current user: public

If you have questions about the server, please let us know.

Query: IDP91978 pneumococcal histidine triad protein D (bvh-11-2), partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100008980 [Streptococcus pneumoniae str. Canada MDR_19A], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MKINKKYLAGSVAVLALSVCSYELGRHQAGQVKKESNRVSYIDGDQAGQKAENLTPDEVSKREGINAEQIVIKITDQGYVTSHGDHYHYYNGKVPYDAIISEELLMKDPNYQLKDSDIVNEIKGGYVIKVDGKYYVYLKDAAHADNIRTKEEIKRQKQERSHNHNSRADNAVAAARAQGRYTTLast
1 -92.600IDP91978 pneumococcal histidine triad protein D (bvh-11-2), partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100008980 [Streptococcus pneumoniae str. Canada MDR_19A]  ali  100  1MKINKKYLAGSVAVLALSVCSYELGRHQAGQVKKESNRVSYIDGDQAGQKAENLTPDEVSKREGINAEQIVIKITDQGYVTSHGDHYHYYNGKVPYDAIISEELLMKDPNYQLKDSDIVNEIKGGYVIKVDGKYYVYLKDAAHADNIRTKEEIKRQKQERSHNHNSRADNAVAAARAQGRYTT 183
2 -68.700IDP91915 histidine triad protein PhtA/B [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007341 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  76  1MKINKKYLVGSAAALILSVCSYELGLYQA-RTVKENNRVSYIDGKQATQKTENLTPDEVSKREGINAEQIVIKITDQGYVTSHGDHYHYYNGKVPYDAIFSEELLMKDPNYKLKDEDIVNEVKGGYVIKVDGKYYVYLXEVEIFTYDISGRIGSMGQRLR....................... 159
3 -53.000IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  71  1MKFSKKYIAGSAVIVSLSLCAYALNQHRSQEN-KDNNRVSYVDGSQSSQKSENLTPDQVSQKEGIQAEQIVIKITDQGYVTSHGDHYHYYNGKVPYDALFSEELLMKDPNYQLKDADIVNEVKGGYIIKVDGKYYVYLKDAAHADNVRTKDEINRQKQEHVKDNEKVN-SNVAVARSQGRYTT 182
4 -38.400IDP91924 pneumococcal histidine triad protein B [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007441 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  15  4........................NHNLTVTPTYHQNQGENISSLLRELYAKPLSERHVESDGLIFDPAQITSRTARGVAVPHGNHYHFIPYSQMSELEKRPQPAPSNPIDEKLVKEAVRKVGDGYVFEENGVSRYIPAKDLSAETAAGIDSKLAKQESLSHKLGAKKTDLPSSDRE...... 196
5 -36.200IDP91932 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007089 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  2............................................................LEITLKSPYQFAHILFQSTIVPHGGHYHFIPESDLSAGELLHVHHEEEDGHGFDANRIISEDSEGFVIPHGDHNHYIKVQTKGYEAALKNKIPSLQSNYQPGTFDEKAVLAKVDQLLA..... 178
6 -9.620IDP05508 putative lipoprotein [Bacillus anthracis str. Ames] BA_5398 [Bacillus anthracis str. Ames]  ali follow..  10  1MTIRKRTSFIWIFLFSLVACSP------PNTTIDKKNDVVVKGTGISNLDKFEQFVLNVEQVK--VDKIRIVHYTHEGDPIFQTLERS--------KNDILYASDNRKDQFDGDNKGLYKDSCKSIVKDERESGTTYRLIDCTNEG..................................... 130
7 -8.490IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  15  1M-LKKLGILVLGSAVALSLVACGDSTKEASNEKKEEPKQEAKKENKENKESKKKITAADVE.......................................................................................................................... 60
8 -7.850IDP92719 hypothetical lipoprotein [Francisella tularensis subsp. tularensis SCHU S4] FTT0991 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  4VRYIHTIFLFILSVVLLASCGFHPRGVKVYIKADNFANFANALKRNLTNYNAIVVNDEKSADYIIN-ESQLTSIVGGASNNTF------VVKPDDKTPVIPNRSINAQQFWQSNSGTQLAQNNEANRIYSY------LEGQLVNNMATQIAALLPSKNTTQASTSSDNSLQ............ 191
9 -7.770IDP91969 peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100009453 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  14  1..MKKLATLLLLSTVALAGCSSVQRSLRGDDYVDSSLAAEESSKVAAQSAKELNDALTNENKEVAEDEAEVILHTSQGDIR-NGITFHMVQTGDPKQSIWHDKDKTKDKGTGFKNE-ALAMANTGQPNTNGSQFFINQSSTDTSSKLPTSKYPQKIIEAYKEGGNPS----------DGKHPV 223
10 -7.750IDP02677 gene: sodC; superoxide dismuate (Cu-Zn) precusor [Francisella tularensis subsp. tularensis SCHU S4] FTT0879 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  17  1MTAFYKLCGMSMLSLVLADCTFLSANKPYDRDHDGELIVHMKDVNTHKEVGTITISPYIHDGN---QEGMLITPHLYNL-TTHGMHIH............................................................................................... 87

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24