current user: public

If you have questions about the server, please let us know.

Query: IDP91869 gene: aac(6`)-Ih; aac(6`)-Ih [Acinetobacter baumannii] AAC41391 [Acinetobacter baumannii], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
3 -74.200IDP91868 gene: aac(6`)-Ig; aminoglycoside 6`-N-acetyltransferase [Acinetobacter haemolyticus] AAA21889 [Acinetobacter haemolyticus]  ali follow..  65  1MNIKPASEASLKDWLELRNKLWSDSEASHLQEM-HQLLAEKYALQLLAYSDHQAIAMLEASIRFEYVNGTETSPVGFLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMHRSLGFQETEKVVYFSKKID 145
6 -61.600IDP92640 gene: phnO; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4093 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  4CELRPATQYDTDAVYALICELKAEFDHHAFRVGFNANLRDPNMRYHLALLDGEVVGMIGLHLQFHLHHV---NWIGEIQELVVMPQARGLNVGSKLLAWAEEEARQAGAEMTELSTNVKRHDAHRFYLREGYEQSH--FRFTKAL. 144
9 -52.300IDP95032 ; aminoglycoside acetyltransferase [Salmonella enterica subsp. enterica serovar Newport] AAR21614 [Salmonella enterica subsp. enterica serovar Newport]  ali follow..  14  3VEIIHLTGNDVALLQSINAMF-SYARNKPSSSYLQKLLSTSSFIALAAVDEQKVIGAIAAYELQKFEQQ---RSEIYIYDLAVAATRRREGIATALIKKLKAIGAARGAYVIYVQADKEDQPAIELYKKLGTIEDVFHFDIAVE.. 152
17 -47.400IDP92645 gene: ypeA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2434 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  1MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGY---------DGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVLSLGKR... 134
18 -45.700IDP00087 gene: STM2449; putative acetyltransferase NTL01ST2379 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  38MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKVNHDVSLFLVAEVSGEVVGTVMGGY---------DGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQIMVRDDNDVVLGMYERLGYEHSDA-LSLGKRL. 172
21 -43.800IDP05730 putative acetyltransferase [Clostridium difficile 630] CD0675 [Peptoclostridium difficile 630]  ali follow..  14  5IKFIKAEEKYIYSYWQTFDKIAKERKEETVEFIKNIINKNLPQLFIIDLESDNCIGWCDVLPKTEKVG---------YLGMGILKEYREKGIGSSLLKQIIDLSKEYGYEKIELDVFKSNSRAIHVYKSLGFVEVNTISSGFT... 148
22 -40.900IDP02595 acetyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1384c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  1MKIREATAKDFDDVVYIWSEFTTNEINNQGKLVVEKYLNNPAFKSFVLTVEDQVIGFSCIK--------------NEILFSTVEQRFLGKGFRSFMLKYLLE-----NYAVDTTYVYSANIQTLAFYTSIGFIIEDK......... 127
24 -40.400IDP92643 gene: rffC; TDP-fucosamine acetyltransferase [Escherichia coli K12] b3790 [Escherichia coli K-12]  ali follow..  40SGAVVAQETDIPALRQLASAAFAQSRFRAPWYAPDASSRFDHQCLILRAASGDIRGYVSLRELN--------------ATDARIGLLAGRGAGAELMQTALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR... 181
26 -39.400IDP92031 N-terminal acetyltransferase complex subunit ARD1, putative [Toxoplasma gondii ME49] TGME49_019760 [Toxoplasma gondii ME49]  ali follow..  10  2ATLRRADVFDLFAMQNANFINLPEN---IMKYYFFHAVSWPQLLSVSHDSQGKLVGYVLAKLEEDD----PTDHHGHVTSVAVLRQSRKLGLASKLMNMTHAMEEVFDADYASLHVRVTNRAAYSLYKHLGYRIHDIDKEYYAD.. 141
27 -39.300IDP92644 gene: yjgM; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4256 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  9PVMRRLTLQDNPAIARVIRQVSAETVADPNLDELYQVYSQPGHAYWVVEYEGEVVGGGGIAPLTG-----SESDICELQKMYFLPAIRGKGLAKKLALMAMEQAREMGFKRCYLETTAFLKEAIALYEHLGFEHIDYAVRMLREL. 167
29 -37.800IDP92642 gene: rimI; ribosomal-protein-S18-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4373 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  2NTISSLETTDLPAAYHIEQRAHAFP---SEKTFASNQ--GERYLNFQLTQNGKMAAFAITQVVLD----------ATLFNIAVDPDYQRQGLGRALLEHLIDELEKRGVATLWLEVRASNAAAIALYESLGFNEATIRRNY..... 129
30 -37.600IDP92646 gene: yjaB; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4012 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  16  3ISIRRSRHEEGEELVAIWCRLSAEYRTELEDLVRSFLP--EAPLWVAVNERDQPVGFMLLS--------------QHMDALFIDPDVRGCGVGRVLVEHALS-----MAPELTTNVNEQNEQAVGFYKKVGFKVTGR......... 127
31 -37.600IDP91766 gene: yhhY; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3441 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  4IVIRHAETRDYEAIRQIHAQPEVYCPHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRPRRSHVAD------GICVDSRWKNRGVASALMREMIEMCDNWRVDRIELTVFVDNAPAIKVYKKYGFEIEGT......... 141
32 -37.200IDP92637 gene: yiaC; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3550 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  19  2..IREAQRSELPAILELWLEIKANYWRDCIPLVRDAYLANAQ--NWVWEEDGKLLGFVSIM------------EGRFLAAMFVAPKAVRRGIGKALMQYVQQ-----RHPHLMLEVYQKNQPAINFYQAQGFHIVDC......... 125
35 -34.800IDP95253 acetyltransferase [Acinetobacter baumannii ATCC 17978] YP_001084790 [Acinetobacter baumannii ATCC 17978]  ali follow..  18  34.....................................LAQGNSRLWIAIQEGTVVGSVQLSLVSKK----NGVHRAEVEKLMVLTSARKQGIATLLLNELENFSKEKGLRLLVLDTREGD-VSELLYSKIGFVRVGVIPNFALS.. 135
37 -34.400IDP92629 gene: yncA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b1448 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  1MSIRFARKADCAAIAEIYNHAIWNDQTVDADNRIAWFEALAGYPVLVSEENGVVTGYASF----GDWRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGIESQNQASLHLHQSLGFVVTAQMPQVGTKFG 150
40 -33.600IDP92633 gene: yafP; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b0234 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  4IQIRNYQPGDFQQLCAIFIRAVTMTASQHYSPQQISAWAQAKSQVWVAIINAQPVGFISRI--------------HYIDMLFVDPEYTRRGVASALLKPLIK-----SESELTVDA---SITAKPFFERYGFQTVKQ......... 129
41 -32.700IDP91819 gene: yjhQ; KpLE2 phage-like element; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4307 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  6FTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFT-RATFKGEMDSPLMHILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFV------LGHATYYPRHGFEPCAG......... 135
42 -32.200IDP92634 gene: yedL; predicted acyltransferase [Escherichia coli str. K-12 substr. MG1655] b1932 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  2FTIKTDDLTHPAVVAYHISGMLQQSPPESSHALDVQKLRNPTVTFWSVWEGEQLAGIGALKLL--------DDKHGELKSMRTAPNYLRRGVASLILRHILQVAQDRCLHRLSLETGTQATACHQLYLKHGFADCEPFRFLSLTLC 153
43 -30.900IDP92639 gene: yhbS; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3156 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  1MLIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLRE-DGFLTLGLVATDDEGQVIGYVAFS---PVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVT------LGDPALYSRFGFELAAH......... 127
44 -30.500IDP95424 set236a-026 [Undefined organism]  ali follow..  15  20......................................AEPRGRLLLAYVDQKPAGCIALR---------IDDGVCEMKRLFVRDEFRGHRLGLLLVEKVIGEARAAGYLKMRLDTFPPKGKAVKLYESHGFREIAPYLFMELDL. 127
46 -29.900IDP95293 gene: aac(6`)-Ib; aminoglycoside 6`-N-acetyltransferase type Ib [Klebsiella pneumoniae] AAL93141 [Klebsiella pneumoniae]  ali follow..  10  25VTLRLMTEHDLAMLYEWLNR--RPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWTDPGVRGIDQLLANASQLGKGLGTKLVRALVELLNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTV........ 177
47 -29.300IDP92638 gene: yiiD; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3888 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  18YHLRVPQEEELERYYQFRWEMLRKPLHQPKGSERDAW-DAMAHHQMVVDEQGNLVAVGRLYI--------NADNEASIRFMAVHPDVQDKGLGTLMAMTLESVARQEGVKRVTCSA---REDAVEFFAKLGFVNQGE......... 143
48 -29.000IDP95485 spermidine acetyltransferase [Staphylococcus aureus] ADV68932 [Staphylococcus aureus]  ali follow..  14  1MKLRALEYSDLLFVHELNNE--PYESLTELQYLFDKHLLDESERRFIVEDENQVVGIVELVEINYIHRNCE--------QIIIKPEFSGKGYAKFAFEKAINYADILNMHKIYLYVDTDNKKAVHIYESQGFKTEGLL........ 140
52 -28.300IDP95484 gene: speG; spermidine acetyltransferase [Yersinia pestis Z176003] ADE65402 [Yersinia pestis Z176003]  ali follow..  11  7VRLRPLEREDLPFVHQLDNN--PYEAFVELCDLYDKHIHDQSERRFIIESQGTKIGLVELVEINHIHRRAE--------QIIIDPTHQGKGYAGAAAKLAMEYGSVLNLYKLYLIVDKENEKAIHIYSKLGFEIEGEL........ 146
54 -27.800IDP91767 gene: speG; spermidine N1-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  7VKLRPLEREDLRYVHQLDNN--PYEAFVELSDLYDKHIHDQSERRFVVECDGEKAGLVELVEINHVHRRAE--------QIIISPEYQGKGLATRAAKLAMDYGTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGEL........ 146
55 -27.100IDP01616 spermidine n1-acetyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] VC_A0947 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  5LTLRALERGDLRFIHNLNNN--YESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAE--------QIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHL........ 145
56 -26.700IDP01688 GNAT family acetyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1313 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  10  5KNFAELNSQEIKLIFKWRNH--KHIDFEEHLRFIRNLHQDSNKKYFLVFQDEQIIGVIDFVNITTKSCEF---------GLYAIP--DLKGVGQVLMNEIKKYAEILKVDTLKAYVFKDNHKALKLYQQNHFTIYDE......... 138
59 -24.200IDP92635 gene: elaA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2267 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  8.HHSELSVSQLYALLQLRCAVFVVEQNCPYQDI-DGDDLTGDNRHILGWKNDELVAYARI------LKSDDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLETCTHHPDKPVYLGA---QAHLQNFYQSFGFIPVTE......... 134
60 -21.400IDP01725 acetyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA2534 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  8LLIRKFEFKDWEAVHEYTSD--VFTEEDTRNFVNKNMGENAKNFPVILIGENILVGHIVFHKYFGEHTY----------GWVFNPKYFNKGYASEAAQATLKYGKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYF........ 146
61 -20.500IDP92628 gene: rimL; ribosomal-protein-L7/L12-serine acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1427 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  11  11LELHAVAENHVKPLYQLICKVQSEEDTRKTVQGNVMLHQRGYAKMFMIFKEDELIGVISFNRIEPLNKTAE--------GYWLDESHQGQGIISQALQALIHHYQSGELRRFVIKCRVDNPQSNQVALRNGFILEG.......... 154
62 -20.500IDP91769 gene: yjcK; ribosomal-protein-alanine acetyltransferase [Yersinia pseudotuberculosis IP 32953] YPTB1890 [Yersinia pseudotuberculosis IP 32953]  ali follow..  12  16IHLLVPDLSRSQEMHQLIVN--EETVFSNMSIASKNFSEDRDEYLIINNHTNQLVGCISLFIRHAQIPYFE--------GYWLSTQAMGYGFITEACILVRDLAHHLKSKRLEIRMARRNIRSSKLAERCGFYCEA.......... 162
63 -19.100IDP92632 gene: rimJ; ribosomal-protein-S5-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1066 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  10  18LVVRLVHDRDAWRLADYYAECYPSGWQARLGMINEFHKQGSAFYFLFDPDEKEIIGVANFS---------GSFHACYL-GYSIGQKWQGKGLMFEALTAAIRYMRTQHIHRIMANYMPHNKRSGDLLARLGFEKEGYAKDYLLIDG 175
64 -18.900IDP92022 glycylpeptide N-tetradecanoyltransferase, putative [Toxoplasma gondii ME49] TGME49_009160 [Toxoplasma gondii ME49]  ali follow..  10  126CECDVRDPEELKEVYDLLSQHYVEDDDNLFRFNYSA-CHRDWVIGVRVSSTNKLVGFITATPSQIRVFS-DSVPMAEVNFLCVHKKLRSKRLAPVLIKEITRRVNLRSIWQAVYTAGVV........................... 253
65 -18.500IDP91269 acetyltransferase, GNAT family [Bacillus anthracis str. Sterne] NT05BA2958 [Bacillus anthracis str. Sterne]  ali follow..  11  11LQLRELTLLDAETMFHYFSK---EQAKTTIQTFKNRYEEGSVFRWIEKKGTGQLIGTCGFHLINHHHKRAE--------GYELDDTYWGQGYASEALQAILTYGETLQLIRIAAVVYVENKASQKLLSKAGFQEEG.......... 153
66 -18.400IDP92630 gene: argA; fused acetylglutamate kinase homolog (inactive)/amino acid N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b2818 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  297.QIRRATINDIGGILELIRPL---EQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYP-------FPEEKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLT----TRSIHWFQERGFTPVDKSKVLMADLG 443
67 -18.400IDP91818 gene: yfiQ; inhibiting acetyltransferase for acetyl-CoA synthetase [Escherichia coli str. K-12 substr. MG1655] b2584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  10  726CLFRPILPEDEPQLQQFISRVTKEDLYYRYFSEINEFTHEDREMAFVADQTEEILGVTRAISDPDNIDA----------AVLVRSDLKGLGLGRRLMEKLITYTRDHGLQRLNGITMPNNRGMVALARKLGFN............. 864
68 -18.100IDP90696 gene: argA; N-acetylglutamate synthase [Yersinia pestis CO92] YPO1022 [Yersinia pestis CO92]  ali follow..  15  296.QVRRATINDIGGILELIRPL---EQQGILVRRSREQLEMEIDKFTIIERDNLTIACAALY--------FPDEHIGEMACVAVHPDYRSSSRGEMLLNRITNQARQMGLKKLFVLT----TRSIHWFQERGFTPAE.......... 416
69 -15.900IDP92641 gene: yjdJ; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4127 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  3.....................................IREGHNKFYINDKQGKQIAEIVFVP--------TGENLAIIEHTDVDESLKGQGIGKQLVAKVVEKMRREKRKIIPL................................ 71
70 -14.500IDP95397 set236a-062 [Undefined organism]  ali follow..  23  3...................................................................................EVDYWSKGIGTKYTKMIFEFLKERNADAVILDPHQDNPRAIRMYQKAGFRIIEDL........ 58
71 -11.600IDP92636 gene: tmcA; elongator methionine tRNA (ac4C34) acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b2474 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  10  361.....SDPETPLKVYQLLSGAHYRTSPLDL----RRMMDAPGQHFLQAAGENEIAGALWLVDEGGLSQQLSQARGRRVSRIAVHPARQREGTGRQLIAGALQYTQDLDYLSVSFGY---TGELWRFWQRCGFV............. 510
72 -10.700IDP95449 set236a-051 [Undefined organism]  ali follow..  11  7VSFRPMSEDDLVLMLKWLTD--DKKHTQKTIREHYTEQWADEIYRVIIEYDTIPIGYAQIY..................................................................................... 75
73 -9.700CPX_01616_91817 Complex of sperminidine SpeG and DNA-binding response regulator RcsB [Undefined organism]  ali follow..  12  5LTLRALERGDLRFIHNLNNN--YESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAE--------QIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHL........ 145

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.