current user: public

If you have questions about the server, please let us know.

Query: IDP92115 methionine aminopeptidase, putative [Toxoplasma gondii ME49] TGME49_048850 [Toxoplasma gondii ME49], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst MVDTAASADSARAPGDQVRCEGCAREVKPELLCPTCVKLGIQSSYFCSQSCFKENWKKHKDVHAVFKLLQKKNQEAETSAETDLAKFNPQDRNTWRNDPHLRNFLSFSFTGELRPWPILQCMRSVPPHIQQPDYALSGVPQSELDSRRKSNVHVHSEEEIQRLRETCLLGRRALDYAHSLVKPGVTTEEIDAKVHAFIVDNGGYPSPLNYQQFPKSCCTSVNEVICHGIPDFRPLQDGDIVNIDITVFFKGMHGDLNETYCVGDNVDEDSKRLIKGAYECLMEAVKQCRPGMMYRDVGRIVSDVADKYNLSVVRSYCGHGIGELFHTTPNIPHYRRNKAIGVMKPGHVFTIEPMINAGKSGDLLWPDNWTACTIDGRRSAQFEHTLLVTETGVEILTKRLPCSPPLDFDASAYDNLLast
1 -126.000IDP92115 methionine aminopeptidase, putative [Toxoplasma gondii ME49] TGME49_048850 [Toxoplasma gondii ME49]  ali  100  1MVDTAASADSARAPGDQVRCEGCAREVKPELLCPTCVKLGIQSSYFCSQSCFKENWKKHKDVHAVFKLLQKKNQEAETSAETDLAKFNPQDRNTWRNDPHLRNFLSFSFTGELRPWPILQCMRSVPPHIQQPDYALSGVPQSELDSRRKSNVHVHSEEEIQRLRETCLLGRRALDYAHSLVKPGVTTEEIDAKVHAFIVDNGGYPSPLNYQQFPKSCCTSVNEVICHGIPDFRPLQDGDIVNIDITVFFKGMHGDLNETYCVGDNVDEDSKRLIKGAYECLMEAVKQCRPGMMYRDVGRIVSDVADKYNLSVVRSYCGHGIGELFHTTPNIPHYRRNKAIGVMKPGHVFTIEPMINAGKSGDLLWPDNWTACTIDGRRSAQFEHTLLVTETGVEILTKRLPCSPPLDFDASAYDNL 416
2 -99.400IDP92112 methionine aminopeptidase, putative [Toxoplasma gondii ME49] TGME49_057730 [Toxoplasma gondii ME49]  ali follow..  33  11VTSRRTYCAKSHATDGLKPGSIAENRLEWTHSKPNSARKPVPAARPPPSSCLISEGGIARKQLRTNSLEP------------------------------AQACRSQLFVKPLRPRYAVLPAHPIPPSIPRPPYARCSTGQADRGFDSDTPGEVQTPDALKKIRAAATVAANALKLGLDAAREGVTTEDLDKIVHEYIVSVGAYPAAVNFHNFPKAVCASVNEAVCHGIPDLRPLQDGDIVTLDCTAYVDGFFGDCAGTAMVGS-VTEAHRTLVETTKDCLDEAIKLLYPGLPIKEVGRCITALAEQRGFSVVREFCGHFIGRKMHLPPLICHAYPNDTQGVFRVGQTFTIEPILCEGASDLFTWNDGWTIVTQDGGRAAQFEHTILMTPEGAEVLTKPT................ 386
3 -96.400IDP02686 gene: map; methionine aminopeptidase [Francisella tularensis subsp. tularensis SCHU S4] FTT0393 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  41  2.....................................................................................................................................................SQIIIKTPQEIEKMRVAGRLAAEVLEMITPFVKEGVTTAELDKICHEYIVEQDAYPAPLNYHGFPKSICASINHVVCHGIPADKKLKNGDILNIDITVKKDGYHGDTSKMFMIGE-PSVMAKKLVEVTHECLWKGIEVVKPGNHFGDIGAAIEKHAKKFGYSIVDAFCGHGIGANFHEPPHVMHHGKAGTGAMFEEGMIFTIEPMINIGKRAVSVLKDGWTAVTKDRSLSAQWEHTILVTKDGYEVLTLREEEK............. 255
4 -96.400IDP04144 gene: map; methionine aminopeptidase [Yersinia pestis CO92] YPO3337 [Yersinia pestis CO92]  ali follow..  39  2.....................................................................................................................................................TEVKIHSPAEIEMARAAGQAAAKVLEMIKPYVLAGITTDEIDRLCHDYIVNEKVIPANIGYHGYTRTVCTSVNHVVCHGIPSDKKLKNGDIVNIDVAIIKEGWYGDTSRMYFVGE-PSVRAKRLVDITYQSMVAGIKAVRPGATLGDIGASIQQLAEGAGFSVVREYCGHGVGQEYHTAPQVLHYGIAQTGMLLKPGMIFTIEPMINAGKAATSVLSDGWTVVTKDRSLSAQWEHTIAVTESGYDLLTPWPEGTGEY.......... 258
5 -95.900IDP92114 methionine aminopeptidase, putative [Toxoplasma gondii ME49] TGME49_011330 [Toxoplasma gondii ME49]  ali follow..  38  2..........................................................................................................................CLVGAGIVKPHYAEEDDGRAKAKRAEREMEWIKPQAEVEGVRRACEVTREVLQVAVDFVKAPLTTEDIDRVVHEETMKRGAYPSPLRYCNFPKSVCTSTNEIVCHGIPDDRPLQRGSICSIDVSCFLDGFHGDCARTVPIGGSLSPPLRRLLVSAREATLEGIRVCAPGRRLSVIGDAIEEFLTRRGYSTIHDFCGHGIGRNFHEEPFVLHASNNMPG-RMLPGMCFTIEPVVCMGGTDYTTWPDKWTIATTDGKPTAQFEHTVLITDTGVEVLTDCPDGETDM.......... 321
6 -95.100IDP02071 gene: map; methionine aminopeptidase, type I [Coxiella burnetii RSA 493] CBU_1388 [Coxiella burnetii RSA 493]  ali follow..  44  2......................................................................................................................................................PISIKTPEELEKMRIAGQLAAEVLEMIEPYVKAGITTNELNAICHDYITQQKAIPAPLNYHGFPKSICTSVNHVVCHGIPNDKKLKEGDIINIDITVIKNGYHGDTSKMFAVGK-IPSHAQRLVRITQECLYIGISMVKPGTPLGDIGAAIQAHAEKNHYSVVREYCGHGIGSIFHEPEQVLHYGRPGTGAVLRPGMTFTIEPMINAGKRYVKLLNDDWTVVTKDRRLSAQWEHTLAVTETGYEVFTLRKDEKISV.......... 258
7 -95.000IDP04451 gene: ampM; methionine aminopeptidase [Yersinia pestis CO92] YPO1043 [Yersinia pestis CO92]  ali follow..  41  2......................................................................................................................................................AISIKTPEDIQKMRVAGRLAAEVLEIIEPYVKPGVTTGELDRICHDHITNHQAISACLGYHGFPKSVCISVNEVICHGIPSDEVLKEGDIVNIDVTVIKDGFHGDTSKMFIVGK-PTILGERLCRVTQESLYLAIKMVKPGIRLRTLGKAIQKFVEAENFSVVREYCGHGIGEGFHEEPQVLHYDADDGGVVLQAGMAFTIEPMVNAGDYRIRTMKDGWTVKTKDRNLSAQYEHTIVVTDNGCEIMTLRKDDTIPNIITHE..... 263
8 -94.900IDP06103 gene: map; methionine aminopeptidase [Helicobacter pylori J99] NP_223937 [Helicobacter pylori J99]  ali follow..  31  2......................................................................................................................................................AISIKSPKEIKALRKAGELTAQALALLEREVRPGVSLLELDKMAEDFIKSSHARPAFKGLYGFPNSVCMSLNEVVIHGIPTDYVLQEGDIIGLDLGVEVDGYYGDSALTLPIGA-ISPQDEKLLACSKESLMHAISSIRVGMHFKELSQILEGAITERGFVPLKGFCGHGIGKKPHEEPEIPNYLEKGSGPKIKEGMVFCLEPMVCQKQGEPKILADKWSVVSVDGLNTSHHEHTIAIVGNKAVILTER................. 253
9 -91.500IDP06298 methionine aminopeptidase [Streptococcus pneumoniae TIGR4] NP_345557 [Streptococcus pneumoniae TIGR4]  ali follow..  27  1......................................................................................................................................................MITLKSAREIEAMDKAGDFLASIHIGLRDLIKPGVDMWEVEEYVRRRCKEENFLPLQIGVDGYPYATCCSLNDEVAHAFPRHYILKDGDLLKVDMVLGGSGGLADSCWAYAVGT-PSEEVKNLMDVTKEAMYKGIEQAVVGNRIGDIGAAIQEYAESRGYGVVRDLVGHGVGPTMHEEPMVPNYGIAGRGLRLREGMVLTIEPMINTGDWEIDTMKTGWAHKTIDGGLSCQYEHQFVITKDGPVILTSQGEEGT............ 285
10 -90.200IDP01338 methionine aminopeptidase VC2261 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  46  2......................................................................................................................................................SIKIKNAVEIEKMRVAGRLAAEVLEMIEPHVKAGVTTEELDQICHKYITEQGAIPAPLNYHGFPKSICTSINHIVCHGIPASEDLRDGDILNIDITVIKDGYHGDTSKMFLIGD-VSIEDKRLCHVAQECLYLALKQVKPGVQLGEIGTTIEKHIKTNNKSIVRDYCGHGIGAEFHEEPQVVHYKNSDRT-VLREGMIFTIEPMINAGKFGCRLDEDSWTVYTADGKKSAQWEHTILVTATGCEILTLRSEESLPRILNNA..... 280
11 -65.800IDP92099 methionine aminopeptidase, type II, putative [Toxoplasma gondii ME49] TGME49_105460 [Toxoplasma gondii ME49]  ali follow..  16  8EAGEDPVAAEAPGAAAESTPEVPKNDEPVEEDLPEEEEEDEGEEGGAAAGDKKKKKKKKKKKTAGAADKTANGVCAPGSAA--------------VAAAKKQSEENSTVLRRVKEWTSFPEKQTWPPTKPMHEVFSDGRQTKRTTAAEDREAVRLEAVDIQAIRQAAECHRQVRRYIQGVARPGVKLVDLCRSLEAKSKELIAAHKLDRGWGFP--TGCSLNNCAAHYTPDNRVLEQGDICKLDFGVQVGGRIIDCAFSIAFDE----KFDSLIQATQDGTNVGISHAGADARLSEIGGFIQEAIESYPIKSIRNLTGHSIDLRIHAGKSVPIVKAPGGQNIMEEGEVYAIETFASTGRAHVSEENDCSHYMKVRGSFTSQMEHTVFIGKNSVEVVSRGDD............... 479
12 -39.800IDP00681 gene: pepQ; proline dipeptidase SACOL1756 [Staphylococcus aureus subsp. aureus COL]  ali follow..  23  125....................................................................................................................................................KQLRNIKSEDEISKIRKAAELADKCIEIGVSYLKEGVTECEVVNHIEQTIKQYGVNEM-----SFDTMVLFGDHAASPHGTPGDRRLKSNEYVLFDLGVIYEHYCSDMTRTIKFGE-PSKEAQEIYNIVLEAETSAIQAIKPGIPLKDIDHIARNIISEKGYGYFPHRLGHGLGLQEHEYQDV----SSTNSNLLEAGMVITIEPGIYV-----------------PGVAGVRIEDDILVTNEGYEVLTHYEK............... 351
13 -39.100IDP02830 gene: pepQ-2; proline dipeptidase [Bacillus anthracis str. `Ames Ancestor`] GBAA4861 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  138.........................................................................................................................................................IKDEKELSILREAAKMADYAVEVGVNAIKEDRSELEVLAIIEHELKTKGIHKM-----SFDTMVLAGANSALPHGIPGANKMKRGDFVLFDLGVIIDGYCSDITRTVAFGE-ISEEQTRIYNTVLAGQLQAVEACKPGVTLGAIDNAARSVIADAGYGFFPHRLGHGLGISVHEYPDV----KAGNESPLKEGMVFTIEPGIYV-----------------PNVGGVRIEDDIYITKDGSEILTKFPKE.............. 360
14 -38.600IDP01139 gene: pepQ-1; proline dipeptidase BA_4422 [Bacillus anthracis str. Ames]  ali follow..  23  122....................................................................................................................................................EKLRLIKTDSEIKILKEAAQIADAAFEHILSFIRPGVSEIEVSNELEFFMRKQGATSS-----SFDIIVASGLRSALPHGVASEKVIETGDFVTLDFGAYYKGYCSDITRTIAVGE-PSDKLKEIYNIVLEAQLRGVNGIKAGLTGREADALTRDYITEKGYGYFGHSTGHGIGLEIHEAPGL----AFRSDTVLEPGMAVTVEPGIYI-----------------PGIGGVRIEDDIIVTSEGNEVITKSPKE.............. 349
15 -38.500IDP02816 proline dipeptidase, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA4014 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  19  123....................................................................................................................................................ENIRLIKDTHEIETMKIAAHIADEAFHHIITFLKPGISENDVRDELEFFMRKKGATSS-----SFQIIVASGVRSSLPHGVASNKIIERGDIVTLDFGALYDGYCSDITRTVAIGE-PSEEFKKIYNVVREALKRGTEAIKPGETAKSIDDVTRNYITDCGYGYFGHSTGHGLGLEIHEPLRL----SQESKATLEEGMVVTVEPGIYI-----------------PNWGGCRIEDDIVITKDGYEVITKSNRD.............. 350
16 -38.500IDP00677 proline dipeptidase SACOL1588 [Staphylococcus aureus subsp. aureus COL]  ali follow..  21  121....................................................................................................................................................DKIRDVKDADEIALIQKAANIVDETYEYILTVVKAGMTEKELKAILESKMLELGADGP-----SFDTIVASGHRGALPHGVASDKIIEKGDMITLDFGAYYNGYCSDITRTFAIGE-PDPKLKEIYQIVLESQMKAINEIRPGMTGAEADAISRNYLESKGYGEFGHSLGHGIGLEIHEGPML----ARTIQDKLQVNNCVTVEPGVYI-----------------EGLGGIRIEDDILITENGCQVFTKCTKD.............. 348
17 -37.300IDP00207 putative peptidase YPO1950 [Yersinia pestis CO92]  ali follow..  21  176........................................................................................................................................................MIKSPWEIEHLRKSAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSR------FNLISVGDNFSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEP-DKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAVIKTSGLPYNRGHLGHGDGVFLEEVPFV----STQATETFCPGMVLSLETPYYG-----------------IGVGSIMLEDMILITDSGFEFLSKLDRD.............. 400
18 -31.400IDP00418 gene: pepP; proline aminopeptidase P II YPO0910 [Yersinia pestis CO92]  ali follow..  20  173.........................................................................................................................................................FKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGA-----RYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVNGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVGELGILKG-LSHWLGMDVHD---VGDYGSSDRGRILEPGMVLTVEPGL--------YIAPDADVPPQYRGIGIRIEDDIVITATGNENLTASVVKD............. 425
19 -30.600IDP01115 xaa-pro aminopeptidase, putative BA_1901 [Bacillus anthracis str. Ames]  ali follow..  17  171.........................................................................................................................................................FKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGI-----KHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGAVGLIQE-VSHFLGLDTHDVGTY-------KDRVLEEGMVITIEP-----------------LYIEEESIGIRIEDDILVTKDGHENLSKDIIRE............. 404
20 -28.600IDP04491 gene: pepQ; proline dipeptidase [Yersinia pestis CO92] YPO3765 [Yersinia pestis CO92]  ali follow..  17  161.........................................................................................................................................................YKTDYELACMREAQKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVP------YDNIVALNEHSAVLHTILQHQPPAEIRSFLIDAGAEYNGYAADLTRTYTADRDSDF--AALISDLNTEQLALIDTIKSGERYTDYHVQMHQRIAKLTHNLVTG-LGHPLGLQVHDLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDSLLAPWRIGEFSKHFNWDRGIRIEDNIVIHDKRVENMTRDLKLA............. 443
21 -17.500IDP01931 peptidase, M24 family protein [Coxiella burnetii RSA 493] CBU_0073 [Coxiella burnetii RSA 493]  ali follow..  16  302.........................................................................................................................................................LKNPVEQKGAREAAIAMIQFLHWLENHWQSGVSEISAAEKLEFFRRGDSRCLDL----SFPSISGFGPHGAIVHYSATDATINDSAPYLIDSGGQYHYGTTDITRTIHLGTPTEEEKRLYTLVLKGHLAIRQAVFPKGTC----GEHLNALAHQFLWREALDYTGHGVGSYLHEGPQ--AITSRYTGIPLQPGMIVSNEP------------------VYLTHKYGIRIENLCLVTEKFTV--DSLTGDGPFYSFEDLTLVPY 548
22 -16.000IDP02506 peptidase, M24 family protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0609 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  13  304.........................................................................................................................................................LKNPVEINGSKEAHRKDAAAFISWWHWIENNYQGVDEIEAAAKLREFRAQQQGYVE--SFSYIVGHAANGAIIHYMANLKKIDDQAPLLCDSGGQYREGTTDITRVLHFGKPSKEHRKYYTLVLKGHLGLGRAVFPKGTT----GSQLDVLAREHLWHFCADYTGHGVGSFLHEGPQ-----NSVSKVELMPGMILSNEP------------------AYFPGEFGIRIENLCYIKQRNQE---SPTGHGPFYCFEDLTLVPY 547

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.