current user: public

If you have questions about the server, please let us know.

Query: IDP91840 positive regulator [Streptococcus pyogenes NZ131] Spy49_0449c [Streptococcus pyogenes NZ131], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MKSKLGATLRKVRKGKQISLCFVADEHLSKSQISRFERGESEISCIRLINILDKLHITLDEFLILHDEDYTNSETFANLVQYIRKQYSSQNINNIACLLSDTSDYTLNSFEKTMVKSILHTMDSSIIPSDDELLQLTDYLFKVEKWGYYEILLLGNCVRTINYNSYFLLTKEMLNNYIYSSRNKTNKRIVTQLAINCFILSINKEEFSNCSYLIDEIKTLLDNELNFYEQTVFLYATGYFEFKRLLETGVEKMKQAIQVLDILNEDKLKLHYADHFDKLVNKDLast
1 -92.900IDP91840 positive regulator [Streptococcus pyogenes NZ131] Spy49_0449c [Streptococcus pyogenes NZ131]  ali  100  1MKSKLGATLRKVRKGKQISLCFVADEHLSKSQISRFERGESEISCIRLINILDKLHITLDEFLILHDEDYTNSETFANLVQYIRKQYSSQNINNIACLLSDTSDYTLNSFEKTMVKSILHTMDSSIIPSDDELLQLTDYLFKVEKWGYYEILLLGNCVRTINYNSYFLLTKEMLNNYIYSSRNKTNKRIVTQLAINCFILSINKEEFSNCSYLIDEIKTLLDNELNFYEQTVFLYATGYFEFKRLLETGVEKMKQAIQVLDILNEDKLKLHYADHFDKLVNKD 283
2 -89.400IDP91845 gene: mutR; putative positive transcriptional regulator MutR [Streptococcus pneumoniae R6] spr0960 [Streptococcus pneumoniae R6]  ali follow..  89  1MKSKLGVTLRKIRKGKQISLCSVADEHLSKSQISRFERGESEISCIRLINILDKLHITLDEFLILHDEDYTKTESFANLVQYIRKQYSSQSINNIACLLSDTSDYTLNSFEKTMVKSILHTMDSNIIPSDEELLHLTDYLFKIEKWGYYEIILLGNCVRTINYNSYFLLTKEMLNNYIYSSLNKTNKQIVSQLAINCFILSIDKEEFSNCSYLISKIKTLLDNELNFYEQTVFLYATGYFEFKRCQTSGIEKMKQAIQVFDILGENKLKLHYTDHFNKPVNKK 284
3 -84.600IDP91839 gene: mutR; positive transcriptional regulator [Streptococcus pyogenes NZ131] Spy49_0415 [Streptococcus pyogenes NZ131]  ali follow..  51  1MEKELGKTLRRLRKGKQVSISFLADEYLSKSQISRFERGESEITCSRLLNLLDKLNITIDEFVSAHSKTHTHFFTLLSQARKCYAEKNVVKLTKLLKDYAHKD------YERTMIKAILFSIDSSIAPSQEELTRLTDYLFKVEQWGYYEIILLGNCSRFMNYNTLFLLTKEMVASFAYSEQNKTNKMLVTQLSINCLIISIDHSCFEHSRYLINKIDLLLRDELNFYEKTVFLYVHGYYKLKQEEMSGEEDMRQALQIFKYLGEDSLYYSYKEHYRQIVLGG 277
4 -82.800IDP91849 XRE family transcriptional regulator [Streptococcus thermophilus LMD-9] STER_1358 [Streptococcus thermophilus LMD-9]  ali follow..  23  1.MKKFGEIFKKFRESRGLRLKDVAKAGISTSQLSRFEKGETDLTISKFMFILDEINMPIDEFMYAVHDFHRDENELLSKVRHFVSTRDVEGMKKLLYSQMEDRREKFHQINIILLKIRLQDLSGETYYTKDDLTYLTDYLFSVEYWGYYELLIFSNTLDVLNHDVFMVLAREMFRRSDFYKEIPNNRRLISTMLLNGYITCVEREKFMDALYFEKQLNQCFFIETEVYERLVFKYAQNLYQYKEDGVKAIIEMKKCVGAMKLAGSHHLAKTYEGHLEKILASS 286
5 -81.600IDP91844 Rgg/GadR/MutR family transcriptional regulator [Streptococcus agalactiae A909] SAK_1520 [Streptococcus agalactiae A909]  ali follow..  50  1MEKELGKTLRRLRKGKKVSISSLADEHLSKSQISRFERGESEITCSRLLNILDKLNITIDEFVSIHSKAHTHFFILLNRVRKYCAEKNVTKLVALLEDHNHKD------YEKIMIKALIFSIDQSIEPNQEELARLTDYLFTVEQWGYYEIILLGNCSRLINYNTLFLLTKEMVNSFAYSEQNKTNKILVTQLAINCLIISIDHSYFEHSHYLIDKVRSLLQDEVNFYEKTVFLYVTGYYHLKLGDSSGKEDMRKALQIFKYLGEDSFYNTYNEHYCQKVLGN 278
6 -81.400IDP91848 XRE family transcriptional regulator [Streptococcus thermophilus LMD-9] STER_1530 [Streptococcus thermophilus LMD-9]  ali follow..  24  1.MKEFGAIFKKFRKSRGIRLKDVAKAGISTSQLSRFEKGQTDLTITKFMLILDEINMPIDEFMYAVHDFHRDDNELLSKIRLFVSTHDIDGLKKLLSSQLEPKREKFHHINTILLKIRLQDLSGESYYTQQDLADLTDYLFSVEYWGYYELLIFANTLDVLNHETLMVLAKEMSRRSDFYKEIPNNRRMISTMLLNVYITCIEREELIDALYFEKQLNQCFFIETEIYERLVFQYAQNYYQYKKEGNQSIIEMKKYIGAMKLAGSEHIAKTYEAHLKKLIEEN 286
7 -81.300IDP91852 DNA-binding protein [Streptococcus equi subsp. zooepidemicus] SZO_12400 [Streptococcus equi subsp. zooepidemicus]  ali follow..  23  3VLNHFGKLFKKFRESRGLLLKDVAKAGISTSQLSRFENGETDLTISKFMSALDEINMPIDEFMYAVHDFHRDENELLSKVRHFVSTRDVEGMKKLLYSQMENKREKFHQINTILLKIRLQELSGETCYSDHDLSYLTDYLFSVEYWGYYELLIFSNTLDVLKHDVFMVLAREMSRRSDFYREIPNNRRLISTMLLNAYITCIGQGELIDALYFEKQLNQCFFIETEVYERLVFQYAHHLYKYKKTGCKAIIEMKKCIAAMTLAGSNHLAKTYEGHLKKIIASK 289
8 -81.200IDP91853 transcriptional regulator [Streptococcus equi subsp. zooepidemicus] SZO_17730 [Streptococcus equi subsp. zooepidemicus]  ali follow..  22  1.MKNFGEIFKKFRESRGLKLKDVAKAGISTSQLSRFEKGETDLTISKFMLILDEINMPIDEFMYAVHDFHRDENELLSKVRHFVSNHDVDGLKKLLYSQMESKQEKFHKLNIILLKIRLQDLSGEAYYSSGDLSYLTDSLFSVEYWGYYELLIFSNTLDVLKHDVFMVLAREMSRRSDFYKEIPNNRRLISSMLLNGYITCVERGKFLDALYFEKQLNQCFFTETEIYERLVFQYAQHLYHYKKEKCKAIIEMRKCIAAMKLAGSNHLSKTYEGHLEKVLAEK 286
9 -81.000IDP91851 XRE family transcriptional regulator [Streptococcus dysgalactiae subsp. equisimilis GGS_124] SDEG_1013 [Streptococcus dysgalactiae subsp. equisimilis GGS_124]  ali follow..  24  1.MKNFGEIFKKFRESRGLKLKDIAKAGISTSQLSRFEKGETDLTVSKFMLILDEINMPIDEFMYAVHDFRRDDNELLLKVRHFVSTRDIEGMKKLLYSQMENKRQKFHQINMILLKIRLQDLSGENYYDKKDLDDLTDYLFSVEYWGYYELLIFMNTLDVLNHDVFMVLAREMSRRSDFYKEIPNNRRLISTMLLNAYITCIEREKFIDALYFEKLLNQCFFIETEIYERLVFKYAQNLYLYKKERSNAVTEMKNCITAILLAGSNSLAKTYEGHLKKTLAED 286
10 -80.500IDP91846 DNA-binding protein [Streptococcus suis P1/7] SSU1789 [Streptococcus suis P1/7]  ali follow..  24  1.MSCFGKTLKFIREGKGKSLAEVAKGHISTSQLSRFENGESDITVSKLFGVLAEMNVDVDEFVYASQDFKKDELTRILEQLKQSIYIRDVVLSEQLAKAERDSRREFHRLNAILIAYKLRNLDKTIVVSKEDTAFLTDYLFRVENWSYYEILLFANTIDKLGHQTMMLFCRELIHRTQFYREMKQHRLVVSQVLLSAYLVSVQTKELVDAIFLEKTIEGLLFDETEIFERILFKFGKAFYDYQNTGSNAILEMRKCIGLLRAVDSQNIADWYESILEKILIE. 287
11 -80.300IDP91842 positive transcriptional regulator MutRfamily [Streptococcus pneumoniae G54] SPG_1268 [Streptococcus pneumoniae G54]  ali follow..  30  1..MILGETYRKIREEKGISISSLAGAEISKSQISRFELGETEISVFKLLYLLERIGVTLEEFLLICNHYQPSDFNTLIASVKQAAYNEDLDMVEKEMELFRGTNSHYHKLNAIFIESIVSGMDKNHQLSRQDASYLTNYLFSVENWGYYETLILGNCCRVLSPDLLFRYTKEALKKGKLYSPIPRNRQSLIQLLLNSLIIMIENDLYEESLFLKQATKNILADSTDFFEQTILLYLDGYLELKFYHQKSLLKIKEALKIFELFNKTIYKNYKQYFEKHIIH.. 284
12 -80.200IDP91855 XRE family transcriptional regulator [Streptococcus thermophilus LMD-9] STER_1299 [Streptococcus thermophilus LMD-9]  ali follow..  16  5ELLKLGEFYKELRIARKVKQKDVAKNKLSVSQLSKFESGQTMLSADKMLEVIEGINLTFSEFGFALRDYKPTQHQLLMNKISKLSAENDKQSLLKLLDKYKESQLLYDKLNTLVIKNAIHLIDRDFTLSLDDSKFLSNYLFDIEDWTAYEIHLFGNTMPFLSDTDLLFLGKELVSRSEIYSPLLDFRKALKYTYLNLISELVERRLTTHFNFFVNQLRMI-LDVFDTFEIILLNFLVLVYSYLIENSVNLEEVEQYILKVSEIEQLGLSKILEQRLSQYLRTN 286
13 -79.600IDP91847 XRE family transcriptional regulator [Streptococcus thermophilus LMD-9] STER_0934 [Streptococcus thermophilus LMD-9]  ali follow..  22  1.MKDYGKLFKKFRESRGLVLKDIAKLGVSVSHISRFERENTDLTISKFMSALNAINMPIDEFMYAANDFQRDENEILEKISLFVSARNVSGMEKLLISQVEEKRETFYTLNTILIKIRLQDLSDKSYYDESDIQYLSDYLFSVEYWGCYELLLFANTVDVLNHQTMMLLSREMCKRSEFYKDLPNYRRLHSTMLLNCYIISIERDEYIDALYFEKQLNHSCFTETEIYEKLVFHYSKNLYELKKNRNKAILEMKKCITAMKLANSENLAIKFENHLSGVLK.. 284
14 -79.400IDP91854 transcriptional regulator [Streptococcus pneumoniae TIGR4] SP_0141 [Streptococcus pneumoniae TIGR4]  ali follow..  18  3ERMELGEFYKELRLARKLKQSDVACEGLTASQLSKFELGQSMLSADKLILAIQGINVTFDEFGHKLNNYQESPHMRIGRKVVNRFAHQDIAALELEEVDQEQMAQTYRRLNAIVIKDAIHSLNKSYPLAEEDSEFLTTYLYAIESWTWFELYLFCNTMPFLSNQDLIFLSTSLLEKSKEFKELVHNRLYMKQGLLNILSELMERKLFSYIPIFEAELERMLRPYD-VFEKVSWQFLKKMSVFLQTKGSNQKEIERFIQSLQVLENPQLIALFELRFQQYKEL. 285
15 -79.300IDP91843 positive transcriptional regulator, MutR family [Streptococcus equi subsp. zooepidemicus MGCS10565] Sez_0050 [Streptococcus equi subsp. zooepidemicus MGCS10565]  ali follow..  30  1..MILGETYRKMREEKGISISSLAGYEISKSQISRFELGETEISIFKLLYLLEKIGITFEEFLLACNNYEPSEFNTLIKAVQNSAYNNKISMIEQENKLFEETNSHYHKLNSIFIQSIISELDNNHQLTNQDISYLSNYLFSVENWGYYETLILGNCCRSLPPKLLFKYTKEALKKGTLYNSIPRNKQSLIQLLLNSLLLMIENDFYEEAIFLNQASKNLLSNSTYFFELTILLYLEGYLELKFNIEKSNSKIEEALKIFNSLNKTIYQNYQEHFNKYISN.. 285
16 -79.100IDP91850 gene: rgg; putative transcriptional regulator [Streptococcus mutans UA159] SMU.1509 [Streptococcus mutans UA159]  ali follow..  23  1.MTEYGKIFKKFRESRGLKMKEVAGSNLSTSHLSRFENGESELTISKLMTALYKINMPIEEFMYAANDFHQDENELLKDVRECVNNKDVERLKAVLIKQQEKEGRIFHHLNVILVKIRLQDLSGETYYSKADLDYLTNYLFKVEYWGFYELLLFTNTIDVFKHETFMVLSREMMRRSDFYKEIPRNRRLISRMALNSFITCIERDKLIDALYFEKQLSICHFDETEIYERLVFHYAQNLFAYKKYKTFAIIEMKKSVAAMKLAGSLHIAETYENHLQKILEG. 285
17 -78.500IDP91856 MutR [Streptococcus pneumoniae Hungary19A-6] SPH_0253 [Streptococcus pneumoniae Hungary19A-6]  ali follow..  18  3EKMELGEFYKELRLARKLKQSDVACAGLTASQLSKFELGQSMLSADKLILAIQGINVTFDEFGHKLNNYQESPMRIGRKVVNRFAHQDIAALEQLLEEVDQEMAQTYRRLNAIVIKDAIHSLNKSYPLAEEDSEFLTTYLYAIESWTWFELYLFCNTMPFLSNQDLIFLSTSLLEKSKEFKELVHNRLYMKQGLLNILSELMERKLFSYIPIFEAELERML-RPYDVFEKVSWQFLKKMSVFLQTKGSNQKEIERFIQSLQVLENPQLTSLFELRFQQYKEL. 285
18 -78.400IDP91857 MutR [Streptococcus pneumoniae P1031] SPP_0211 [Streptococcus pneumoniae P1031]  ali follow..  17  3EKMELGEFYKELRLARKLKQSDVACAGLTASQLSKFELGQSMLSADKLILAIQGINMNFDEFGHKLNNYQESPHMRIGRRVVDCFSHQDIAALELEEVDQEQMAQTYRRLNAIVIKNALHSLDKSYPLTEEDSEFLTTYLYAIESWTWFELYLFCNTMPFLSNQDLIFLSTSLLEKSKEFKELVHNRWYMKSGYLNIISELMERKLFSYIPIFEAELERMLRPYD-VFEKVLWQFLKKMQIFLQTKGSNQKEIEHFIQSLQVLENPQLTALFELRLQQYKEL. 285
19 -57.700IDP91841 MutR family transcriptional regulator [Streptococcus thermophilus LMG 18311] stu0182 [Streptococcus thermophilus LMG 18311]  ali follow..  26  1............................................MIKFLSALDFINVSIEEFMVIYRGYRNDSEELLKKLHTLSLTKDAEGLRYLFNEVEELPNSTTKKIEKILILSCLSSVESENLITQSDLRFVTDYLFGIESWGYYELSILGNLAQYINGETLVSLGREVLRKTDYYYEVVRNSKLVIQLSINIMIRCIESEWFTKAAFFERHIDSLVNVESDMYEKVIFSYVQGYLKFAMGDSGGKQIMQESLEIFKLLKNTRLYKNYLEHFKSIVG.. 238
20 -51.300IDP91866 hypothetical protein SPy_0037 [Streptococcus pyogenes M1 GAS] SPy_0037 [Streptococcus pyogenes M1 GAS]  ali follow..  12  1MLEHFGGKVKVLRLEKRISREDLCGDELSVRQLARIELGQSIPSLSKVIFIAKALNVSVGYLTDGADLELPKRKELKYLILRTPTYMDDGKLQVREEQFDEIFEDYYDKIIDCLQATLDTLLSENTNFGIDLLQEYFNQIKTKVRFRQNDLILLELYLAYLDIEGMDGQYSDKIFYDSLLDNLLDELFIVNKIIIDISSLSLKNNRLDNLEKAIEMSQKIMAKIQDWNRMPILKLIEWKYFLIKDIIKAEQSFMKACLFAQMTADQYLENKLIQEWEKDVKS. 302
21 -51.000IDP91832 putative transcriptional regulator [Streptococcus mutans UA159] SMU.61 [Streptococcus mutans UA159]  ali follow..  12  1MLKDFGKKIKSLRLEKGLTKEAVCESQLSTRQLTRIESGQSTPTLNKAVYIAGRLGVTLGYLTDGENVELPSRYKELKYLLLRTPTYGDQQFDEIFSQFYDDLPEEEQLIIDGLQSKLDIHFSDNIDFGVGILNDYFDQILRKTNYQVNDLILIDLYFSCLTVSGLDSAIFDSRKYNQLLETLLKQVDVLNNVLLNNFGLLLELKKYDFVKQLIAVSNKIMDRTHDFQKKPIVNLLTWKHHLFVDYAEAKKSYDAAILFAQLTENINLRENLEKEWQKDSQN. 302
22 -49.000IDP91859 DNA-binding protein [Streptococcus agalactiae A909] SAK_0081 [Streptococcus agalactiae A909]  ali follow..  12  1MLKHFGSKVRKFRESQQVTREEFCGDELSVRQLARIEAGESVPNLSKAHYIARNLGVSLDSLTAGASLELSKKKELKYLILRTPTYNDTDRLDLIEKYLDEIYLEDEKIAIESIQSSLDIYISKSHHFGDDLIREYMNQIKRKKIYSINDLLIIKLWQYKITASRYDPNIFKIDTFIGTIDKLLNQVKLLRDVLIYSLGILFILAEYQQIENIINTLNDILIKTQDFQKRPIIDMFEWKYQLFYNREVAKRKYQESTLFAQLIGDQVLVTQLKEEWKADYIE. 302
23 -47.700IDP91861 transcriptional regulator [Streptococcus dysgalactiae subsp. equisimilis GGS_124] SDEG_0056 [Streptococcus dysgalactiae subsp. equisimilis GGS_124]  ali follow..  12  1MLEHFGEKVRGLRLEKGISREELCGDELSVRQLARIELGQSIPSLAKVIFIAKALEVSVGYLTDGANLELPKRKELKYLILRTPTYMDDRKLQVRESQFDEIFENYYDQLIECLQATLDTLLSENINFGVELLQEYFKQTKVKLRFKQNDLILIELYLAYLDIEGMYGEYSDKVFYDSLLDNLLDELFIVNKIIIDISSLSIKTNKLDNLEKTIAISQKIMAKIQDWNRMPILKLIEWKYFLIKNRKQAEESYTKACLFAQITGDKYLEEQLIKEWEKDICA. 302
24 -46.300IDP91862 DNA-binding protein [Streptococcus equi subsp. zooepidemicus] SZO_00390 [Streptococcus equi subsp. zooepidemicus]  ali follow..  13  1MLDNFGEKVRDLRYQKKITREDLCGSELSIRQLARIELGQSIPSLSKVVFIAKALDVSVGFLTDGEDLELPKRYKELKYLILRTPTYMDDDFNEIFEDYYDQLPEEEKLVVDCLQSIMDTLLTENINFGVGLLQEYFEQTKSKTQFRENDLILIELYLAYLDIAGMNGEYSDKGFYDSLLDILLEELFIVNKIAIGISSLSIKNNKPEILEKVIVLSQKIILKTQDFNRMPILNLIEWKYALMKDIEMAKKCYDKACLFAQLTGDQYLEKKLREEWGKDIKR. 302
25 -46.100IDP91865 DNA-binding protein [Streptococcus pyogenes str. Manfredo] SpyM50034 [Streptococcus pyogenes str. Manfredo]  ali follow..  12  1MLEHFGGKVKVLRLEKRISREDLCGDELSVRQLARIELGQSIPSLSKVIFIAKALNVSVGYLTDGADLELPKRYKELKYLILRTPTYMDDGFDEIFEDYYDKLPEEEKVAVDIIQAKFEVYQTGDINFGYSILKEFLPQLKRKSIYNLNELLLIDLYLIILVVSHFSDDIFDVQFYEEITESMLKQHNLLNNILLSCADTYIRLKMFGRLKETLQLSHFIMSTIQDFQKMPMYCMYEWKLSIFYDINRARNYFEQSILFTQMTGDTYLVQKLRGEWNKDIHY. 302
26 -44.700IDP91858 hypothetical protein gbs0048 [Streptococcus agalactiae NEM316] NP_734518 [Streptococcus agalactiae NEM316]  ali follow..  11  1MLKHFGSKVRNLRVTRNITREDFCGD-LSVRQLARIESGQSIPNLTKAHYIAKQLNVKLDILTGGESLELPKRKELKYKLLRTPTYGDANRLAVREAYFDEIYEVFYEELIDCMQSKLDVHFSVNDNFGITILHDYFDQIKKKKEYTTNDFVMIDLYLLCFSINSLENYHFIMSKLLEQDNLLPEDNFQLNNVLLNHVELAFQFKQKKYVQQIIHRSNAIMTEIHDFQKRPILSLIEWKYLLIIDRTKAETCFKQSILFAELIGDLYLKGKLIEEWNKDLT.. 300
27 -43.800IDP91838 cro/CI family transcriptional regulator [Streptococcus bovis ATCC 700338] HMPREF9319_0022 [Streptococcus equinus ATCC 700338]  ali follow..  13  1.MEKFGIKVRALREKKGISREEFCGDELSVRQLARIEKGQSVPTLNKVGYIAKVLGVTIGELTDGKNLELSTRKELKYLLLRTPTYGDEERLKRQTSYFDEISEEEERLIIDCLQSKLDVHFSDDVNFGEGILNDYFDQVIRKKNFQINDLVLIDLYFACLGIYSLDLYDKLMECLLDQENLSPETSLILNNVLLNNVDLVLRFHRESFMKRIIIKSDTIMTSVHDFQRRPVLSLVEWKYYLQFDFLAAQKSYSNAILFANLIGDTYLENKLIEEWNNDTT.. 299
28 -43.400IDP91834 DNA-binding helix-turn-helix protein [Streptococcus downei F0415] HMPREF9176_0709 [Streptococcus downei F0415]  ali follow..  13  3FKSKIGPQIRQKREAKQLSREKLCHDGLTVRQLIRIEKGQSLPSLDKLDYIAQQLGLKPSDLLAEEELTIPDTYFELKHRLVKFPTYGDPEIEEAYEKYFTVLPEEELLFLDLSEKILNWSQTKKLVAIEEIYEDAFEQLQEKKIYNLNDLMVLGYYLIGIDKKLFNKLKNRLLEQEPSTDE--LYNIDLLSILISVLGVYVQHGDYGATLPVFKKVYQLIEETQQPSYRPSVMMVEAKYYLNVDKEQAGQLYDQAINFATLLGDQVLADGLREEKDRD.... 297
29 -43.300IDP91860 Cro/CI family transcriptional regulator [Streptococcus agalactiae 2603V/R] SAG0048 [Streptococcus agalactiae 2603V/R]  ali follow..  10  1MLKHFGSKVRNLRVTRNITREDFCGD-LSVRQLARIESGQSIPNLTKAHYIAKQLNVKLDILTGGESLELPKRYKELKYLILRIPTYADAEFDHIFEEFYDNLPEDECLAIDSLQAKFEVYQTGDINFGVEVLCECFDKVKYKEKYTLNDLIIIDLFLTCAVVSKFNNRAFTKEVFQTICKTLISQNHWFNHVLLNCVFVGLCLNSEECLAEMLEVSRQTMVSTHDFHKMPLYFMYQWKYFITIDIKSAENAYQQSIMFSKMIDDKHLIKKLELEWQEDITG. 302
30 -43.100IDP91836 Cro/CI family transcriptional regulator [Streptococcus gallolyticus UCN34] GALLO_0038 [Streptococcus gallolyticus UCN34]  ali follow..  12  1.MEKFGIKVRALREKKGISREEFCGDELSVRQLARIEKGQSVPTLNKVGYIAKVLGVTIGELTDGKNLELPTRYKELKYLLLRTPTYGDKEFDEISEKYYEVIPEEERLIIDCLQSKIDVHFSDDVNFGEGILNDYFDQVRRKKNFQINDLILIDLYFACLASAKSFVGIYSLDLYDELMECLLNQENILNNVLLNNVDLVLRFHRESFMKRIIIKSDTIMTSVHDFQRRPVLSLVEWKYYLQFDFLAAQKSYSNAILFANLIGDTYLENKLIEEWNNDTT.. 299
31 -42.900IDP91833 DNA-binding protein [Streptococcus suis SC84] SSUSC84_0046 [Streptococcus suis SC84]  ali follow..  10  3.DKEFGQRVRQLRESASMTREQFCDDELSVRQLTRIEAGASKPTFSKIQYIATRLGMGLYELMPDYVSLPERYSKLKFDVLRTPTYGNEDLAEKRDAMMTEIYDDYYDELIDAIQSRIDTLESGTAGFGKEILEDYFEQIFRKRKYELNDLLIVRLHLEYVIFRQFLKIIEHLHEQINIINS--NDLFVLRDTLLSCVNILGSKKYYEPIPKIFDSVDKIIQSTQDFQKKPIVSVLKWKYALFVDRDEAEKHYLDAVLFAKLIENRELEQKIEEDWRVDNQ.. 299
32 -41.500IDP91835 DNA-binding protein [Streptococcus equinus ATCC 9812] HMPREF0819_1750 [Streptococcus equinus ATCC 9812]  ali follow..  13  1.MKKFGNKIRILREKKGISREEFCGD-LSVRQLARIELNQSIPNLSKAQFIANRLGVKLGTLTDGDSLELPKRYKELKYLLLRTPTYGDQEFDEISENYYDIIPEEEKLIIDCLQSKFDVHFSDDVNFGDGILNDYFDQVIRKETFNINDLILIDLYCVCMGIYSLDIYDNLMDCLLNQSHVTPETSLILNNVLLNNIALAFKFEREDYVYKVIKISDRIMTEIHDFQRRPILSLVEWKYYLKFDYDSAKQSFTHATLFARLIGDVYLENKLKEEWKFDTTT. 300
33 -40.300IDP91867 DNA-binding protein [Streptococcus uberis 0140J] SUB0057 [Streptococcus uberis 0140J]  ali follow..  13  1.MQGLGLKMKELRKKKQMTREALCGDELSVRQLARIESGQSNPSLAKALFIAKKLGVPLSDFVNPKELDLPKRYQELKYLILRHPTYMNTDFDIIFEDYYADLPEEEQVLIDRLRSRFEVYQSGNSVYGQDLLLEYIDQIKKKKTYDLNDIFFIDLYLTCGYVSSFKGIFECFTSKLILLEEKLDFKDLLNNVLMTAIAVGLTLEEYVKIRTLLNVCRRIMTITQDFQRMPIYYMYEWRYTLFHDFRKAPYYYQQSLLFARTHGDEYLKTMIVNAWQEDQDK. 301
34 -40.000IDP91863 DNA-binding protein [Streptococcus parauberis KCTC 11537] STP_0036 [Streptococcus parauberis KCTC 11537]  ali follow..  12  1.MPELGDKIKAIRLGKKLTRESICGD-LSVRQLVRIEQNQSLPTLAKLVYLAKVLDIRLDKLINPKTISIPHDYLALKYQIIRTPLYMNDQFDAIFEKYYDYLPDEEKLIIDFLQSKFDVYQSGDANFGRPLLQDYIRQISKKKRYQINDIFLIDLYLTCAIVSSFKAEFFDLDLYRRFLSKLLLMEKLLNNVLLTCIDVGIRIGHFELIQPALKASHRIMYKVQDFQRLPIYCMHAWKNALFYSVKRGEDYFHQAQLFAKLIGDKNLEGKLAREWQKNLAE. 301
35 -39.700IDP91864 transcriptional regulator, Cro/CI family [Streptococcus porcinus str. Jelinkova 176] ZP_08398653 [Streptococcus porcinus str. Jelinkova 176]  ali follow..  12  1.MKKLGKKIQKLRLDKSLTRETICGDELSIRQLARIEKGQSIPSLAKVLFIAKKLELPVVELINPECLVLPKRYKELKYLILRRPTYMNGQFDEIFEDYYATLPEEEQLIIDLLQSRFDVYQSGDTNYGKELLREYISQIRKKKSYALNDIFLIDLYLTCGMVSNFKEELFDKGNFDCFTNKLVLLEDLLNNVLLTSIAVGISIKEYQKTRILLNVCRRIMTITQDFQRMPIYYMYEWKYTLFYDSQKAYYYYRQSLIFARTLTDNYLVNRLKTSWELDNQS. 301
36 -39.500IDP91837 hypothetical protein STRINF_00393 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] STRINF_00393 [Streptococcus infantarius subsp. infantarius ATCC BAA-102]  ali follow..  10  1.MEKFGEKIRLMREEKEISREEFCGD-LSVRQLARIELNQSIPNLSKASFIANRLGVKLGTLTDGDSLELPKRKELKYLLLRTPTYGDQVRLDRKNDYFDEIAEEEERLIIDCLQSKFDVHFSEDVNFGEGILNDYFGQVNRKKVFTINDLILIDLYFACLGIYSLDFYDDLMKRLVNQKHVSPETDLILNNVLLNNIDLAFQFKREYYIERVITISEKIMTEIHDFQRRPILSLVEWKYYLKLDFALAEQSFTNATLFARLVGDTYLENKLKEEWQLDIDA. 300
37 -19.600IDP91375 hypothetical protein VV1_2191 [Vibrio vulnificus CMCP6] VV1_2191 [Vibrio vulnificus CMCP6]  ali follow..  17  9LAEEIGDRLKQARLNRDLTQSEVAEIAIARKTVLNAEKGKVQLDIMIAILMALDLTEQIDLFI............................................................................................................................................................................................................................ 72
38 -18.200IDP00197 putative prophage repressor protein YPO1233 [Yersinia pestis CO92]  ali follow..  19  14.AKRLKELFNAKKKALGISQESVAHELVGQSAVNQFLNGVNPLNITNAAAFAKVLNEPISSFS............................................................................................................................................................................................................................ 76
39 -13.000IDP93919 antidote protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001006180 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  21  10.....GGIIAESLEDLALSINAAARALVAPSTLSRVMRGESAISPEMAVKLEAAGIGTARHWLAMQSGYD..................................................................................................................................................................................................................... 75
40 -11.200IDP06200 hypothetical protein HP0554 [Helicobacter pylori 26695] NP_207349 [Helicobacter pylori 26695]  ali follow..  16  30.ELSLKNLDKNLQILKEVGVAEICKATIASKNIHSILEKRYEVHARGFIQILERYKIDLSAWMKEFDKACTFKEG................................................................................................................................................................................................................ 109
41 -10.300IDP91041 gene: vanUG; predicted transcriptional regulator [Enterococcus faecalis] EFE0002 [Enterococcus faecalis]  ali follow..  15  6......NKLWKLLIDRDMKKGELREAVVSKSTFAKLGKNEN-VSLTVLLAICEYLNCDFGDIIEALPETPDKERD................................................................................................................................................................................................................ 74
42 -10.300IDP02170 helix-turn-helix family protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1010 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  21  1..MAIKIDLAKIMVDKQIKSKDLARAIITEQNLSILKNGKAKIRFSTLEAICKYLECQPGDIL............................................................................................................................................................................................................................ 63

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.