current user: public

If you have questions about the server, please let us know.

Query: IDP91977 D-alanyl-D-alanine carboxypeptidase [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007810 [Streptococcus pneumoniae str. Canada MDR_19A], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst MKKRYVILSGLLALTLAACSQEKTKVEENTQKTEQSSQPEGTVGSKSQASSQKKAEVSNKGSYYSIQGKYDEIILANKRYPLSKDYNPGENPTAKAELLKLIAAMQAEGYPISDQYSGFRSYETQAKLYQDYVNQDGKEAADRYSARPGYSEHQTGLAFDLIGTDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAASGLSLEEYYGFEGGDYVDLast
1 -104.000IDP91977 D-alanyl-D-alanine carboxypeptidase [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007810 [Streptococcus pneumoniae str. Canada MDR_19A]  ali  100  1MKKRYVILSGLLALTLAACSQEKTKVEENTQKTEQSSQPEGTVGSKSQASSQKKAEVSNKGSYYSIQGKYDEIILANKRYPLSKDYNPGENPTAKAELLKLIAAMQAEGYPISDQYSGFRSYETQAKLYQDYVNQDGKEAADRYSARPGYSEHQTGLAFDLIGTDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAASGLSLEEYYGFEGGDYVD 238
2 -88.700IDP02154 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA2526 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  31  1MRIKLVGIFTCMIVILGIFIVYTNQSIGKEPRKTNYETRENSINKEKNSTSNN-----------IASSFASVQAVVNKEYGLPEDYKPEDLVEAAEALERLFDLANKEGIQLN-AVSGFRSYDYQKKLYANNVKRKGQEHTDRFSAKPGHSEHQTGLTMDVSSKSALTFANTKEGKWLKENAHRAGFIIRYPKGKESITGYAYEPWHIRYVGDIAESIYKKKLTLEEYMNL....... 243
3 -85.800IDP02767 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA4750 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  30  1MKKIIIISAATIVIGITSFAGSKSPLQNEARAVESQQHSNHQKEEIPAFPKADHNAKKLDNDFSVVTNPDSNLVLVNKHRKLPDGYTPEDLTDAADALENMFEAAKKEGLELT-AVSGYRSYKRQKSLHDTYVRRQGKAEADSVSAIPGTSEHQTGLAMDISSKSAPIFGETAEGKWVAKHAHEFGFVIRYLEDKTETTEYSYEPWHLRYVGNPATYIYKHHLTLEEAMED....... 257
4 -78.500IDP91775 gene: vanXYE; VanXYE [Enterococcus faecalis] AAL27443 [Enterococcus faecalis]  ali follow..  32  3.....................................................................KNYLRLINENNEIKDSERPSHLVMVAIQLEKLIKTTGLDSQ--IITIDGYRSKETQQALWDETIQEKGLEFAHKYVAKPGCSEHEIGLAVDLGLATKPSFTDSPIVDKFLKHMTDFGFILRYQKGKESITNINYEPWHFRYVGTPSSIMVQQNWVLEEYIEFIES.... 185
5 -78.500IDP91778 gene: vanXYc; D,D-dipeptidase/D,D-carboxypeptidase VanXYc [Enterococcus gallinarum] AF132548_1 [Enterococcus gallinarum]  ali follow..  29  2......................................................................NTLQLINKNHPLKKNQEPPHLVEVAKQWERLVRATGLEK---IRLVDGYRTEKEQRRLWEYSLKENGLAYTKQFVALPGCSEHQIGLAIDVGLKKQPHFRDSAAADLFMQQMMNYGFILRYPEDKQEITGISYEPWHFRYVGLPSQVITAQKWTLEEYHDYLAQTVRQ 188
6 -77.500IDP92726 gene: ddcY; metallo D,D carboxypeptidase [Enterococcus faecium] ADD91671 [Enterococcus faecium]  ali follow..  32  18...............................................TSIGLFFRKTPQKIQVCGEERDSWNLLLVNAKHKIPQGYTVELQKRIYPDLQLMLDAARAEGIYPK-IVSSFRTTEDQEKIMEDKIAQKAKEEAAKWVAAPGTSEHELGLAVDINAES-SISTDKEVYEWLADNAYQYGFILRYPSNKVYITGVGYEPWHYRYVGKKAKKITEAGITLEEYLGK....... 218
7 -77.400IDP91871 gene: vanYB; D,D-carboxypeptidase [Enterococcus faecalis] AAB05624 [Enterococcus faecalis]  ali follow..  25  20.SGEKRAFLWAFIISFTVCTLFLGWRLVSVLEATQLPPIPATHTGSGTGVAENPEENTLATAKEQGDEQEWSLILVNRQNPIPAQYDVELEQRISPYLQDLFDAARADGVYPI-VASGYRTTEKQQEIMDEKVAEQAKAEAETWVAVPGTSEHQLGLAVDINADG-IHSTGNEVYRWLDENSYRFGFIRRYPPDKTEITGVSNEPWHYRYVGIEATKIYHQGLCLEEYLNT....... 266
8 -76.800IDP91044 gene: vanY; vanY [Enterococcus faecalis] EFA0002 [Enterococcus faecalis]  ali follow..  23  1MKKLFFLLLLLFLIYLGY-----DYVNEALFSQEKVEFQNYDQNPKEHLENSGTSENTQEKTITEEQVYQGNLLLINSKYPVRQESVKSDIVEIAQKFSEMVNDAVKGGVSHFIINSGYRDFDEQSVLYQEM--------GAEYALPAGYSEHNSGLSLDVGSSL-TKMERAPEGKWIEENAWKYGFILRYPEDKTELTGIQYEPWHIRYVGLPSAIMKEKNFVLEEYMDY....... 241
9 -76.600IDP01682 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5104 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  24  1MKKWVFISFFIACTICVGVYISPLFQKEIDVKIGGENGAVKNANIEKIEVTKE-------------QIYKGDLLLVNKDYPVKKDSIRSDIIDVVKKFLNVVDAAGKDGVQHFLMNSGYRDFKEQSKLYKEM--------GSDYALPAGYSEHNLGLSLDVGSTQ-KKMEKAPEGKWIEENVWKHGFVLRYPKNKSHITGIQYEPWHIRYVGLPSAIMQKKKITLEEYLDF....... 233
10 -72.700IDP91774 gene: vanXYG; D,D-dipeptidase/D,D-carboxypeptidase [Enterococcus faecalis] AAQ16272 [Enterococcus faecalis]  ali follow..  37  14.....................................................................CGNLLLVNKNYPLRDNNVKGLMKRDVANVLQLIFEKISAGNSIV-PVSGYRSLEEQTAIYDGSLKDNGEDFTRKYVALPNHSEHQTGLAIDLGLNKKPDFPYDGICDEFRRAAPDYGFTQRYARDKEEITGISHEPWHFRYVGYPSKIMQENGFSLEEYTQF....... 192
11 -55.100IDP00223 putative carboxypeptidase YPO3054 [Yersinia pestis CO92]  ali follow..  21  9......................................................................QMLTGLSTDHLVVLSGAHRLQPQAAEAFQAMQQAAKVAGFDLQ-PASTFRDFGRQLAIWNGKFRAARCEAILRWSALPGTSRHHWGSDLDIYDPSDAGGYFYPLTQWLSAHMAEFGFYRPFATDN---GGVAVEPWHLSYRPLAAEHLLTPKILLAAWQS........ 201
12 -31.500IDP91776 gene: vanXD; D,D-dipeptidase VanXD [Enterococcus faecium] ACM47288 [Enterococcus faecium]  ali follow..  17  15.........................................................................IRWDAKYATWDNFTGKPVKELGVALRKAQKMAEKLGYGLL-LWDGYRPQCAVNCFLNWASQPEDNLTKKRYYPNASQSSHSRGSAVDLTIFRLDDVRSHHAASGLSEEESKNRQCLRYIMESSGFEAYRYEWWHYVLADEPPDTYFDFCIA.............. 202
13 -18.900IDP91773 gene: vanXB; D,D-dipeptidase [Enterococcus faecalis] AAB05628 [Enterococcus faecalis]  ali follow..  15  15.........................................................................VRWDAKYATWDNFTGKPVKAVALALREAQIHAARLGYGLL-LWDGYRPKSAVDCFLRWAAQPEDNLTKEKYYPNASQSSHSRGSTIDLTGSNFDFMDERSTAKGIGNAEAQNRRCLRKIMESSGFQSYRFEWWHYKLIDEP........................ 191
14 -17.000IDP91596 gene: vanXst; D-ala-D-ala dipeptidase [Streptomyces toyocaensis] AAD02118 [Streptomyces toyocaensis]  ali follow..  16  21.........................................................................LRWDAKYATWDNFTGKPVKALCAALERARDEAASLGFGLL-LWDGYRPQRAVDCFLRWSQQPEDGRTKSRHYPNAARSGHSRGSTVDLTGGDHDLMDPVSHHGALAPVEARNRQHLRSVMESCGFKAYEYEWWHYTL............................ 193
15 -12.900IDP00233 putative phage-related protein YPO3676 [Yersinia pestis CO92]  ali follow..  12  1.........................................................................MMNDKPTFRLSQISEHNLHHVHPDLVLIVRRALTLSHIDFRVIEGIRTPERQRQMVLN-------------HSKTMNSRHLTGHAVDLAPMVNNRIPWDDWHAF-MELPLQWG------------------DWHFEL............................ 127
16 -11.700IDP05627 hypothetical protein CD1406 [Clostridium difficile 630] CD1406 [Peptoclostridium difficile 630]  ali follow..  11  134.........................................................................MIVNS--------------ELAPEVVDIFKELYEKKYPIEKI-KLIDDYDAVDEKSMS-DNNTSSFCYRTIAGTNVVSNHGKGRAIDINPLQNP--GMIKKGDDCYNAFVSRGWS-----------------WHFE............................. 267
17 -10.300IDP90420 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_465 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  5.....LLLTLCLSSLLSGCSTDNRQTSYIEAARITTQSSGSLILYPVIEPRSAPTYHWPTPKSPVITNYSFHCHGTSGSLSTEETLV-AKPFSIHPLLVTIAQYIHHH----ITIEEGYCCPMHYKFL-------LTSDTSIS-------EQHCKGLAAIVSTQQPVSPQMNEDFIITSTFKKGKPVLVHH............................................... 212
18 -9.690IDP91979 LysM domain-containing protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100000080 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  17  297....................................................................................................................................................DSGDHGKGLAIDFMVPERSELGDK--AEYAIQNMASRGYIINPMPDRGSVTENHYDHVHVSMNG.......................... 380

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.