current user: public

If you have questions about the server, please let us know.

Query: IDP92663 hypothetical protein BB0811 [Bordetella bronchiseptica RB50] NP_887360 [Bordetella bronchiseptica RB50], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MMLTLIVRNPEPGASARRADFHAPGGTLGRDAENCLALPAAPGQLCRVQAALRADAQGWRLHNLSGMAAVHINDAALAPGAVRAIQAGDTLRVGAHTLEVSGPDAPDARPAALPEAAADTPADAPRRGQAGAGAAEDIFSGLFGPGTLPVGGIADAATHPFDLDSAQARNAADPLAHLPAGDAAVSRPAGDPLALFDAPHGGADVFADATPSALPAHDPLAPLRADPVRDTLLPRHAAGDGPAAHDHAPAGGTFLRPAAPRADQADLast
1 -71.000IDP92663 hypothetical protein BB0811 [Bordetella bronchiseptica RB50] NP_887360 [Bordetella bronchiseptica RB50]  ali  100  1MMLTLIVRNPEPGASARRADFHAPGGTLGRDAENCLALPAAPGQLCRVQAALRADAQGWRLHNLSGMAAVHINDAALAPGAVRAIQAGDTLRVGAHTLEVSGPDAPDARPAALPEAAADTPADAPRRGQAGAGAAEDIFSGLFGPGTLPVGGIADAATHPFDLDSAQARNAADPLAHLPAGDAAVSRPAGDPLALFDAPHGGADVFADATPSALPAHDPLAPLRADPVRDTLLPRHAAGDGPAAHDHAPAGGTFLRPAAPRADQAD 266
2 -20.600IDP04699 gene: yscD; virulence protein [Yersinia pestis CO92] YPCD1.53 [Yersinia pestis CO92]  ali follow..  15  1MSWVCRFYQG--KHRGVEVELPHGRCVFGSDPQSDIVLSDSE--IAPVHLVLMVDEEGIRLTDSA--EPLLQEGLPVPLGTL--LRAGSCLEVGFLLWTFVAVGQPLPETLQVPTQRKEPTDRLPRSRLGIGLGVLSLLLLLTFLGLLGHGLWREYNQDGQLVEQEVRR................................................................................................. 162
3 -18.500IDP91490 putative type III export protein PscD [Vibrio parahaemolyticus RIMD 2210633] VP1695 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  11  4WKIRILS----GVHSGVEVTLPEGALVLGSDDIADLVLSDAG--VEANHFTLVCDSESVMLRGCQDVTINGENRAVG--ESGIELERHAVISVGVVKFALGYVEDELIVTNVTDAQTKQDAPVVTAQSTSWKRTA................................................................................................................................... 131
4 -8.690IDP92687 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus str. Newman] YP_001331559 [Staphylococcus aureus subsp. aureus str. Newman]  ali follow..  1..........................MINR----------DNKKAITKKGMISNRLNKFSIRTVGTAS-ILV---------------GTTLIFGLGNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKE 216
5 -8.600IDP92699 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus USA300_TCH1516] YP_001574462 [Staphylococcus aureus subsp. aureus USA300_TCH1516]  ali follow..  1..........................MINRD----------NKKAITKKGMISNRLNKFSIRTVGTAS-ILV---------------GTTLIFGLGNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKE 216
6 -7.460IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  10 1815....................................................................................................ESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQPPPARDVLSTPQIFVNSQAACAPFADSGRDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQQLD 1985
7 -7.430IDP06012 membrane-attack complex / perforin domain-containing protein [Toxoplasma gondii ME49] EEB00555 [Toxoplasma gondii ME49]  ali follow..  2....................LLSAIGGIGPTESRLQHIPFS----TTRYLPIRSHVLQSTVERIESPEAL--NEVPTKVERNEFTEKGDK------------TEQVLTAQADHKSLLEGRSVRLESTSTAPDDDFDFLFEDDTPKKPKSRVNKGTSSDETSPGDRSSGEGSSDSDSLLSVVHRTKGNATQANKNQTRITHPKSKAQHQKKVTKKQGIPGSDSLGTSSADFDFDIDSSSNTQADDSQRQSLGDSSALDLFGSDTG.. 227
8 -7.410IDP91542 3`,5`-cyclic phosphodiesterase, putative [Toxoplasma gondii ME49] TGME49_080410 [Toxoplasma gondii ME49]  ali follow..  15  1.....MAAESSPSGPIESAGLAARDESPTRSSTSSL---DPDQQTCE-HAS---------LPSLRESPRASASSSGVASKAG----EGPRLLT----LPQRLHEATPPQDGALPAASGHGHTDAETHAQGANPGEARPEIQAGPDSDSKTSSSPLSFLTSLAVASKQKAHAEGVSSHASSISGKRRAQGVEKTALVSLDEESDVSGADSAASVLSSQWASGEDRTIGAKPVPDRARWTTTAHDATTHGDASAETLTTPEGIQSPP. 248
9 -7.160IDP91386 cell shape-determining protein [Vibrio vulnificus CMCP6] VV1_1450 [Vibrio vulnificus CMCP6]  ali follow..  134...QVVIDKGRIDGVYIGQPVINEKGIVGQHNSRVLLLSDAKNAIP---VQVVRNDIRVIASGNGDIDEIQLEHIP----TSTDIQVDDLLVTSGL.......................................................................................................................................................................... 225
10 -7.150IDP01204 glycosyl transferase, group 2 family protein BA_2274 [Bacillus anthracis str. Ames]  ali follow..  1...........................MGNEQVKNMIVKNESRIMERCLNATKSIVDFVSICDTGSTDHTP---KNFGYNRSLAVSLAQK---ADYLLILDADM.................................................................................................................................................................. 106

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35