current user: public

If you have questions about the server, please let us know.

Query: IDP92642 gene: rimI; ribosomal-protein-S18-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4373 [Escherichia coli str. K-12 substr. MG1655], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MNTISSLETTDLPAAYHIEQRAHAFPWSEKTFASNQGERYLNFQLTQNGKMAAFAITQVVLDEATLFNIAVDPDYQRQGLGRALLEHLIDELEKRGVATLWLEVRASNAAAIALYESLGFNEATIRRNYYPTTDGREDAIIMALPISMLast
1 -93.800IDP92642 gene: rimI; ribosomal-protein-S18-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4373 [Escherichia coli str. K-12 substr. MG1655]  ali  100  1MNTISSLETTDLPAAYHIEQRAHAFPWSEKTFASNQGERYLNFQLTQNGKMAAFAITQVVLDEATLFNIAVDPDYQRQGLGRALLEHLIDELEKRGVATLWLEVRASNAAAIALYESLGFNEATIRRNYYPTTDGREDAIIMALPISM 148
2 -61.700IDP92031 N-terminal acetyltransferase complex subunit ARD1, putative [Toxoplasma gondii ME49] TGME49_019760 [Toxoplasma gondii ME49]  ali follow..  23  1MATLRRADVFDLFAMQNANFINLPENYIMKYYFFHAVSQLLSVSHDSQGKLVGYVLAKLEEDDGHVTSVAVLRQSRKLGLASKLMNMTQHAEEVFDADYASLHVRVTNRAAYSLYKHLGYRIHDIDKEYYA---DKEDAFSMRNYFS. 153
3 -60.400IDP95409 set236a-011 [Undefined organism]  ali follow..  15  8.LHSSRQYNTPLE-IVESRNKNLLVPILHDADEDDVDMANISYAAYIGDECVGAAMMHWQLDESEILYIAIRAADRGKGYGRELIAAIVNMARERSTQALVVGTASTSVDNILFYQKCGFRMDSVRKDFFNYKPTLRDMVMLRYELG. 167
4 -53.500IDP05730 putative acetyltransferase [Clostridium difficile 630] CD0675 [Peptoclostridium difficile 630]  ali follow..  17  5.IKFIKAEEKYIYSYWQTFDKAFPFEETVEFIKNIINKNQLFIIDLESDNCIGWCDVLPKTEKVGYLGMGILKEYREKGIGSSLLKQIIDLSKEYGYEKIELDVFKSNSRAIHVYKSLGFVEVNTISSGFTWNDRPVKEEVIQMELTL 165
5 -52.700IDP95442 set236a-044 [Undefined organism]  ali follow..  19  1.VEYKLLEKEDLELMKEIIED-DDIEFDLEKINEFYNDKVIGFIAKAENKIVGFAYGYDIIHAYFIYSIGMLPDYQDKGYGTKLLGFIKDYISSNGFFEMFVLTDKGNPRACHVYEKLGGKNDFEDEICYVYDFEGDE.......... 142
6 -52.400IDP00047 streptothricin acetyltransferase, putative BA_3185 [Bacillus anthracis str. Ames]  ali follow..  17  33LSKVNRRIEYTVEDVPSYEKSYLQNDNEELVYNEYINKNQIIYIALLHNQIIGFIVLKKNWNNAYIEDITVDKKYRTLGVGKRLIAQAKQWAKEGNMPGIMLETQNNNVAACKFYEKCGFVIGGFDFLVYKGLNSDEVAIYWYLHFD. 183
7 -51.000IDP92645 gene: ypeA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2434 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  1.MEIRVFRQEDFEEVITLWERCLLRPWNDPEMDIERHDVSLFLVAEVNGDVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVGKRLIEDEE.............. 140
8 -50.000IDP00087 gene: STM2449; putative acetyltransferase NTL01ST2379 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  38.MEIRVFRQEDFEEVITLWERCLLRPWNDPEMDIERHDVSLFLVAEVSGEVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQIMVRDDNDVVLGMYERLGYEHLSLGKRLIEDEE.............. 177
9 -49.700IDP02174 putative acetyltransferase [Yersinia pestis CO92] YPO3031 [Yersinia pestis CO92]  ali follow..  21  1.MEIRIFQQDDFEEVILLWEHCLLRPWNEMDIERKLNHDELFLVAEVNGTIVGSVMGGYDGHRGSAYYLGVHPDYRGRGFANALISRLEKKLIARGCPKLNIMVREDNDAVIGMYEKLDYETQDLGKRLIVDQE.............. 140
10 -48.400IDP95253 acetyltransferase [Acinetobacter baumannii ATCC 17978] YP_001084790 [Acinetobacter baumannii ATCC 17978]  ali follow..  17  10.........ASIGFLAPIEKNEVLNYWR-EVNHKLAQGNSRLWIAIQEGTVVGSVQLSLVSKKAEVEKLMVLTSARKQGIATLLLNELENFSKEKGLRLLVLDTREGD-VSELLYSKIGFVRVGVIPNFALSSNGNDGTAIYYKKLV. 151
11 -48.400IDP95445 set236a-047 [Undefined organism]  ali follow..  19  3.............ILLKLLFIDDNMVFDIDNLKGFLNDTSFGFIAKENNKIIGFAYCYTLLRMFYLHSIGMLPNYQDKGYGSKLLSFIKEYSKEIGCSEMFLITDKGNPRACHVYEKLGGKNDYKDEIVYVYDYEKGDK......... 134
12 -47.300IDP95410 set236a-012 [Undefined organism]  ali follow..  19  1MLIYRRLTEADAEAMRQMDTKTYRYDQGDDAYFQRIKDHVIVLACFHAGQVVGGLVAYVLDSEIYIYDLAVDESHRRQGIATELINELKAIAAKTGAWVIFVQADREDEPAIQLYEKLGVREEPLHFDIN.................. 147
13 -46.100IDP92718 gene: aacC1; aminoglycoside-(3)-N-acetyltransferase [Serratia marcescens] AAB20441 [Serratia marcescens]  ali follow..  17  26IIRTCRLGPDQVKSMRAADVATYSQHQPDSDYLGNLSKTFIALAAFDQEAVVGALAAYVLRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPST............... 175
14 -45.500IDP95033 ; aminoglycoside acetyltransferase [Pseudomonas aeruginosa] CAD53575 [Pseudomonas aeruginosa]  ali follow..  17  6.TKITRLNSQDVGVMRAMDAENYCRAQPSDSYLQDLGSGFIAIAALQGQEVIGGLAAYVLPKEIYIYDLGVQGAYRRRGIATALINELQRIAHDIGAYVIFVQADYGDDPAVALYTKLGIREDVMHFDIEPQ----PAA......... 156
15 -40.000IDP92643 gene: rffC; TDP-fucosamine acetyltransferase [Escherichia coli K12] b3790 [Escherichia coli K-12]  ali follow..  18  40.SGAVVAQETDIPALRQLASAAFAQQWIENAVRGT-FDHQCLILRAASGDIRGYVSLRELNA-----TDARIGLLAGRGAGAELMQTALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR................. 181
16 -39.200IDP95438 set236a-040 [Undefined organism]  ali follow..  20  2...LKIAEKEDVPVAAELAGMLWPHH-LEGELLSFIESGGMVFLWMEEGNPVAFAQCGIRTD-GYLEGIFVLEKFRRRGIGKVLLTACEEWAKEQGCEEFASDTELDNAEGLSFHSGAGFYEANRIVCFVKN................ 142
17 -39.200IDP91868 gene: aac(6`)-Ig; aminoglycoside 6`-N-acetyltransferase [Acinetobacter haemolyticus] AAA21889 [Acinetobacter haemolyticus]  ali follow..  15  1.MNIKPASEASLKDWLELRNKLWSDS-HLQEMHQLLAEKALQLLAYSDHQAIAMLEASIRFEYGFLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMHRSLGFQETEKVVYFSKKID.............. 145
18 -38.700IDP95418 set236a-020 [Undefined organism]  ali follow..  20  10FLKIERLAENDLPKFIQLEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFY.................. 153
19 -37.800IDP91869 gene: aac(6`)-Ih; aac(6`)-Ih [Acinetobacter baumannii] AAC41391 [Acinetobacter baumannii]  ali follow..  15  1.MNIMPISESQLSDWLALRCLLWPDH-HLQEMRQLIAHRLQLLAYTDTQQAIAMLEASIRYE-AFLEGIFVLPEYRRSGIATGLVQQVEIWAKQFACTEFASDAALDNQISHAMHQALGFHETERVVYF................... 141
20 -36.400IDP92640 gene: phnO; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4093 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  4.CELRPATQYDTDAVYALICELKQAEFDHHAFRVGFNANMRYHLALLDGEVVGMIGLHLQFH-GEIQELVVMPQARGLNVGSKLLAWAEEEARQAGAEMTELSTNVKRHDAHRFYLREGYEQSHFR...................... 139
21 -36.100IDP95439 set236a-041 [Undefined organism]  ali follow..  17  5.FVVREATQADALALAELAIKLWSS--LQSEFLDLICSDAVCFIKYVGSKAVGFAQCQLRND-GYLEGIFVEEEYRHNGYAKELLSKCEKWAKEKHCTEFASDCEINNEISLQFHLSMGFEEANRIICF................... 145
22 -36.000IDP95031 ; aminoglycoside 3`-N-acetyltransferase [Pseudomonas aeruginosa] AAA88422 [Pseudomonas aeruginosa]  ali follow..  17  26.IATVKIGPDEISAMRAVIPTYSDRQPTNEYLANLLHSEFIALAAFDRGTAIGGLAAYVLPKEIYIYDLAVASSHRRLGVATALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVREDVMHFDIDPRT............... 174
23 -35.900IDP95403 set236a-005 [Undefined organism]  ali follow..  15  3.LDVHQLSPNEVALMETLDMETYTGNRPRGAYSRRLSDYFIALAALEYGEIVGGLAAYELKSEIYIYDLAVAKAHRRRGIATALIEKLKELGAARGAYVIFVQTAIEDEPAIALYSKLGVREEVLHFDIPVSQNNVD........... 157
24 -35.900IDP95405 set236a-007 [Undefined organism]  ali follow..  17  3.YRIQQVTPADLDLMNELEETYNGKRPGAGYMRRLLESDFIALAALNDQKVVGGLAAYELKSEIYIYDLAVAKNHRRKGIATALIMELKKIAAARGAYVIFVDTGAEDEPAIELYTKLGIREDVLHFDIP.................. 150
25 -35.800IDP95032 ; aminoglycoside acetyltransferase [Salmonella enterica subsp. enterica serovar Newport] AAR21614 [Salmonella enterica subsp. enterica serovar Newport]  ali follow..  17  3.VEIIHLTGNDVALLQSIDQDSYARNKPSSSYLQKLTSSFIALAAVDEQKVIGAIAAYELQSEIYIYDLAVAATRRREGIATALIKKLKAIGAARGAYVIYVQKGVEDQPAIELYKKLGTIEDVFHFDIA---EQSKNH......... 157
26 -35.600IDP91766 gene: yhhY; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3441 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  23  4.IVIRHAETRDYEAIRQIEVYCNTLQVPHPSDHMWQERGIKQLVACIDGDVVGHLTIDV-RSHVADFGICVDSRWKNRGVASALMREMIEMCDNWRVDRIELTVFVDNAPAIKVYKKYGFEIEGTGKKYALRNGEYVDAYYMAR.... 160
27 -34.300IDP95422 set236a-024 [Undefined organism]  ali follow..  17  54.IEIVNFSSELRTHFERLNRGWIERQFEMEPLDYLLKGGAVLFAVASRGEVVGTAALKNEGEGYELSKMAVDEESRGLGIGKALGLAALDRVRKMGAVKVILYTNSALEPAINLYRKLGFIDVPVTEKGYTRAD-----VKMEIEFKV 206
28 -32.300IDP95034 aminoglycoside acetyltransferase [Corynebacterium striatum]  ali follow..  20  5.NEIRVAEVADAGVVAKLLRDFNTE--LEERFAQIIAHDDAFVLLAGD---IGFAYVTLRPSPAMLDELYVAPAHRNRGVGTALLQRVFEEIRKHSAGELQINVDEVDTDARRFYERHGLTNIEQGSRML.................. 142
29 -32.300IDP92629 gene: yncA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b1448 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  23  1.MSIRFARKADCAAIAEINDQTVDADNRIAWFEARTLAGYPVLVSEENGVVTGYASFGDWRSFDGFHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGIESQNQASLHLHQSLGFVVTAQMPQVGTKFGRWLDLTFMQLQLD. 163
30 -32.300IDP92637 gene: yiaC; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3550 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  20  2...IREAQRSELPAILELWLESTTWGHPIPLVRDAYLANAQNWVWEEDGKLLGFVS---IMEGRFLAAMFVAPKAVRRGIGKALMQYVQQRH-----PHLMLEVYQKNQPAINFYQAQGFHIVDCAWQ.................... 128
31 -32.200IDP92646 gene: yjaB; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4012 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  2VISIRRSRHEEGEELVAIWCRSVDATHDEDLVRSFLPEAPLWVAVNERDQPVGFMLL----SGQHMDALFIDPDVRGCGVGRVLVEHALSMAPE-----LTTNVNEQNEQAVGFYKKVGFKVTGRSEV.................... 130
32 -32.000IDP00086 gene: yncA; putative acyltransferase NT01ST1973 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  25  1.MTIRFADKADCAAITEINDRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDWRSFDGFHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQVGVKFGRWLDLTFMQLQLD. 163
33 -32.000IDP00230 putative acetyltransferase YPO3444 [Yersinia pestis CO92]  ali follow..  18  9.LLVRPITAGDNLAIANVIREVSAEPNLDHLYELYSQPRSAYWVIEVDGHIAGGGGVAPLLGGCELQKMYFLPILRGKGLAKQLALQALAFARQQGFGRCYLETTASLTSAVGLYERLGFEHIG---GAMGNTGHVDCEVTMLKTL.. 167
34 -31.800IDP95450 set236a-052 [Undefined organism]  ali follow..  13  7.VSFRPMSEDDLVLMLKWLTDDRVLEFIREHYTEQWADEIYRVIIEYDTIPIGYAQIYRIQGEYAMDQFIGEPEYWNMGIGAEYCRVVCQYLTEMDANAVILDPRKNNPRAVRAYQKAGFEIIKELPEHELHEGKKEDCVLMEW.... 176
35 -31.700IDP95446 set236a-048 [Undefined organism]  ali follow..  13  7.VSFRPMSEDDLVLMLKWLTDDRVLEFIREHYTEQWADEIYRVIIEYDTIPIGYAQIYRIQGEYAMDQFIGEPEYWNMGIGAEYCRVVCQYLTEMDANAVILDPRKNNPRAVRAYQKAGFEIIKELPEHELHEGKKEDCVLMEW.... 176
36 -31.400IDP91382 histone acetyltransferase HPA2 [Vibrio vulnificus CMCP6] VV1_1470 [Vibrio vulnificus CMCP6]  ali follow..  18  7.FVLRPITVEDNASIANVIRQVSAEPTLDDLFSIYSQANAAYWVVEHQGKIVGGGGFSALAGVCELQKMYFLPICRGQGLAKKIVSLSRSAAKKMGYQRCYLETTACLKEAIALYEKLGFEHL---QAPLGQTGHDACEVVMICHL.. 164
37 -31.000IDP01351 toxin resistance protein VCA0387 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  19  1.MEIXTGEFEDIAGITDIFNFYIEQPFTLENREEWFSQKYQIYVAVENGVLQGFACSQKYRAIPAFVSVYLAQEAKGKGLGSKLYTQLFSSIRAYGVHRILSGVALPNDASVALHKRFGFREVGISNEYAKKHGQYISSLWLEKALN. 164
38 -30.800IDP92644 gene: yjgM; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4256 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  9.PVMRRLTLQDNPAIARVIRQVSAEPNLDELYQVYSQPGHAYWVVEYEGEVVGGGGIAPLTGSCELQKMYFLPAIRGKGLAKKLALMAMEQAREMGFKRCYLETTAFLKEAIALYEHLGFEHI---DYALGCTGHVDCEVRMLREL.. 167
39 -30.600IDP01688 GNAT family acetyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1313 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  4LKNFAELNSQEIKLIFDISQFMKTKHIDFEEHLRFIRNNKKYFLVFQDEQIIGVIDFVNITTKSCEFGLYAIP--DLKGVGQVLMNEIKKYAEILKVDTLKAYVFKDNHKALKLYQQNHFTIYDEDKDFYYVCLKQSHCKALP..... 156
40 -30.200IDP02595 acetyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1384c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  1.MKIREATAKDFDDVVYIEHLLNNCQFFTTNEINNQGKAFKSFVLTVEDQVIGFSCI----KDNEILFSTVEQRFLGKGFRSFMLKYLLE-----NYAVDTTYVYSANIQTLAFYTSIGFIIEDKIDD.................... 130
41 -28.800IDP95485 spermidine acetyltransferase [Staphylococcus aureus] ADV68932 [Staphylococcus aureus]  ali follow..  17  1.MKLRALEYSDLLFVHELNNEYSIMSYWFEEPYESLDESERRFIVEDENQVVGIVELVEIIHRNCEIQIIIKPEFSGKGYAKFAFEKAINYADILNMHKIYLYVDTDNKKAVHIYESQGFKTEGLLKEQFYTKGKYKDAYFMSL.... 158
42 -28.600IDP95421 set236a-023 [Undefined organism]  ali follow..  15  33.........................................FVIARIDGFPVGCGALRPLDASGEVKRMYTRRGFRRKGVAQAILAELERLAIEFGYTTIKLQTGPKQLDAAALYELVGYHRIPRFSGN------WDLVLAYQKDL.. 132
43 -28.400IDP05291 putative acetyltransferase [Clostridium difficile 630] CD1211 [Peptoclostridium difficile 630]  ali follow..  20  9.ITLQFVEEKDLENLENVKLNSLNIDLCFQDFNNELKTSGSLILAFVDENLAGCVALKKLEGKCELKRLYVRNQFRGLKIGKILLEEIIEEAKKFGYTHMRLDTLPSMKSAQGLYEKFGFYDIE-------TYNPIEGARYMELKL.. 163
44 -28.100IDP92634 gene: yedL; predicted acyltransferase [Escherichia coli str. K-12 substr. MG1655] b1932 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  17  1MFTIKTDDLTHPAVQALVAYHISGM--HALDVQKLRNPTVTFWSVWEGEQLAGIGALKLLDDKGELKSMRTAPNYLRRGVASLILRHILQVAQDRCLHRLSLETQAGFTACHQLYLKHGFADCEPFADY----RLDPHSRFLSLTLC. 153
45 -27.800IDP95484 gene: speG; spermidine acetyltransferase [Yersinia pestis Z176003] ADE65402 [Yersinia pestis Z176003]  ali follow..  18  7.VRLRPLEREDLPFVHQLDNNASIMRYWFEEPYEAFDQSERRFIIESQGTKIGLVELVEIIHRRAEFQIIIDPTHQGKGYAGAAAKLAMEYGSVLNLYKLYLIVDKENEKAIHIYSKLGFEIEGELKQEFFINGEYRTVIRMCI.... 164
46 -27.600IDP91767 gene: speG; spermidine N1-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  20  7.VKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFDQSERRFVVECDGEKAGLVELVEIVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAIRMCI.... 164
47 -27.100IDP01616 spermidine n1-acetyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] VC_A0947 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  5.LTLRALERGDLRFIHNIMSYWFEEPYESFDELEELYNKHIFVVEDAQKNLIGLVELIEIIHRSAEFQIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYI.... 163
48 -26.400IDP95424 set236a-026 [Undefined organism]  ali follow..  22  26.........................................LLLAYVDQKPAGCIALRGIDDGCEMKRLFVRDEFRGHRLGLLLVEKVIGEARAAGYLKMRLDTFPPKGKAVKLYESHGFREIAPYYNN-----PHTGVLFMELDL.. 127
49 -25.900IDP92633 gene: yafP; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b0234 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  17  4.IQIRNYQPGDFQQLCAIFIRAVTSAWAQIDESKEKLAKSQVWVAIINAQPVGFISR----IEHYIDMLFVDPEYTRRGVASALLKPL-----IKSESELTVDA---SITAKPFFERYGFQTV--KQQRVECRGAWFTNFYMRYKPQ. 149
50 -25.800IDP95423 set236a-025 [Undefined organism]  ali follow..  16  15....TDRSRIDLDLVHSFLSNSYWARNIPREVVRRSVENSLCFGVYEGVAQVGFAVLPDIATFAYLADVFILESHRGRGLSKWLVESILGHPDLQGLRRWML----ATRDAHGLYSKSGFVPLKHNPDVY.................. 145
51 -25.100IDP95293 gene: aac(6`)-Ib; aminoglycoside 6`-N-acetyltransferase type Ib [Klebsiella pneumoniae] AAL93141 [Klebsiella pneumoniae]  ali follow..  20  25.VTLRLMTEHDLAMLYEWLNRSHIVEWVQEQYLPSVQESVTPYIAMLNGEPIGYAQSYVALGSGD-IDQLLNASQLGKGLGTKLVRALVELLNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTT------PDGPAVYMVQT... 190
52 -24.800IDP00739 acetyltransferase, GNAT family SACOL1063 [Staphylococcus aureus subsp. aureus COL]  ali follow..  18  7.......NQKMLEDCFYIRKKVFVEE-PEESEIDEYESESIHLIGYDNGQPVATARIRPI-TTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCH---AIPFYESLNFKMRG........................ 123
53 -24.700IDP91819 gene: yjhQ; KpLE2 phage-like element; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4307 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  21  6.FTFHITDKSDASDIREVETRAFGFS-KEADLVASLLEDALSLLARYEGKAVGHILFTRATFKGELAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFV------LGHATYYPRHGFEPCAGDKGYYPIPEEHKACWMM...... 155
54 -24.500IDP92639 gene: yhbS; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3156 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  19  1.MLIRVEIPIDAPGIDALLRRSFESD-AEAKLVHDLREDGGLVATDDEGQVIGYVAFSPVDVQGEMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVT------LGDPALYSRFGFELAAHHDLRCRWPGTESAFQVHRLA... 147
55 -22.900IDP00844 acetyltransferase, GNAT family SACOL0519 [Staphylococcus aureus subsp. aureus COL]  ali follow..  13  3.IYLSTLTELDYDKSLNSIEESFDDN-QARAKVKHLRKSLEVIAKNENNDVVGHVLLIEVYYGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVVV------DHCFDYFEKLGYQNAAE----HDIKLEFGDAPLLVKYLW. 156
56 -22.600IDP92638 gene: yiiD; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3888 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  20  25.......TEEELERYYQFRWEMLRKPLHQPKGSER-AMAHHQMVVDEQGNLVAVGRLYINADEASIRFMAVHPDVQDKGLGTLMAMTLESVARQEGVKRVTCSARED---AVEFFAKLGFVNQG........................ 142
57 -22.500IDP92628 gene: rimL; ribosomal-protein-L7/L12-serine acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1427 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  11.LELHAVAENHVKPLYQLICKNKTWNWPQGNVMLHQRGYAKMFMIFKEDELIGVISFNRIEPLNKTAEIGLDESHQGQGIISQALQALIHHYQSGELRRFVIKCRVDNPQSNQVALRNGFILEGCLKQAEFLNDAYDDVNLYAR.... 174
58 -22.100IDP92632 gene: rimJ; ribosomal-protein-S5-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1066 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  18.LVVRLVHDRDAWRLADYENRHFLKPWYPSGWQARLGMINEGLFDPDEKEIIGVANFSNVVRGSF-LGYSIGQKWQGKGLMFEALTAAIRYMRTQHIHRIMANYMPHNKRSGDLLARLGFEKEGYAKDYLLIDGQWRDHVLTAL.... 185
59 -21.900IDP92635 gene: elaA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2267 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  6DLHHSELSVSQLYALLQLRCAVFVVEQNQDIDGDDLTGDNRHILGWKNDELVAYARILDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLETCTHHPDKPVYLGAQAH---LQNFYQSFGFIPVT........................ 133
60 -21.800IDP95401 set236a-066 [Undefined organism]  ali follow..  16  8.ICIRTLIDDDFPLMLKWLTDERVLEFLKKHYTEPWEDEVFRVIIEYNNVPIGYGQIYKMYDELY-MDQFIEPNYWSKGIGTRYIKLIFEFLKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLME..... 176
61 -21.700IDP91769 gene: yjcK; ribosomal-protein-alanine acetyltransferase [Yersinia pseudotuberculosis IP 32953] YPTB1890 [Yersinia pseudotuberculosis IP 32953]  ali follow..  13  16.IHLLVPDLSRSQEMHQLIVNFSNLTWADKNFSEDRDEYKFLIINNHTNQLVGCISLFIRHAQIPYFEIGLSTQAMGYGFITEACILVRDLAHHLKSKRLEIRMARRNIRSSKLAERCGFYCEAILKNNRIDGFGCDDTCIYIY.... 183
62 -21.600IDP91190 6`-aminoglycoside N-acetyltransferase [Enterococcus faecalis V583] EF_A0061 [Enterococcus faecalis V583]  ali follow..  17  8.ICIRTLIDDDFPLMLKWLTDERVLEFLKKHYTEPWEDEVFRVIIEYNNVPIGYGQIYKMYDELY-MDQFIEPNYWSKGIGTRYIKLIFEFLKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLM...... 175
63 -20.800IDP01725 acetyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA2534 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  8.LLIRKFEFKDWEAVHEVMKYIPEGVFTEEDTRNFVNK-NFPVILIGENILVGHIVFHKYFGEHTYIGWVFNPKYFNKGYASEAAQATLKYGKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYFKKCIPHGNEWWDEYYYAI.... 164
64 -19.900IDP91269 acetyltransferase, GNAT family [Bacillus anthracis str. Sterne] NT05BA2958 [Bacillus anthracis str. Sterne]  ali follow..  16  11.LQLRELTLLDAETMFHYFSKESVIRYFGMDSFENIEQAKTGIEKKGTGQLIGTCGFHLINHHHKRAEIGLDDTYWGQGYASEALQAILTYGETLQLIRIAAVVYVENKASQKLLSKAGFQEEGLLRKHMIQNGVAHDTILYSL.... 173
65 -14.600IDP95397 set236a-062 [Undefined organism]  ali follow..  22  3.......................................................................EVDYWSKGIGTKYTKMIFEFLKERNADAVILDPHQDNPRAIRMYQKAGFRIIEDLPEHELHEGKKEDCYLM...... 74
66 -14.000IDP92630 gene: argA; fused acetylglutamate kinase homolog (inactive)/amino acid N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b2818 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  16  297..QIRRATINDIGGILELEQQGILVRRSREQLEMEIDK---FTIIQRDNTTIACAALYPFPEEGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFV-----TTRSIHWFQERGFTPVDIKKQLY---NYQRKSKVLMADLG. 443
67 -13.600IDP91818 gene: yfiQ; inhibiting acetyltransferase for acetyl-CoA synthetase [Escherichia coli str. K-12 substr. MG1655] b2584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  19  726.CLFRPILPEDEPQLQQFISRVTKEDLYYRYFSEINEFTHEDLA-DQTEEILGVTRAISDPDNIDAFAVLVRSDLKGLGLGRRLMEKLITYTRDHGLQRLNGITMPNNRGMVALARKLGFNV---------DIQLEEGIVGLTLNLA. 881
68 -13.000IDP90696 gene: argA; N-acetylglutamate synthase [Yersinia pestis CO92] YPO1022 [Yersinia pestis CO92]  ali follow..  16  296..QVRRATINDIGGILELEQQGILVRRSREQLEMEIDK---FTIIERDNLTIACAALYPFPDEGEMACVAVHPDYRSSSRGEMLLNRITNQARQMGLKKLFV-----TTRSIHWFQERGFTPAEVKQELY---NYQRRSKILLADL.. 441
69 -12.200IDP92641 gene: yjdJ; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4127 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  5....................................EGHNKFYINDKQGKQIAEIVFVPTGENLIIEHTDVDESLKGQGIGKQLVAKVVEKMRREKRKII................................................ 69
70 -11.400IDP92022 glycylpeptide N-tetradecanoyltransferase, putative [Toxoplasma gondii ME49] TGME49_009160 [Toxoplasma gondii ME49]  ali follow..  10  125WCECDVRDPEELKEVYDLDDNLFRFNYSADFLDWALTAPVIGVRVSSTNKLVGFITATDSVPMAEVNFLCVHKKLRSKRLAPVLIKEITRRVNLRSIWQAVYTAGVVLPTPVAQCRYWHR............................ 266
71 -10.600CPX_01616_91817 Complex of sperminidine SpeG and DNA-binding response regulator RcsB [Undefined organism]  ali follow..  18  5.LTLRALERGDLRFIHNLNNNRFEEPYESFDELEELYNKHRFVVEDAQKNLIGLVELIEIIHRSAEFQIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYI.... 163
72 -10.300IDP92636 gene: tmcA; elongator methionine tRNA (ac4C34) acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b2474 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  11  384..DLRRMMDAPGQHFLQAAGENEIAGALWLVDEGGLSQQLSQAVWAGFRRPRGNLVAQSLAAHGRVSRIAVHPARQREGTGRQLIAGALQYTQDLDYLSVSFGY---TGELWRFWQRCGFVLV--RMGNHREASSGCYTAMALLPMS. 534

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.