current user: public

If you have questions about the server, please let us know.

Query: IDP91880 hypothetical protein lmo0753 [Listeria monocytogenes EGD-e] NP_464280 [Listeria monocytogenes EGD-e], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MNIRTELQNSQLCEGITEAQLTELMNKITVKEKHYKNNEILFYTDEVTKVYILVKGNAAIAKNTSSGKRILGKNVTEPGELAGEIYYFSHRNPFWDYAIVLEPTTVLEISGIDQGTLQTLDLALQNQLLVNLLKSVTRKFEYIGEKVRMVSEDSVRAKISNYLFGIQDDDGSIELTETREEIADYLDITRPSLSRELGRMQKENIIRIEGSSVIILDAIIFDTFIELast
1 -88.000IDP91880 hypothetical protein lmo0753 [Listeria monocytogenes EGD-e] NP_464280 [Listeria monocytogenes EGD-e]  ali  100  1MNIRTELQNSQLCEGITEAQLTELMNKITVKEKHYKNNEILFYTDEVTKVYILVKGNAAIAKNTSSGKRILGKNVTEPGELAGEIYYFSHRNPFWDYAIVLEPTTVLEISGIDQGTLQTLDLALQNQLLVNLLKSVTRKFEYIGEKVRMVSEDSVRAKISNYLFGIQDDDGSIELTETREEIADYLDITRPSLSRELGRMQKENIIRIEGSSVIILDAIIFDTFIE 226
2 -60.800IDP91810 gene: crp; DNA-binding transcriptional dual regulator [Escherichia coli str. K-12 substr. MG1655] b3357 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  19  1.........MVLGKPQTDPTLEWFLS--HCHIHKYPSKSTLIHQGEAETLYYIVKGSVAVLIKDEEGKEMILS-YLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQL----IQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR....... 210
3 -27.900IDP91407 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinase [Vibrio vulnificus CMCP6] VV1_0729 [Vibrio vulnificus CMCP6]  ali follow..  18  1..MDTRFTQQLQQLNLSADDIALVLSHA--KELQLPTRHILHHQGEPQQFYFLLDGLCHACYLTEDGKEFSK-EFYWEVDWMIGFESAILQQASPFLLETLTPVHLLTFPIELLQHWRSTHHPLYTHLLETQL-------VYKERKERFLLLHTPEQKYHLFK----TSFPTLLERLSDRQIAAYLGITPVSLSRIKNRST......................... 186
4 -11.600IDP91361 NhaP-type Na+/H+ and K+/H+ antiporters [Vibrio vulnificus CMCP6] VV1_2840 [Vibrio vulnificus CMCP6]  ali follow..  11  697.QEQKLINDIPWARELKSKTREELTS--WIEHTVYDAGQLICENQRLNRIGIVSRGSITELYETRSDDLEKVRTTIGPGETFALISLLTGKTN--AQYVSDTPTDIMWLPVDKLKLL----MNQDPNLTAVVCQLFKQLKS..................................................................................... 830
5 -11.000IDP00626 gene: sarT; staphylococcal accessory regulator T SACOL2506 [Staphylococcus aureus subsp. aureus COL]  ali follow..  15  5............................................................................................................................KSKSNIKLMKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDVFKNDEGKY----FMRDIISYIGIDQSRIVKSVKDLSKKGYLN-DSRNVIIVVSVKQHNYIK 107
6 -9.610IDP00871 gene: slyA; transcriptional regulator SlyA STM1444 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  17  2............................................................................................................................ESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPD-------QSQIQLAKAIGIEQPSLVRTLDQLEDKGLIS................... 77
7 -9.450IDP00098 gene: slyA; transcriptional regulator NT01SF2011 [Shigella flexneri 2a str. 2457T]  ali follow..  17  1.........................................................................................................................MKLESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPD-------QSQIQLAKAIGIEQPSLVRTLDQLEEKGLIS................... 79
8 -9.020IDP01519 hypothetical protein VC2149 VC2149 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  1.....................................................................................................................................................MELSPVFARRLYLALLVESLERP-----NVPKLIEKTGWPRRTIQDVIKAMPGIGIE.................... 52
9 -8.780IDP01032 gene: yhgG; putative cytoplasmic protein STM3507 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  7..................................................................................................................................................................VRDLLALRGRMEA----TQISHTLHAPQPMIDAMLNQLEIMGKAV................... 47
10 -8.700IDP93833 DNA-binding transcriptional repressor ArsR [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007538 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  12  9.......................................................................................................................................................FKNLSDETRLGIVLLLKEMGELCV-----DLCTALDESQPKISRHLAMLRESGLLLDRKQ............... 64

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.