current user: public

If you have questions about the server, please let us know.

Query: IDP92718 gene: aacC1; aminoglycoside-(3)-N-acetyltransferase [Serratia marcescens] AAB20441 [Serratia marcescens], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPSTATLast
1 -83.900IDP92718 gene: aacC1; aminoglycoside-(3)-N-acetyltransferase [Serratia marcescens] AAB20441 [Serratia marcescens]  ali  100  1MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPSTAT 177
2 -75.100IDP95031 ; aminoglycoside 3`-N-acetyltransferase [Pseudomonas aeruginosa] AAA88422 [Pseudomonas aeruginosa]  ali follow..  75  1MLWSSNDVTQQGSRPKTKLGG-SMSIIATVKIGPDEISAMRAVLDLFGKEFEDIPTYSDRQPTNEYLANLLHSETFIALAAFDRGTAIGGLAAYVLPKFEQARSEIYIYDLAVASSHRRLGVATALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVREDVMHFDIDPRTAT 176
3 -69.600IDP95033 ; aminoglycoside acetyltransferase [Pseudomonas aeruginosa] CAD53575 [Pseudomonas aeruginosa]  ali follow..  58  1.....................MISTQTKITRLNSQDVGVMRAMLGMFGEAFEDAENYCRAQPSDSYLQDLLCGSGFIAIAALQGQEVIGGLAAYVLPKFEQQRKEIYIYDLGVQGAYRRRGIATALINELQRIAHDIGAYVIFVQADYGDDPAVALYTKLGIREDVMHFDIEPQPAA 156
4 -67.500IDP95410 set236a-012 [Undefined organism]  ali follow..  50  1.........................MLIYRRLTEADAEAMRQMNQMFGAAFKDTKTYRYDQGDDAYFQRILGKDHVIVLACFHAGQVVGGLVAYVLDKLEMARSEIYIYDLAVDESHRRQGIATELINELKAIAAKTGAWVIFVQADREDEPAIQLYEKLGVREEPLHFDINLEE.. 150
5 -63.100IDP95405 set236a-007 [Undefined organism]  ali follow..  52  2.........................TYRIQQVTPADLDLMNELLSVFGQAFDDEETYNGKRPGAGYMRRLLESDNFIALAALNDQKVVGGLAAYELKKFERERSEIYIYDLAVAKNHRRKGIATALIMELKKIAAARGAYVIFVDTGAEDEPAIELYTKLGIREDVLHFDIPVENG. 154
6 -63.100IDP95032 ; aminoglycoside acetyltransferase [Salmonella enterica subsp. enterica serovar Newport] AAR21614 [Salmonella enterica subsp. enterica serovar Newport]  ali follow..  52  2.........................SVEIIHLTGNDVALLQSINAMFGEAFNDQDSYARNKPSSSYLQKLLSTSSFIALAAVDEQKVIGAIAAYELQKFEQQRSEIYIYDLAVAATRRREGIATALIKKLKAIGAARGAYVIYVQADKEDQPAIELYKKLGTIEDVFHFDIAVEQ.. 153
7 -62.700IDP95403 set236a-005 [Undefined organism]  ali follow..  53  2.........................SLDVHQLSPNEVALMETLLATFGEAFNDMETYTGNRPRGAYSRRLLESDYFIALAALEYGEIVGGLAAYELKKFEQERSEIYIYDLAVAKAHRRRGIATALIEKLKELGAARGAYVIFVQTAIEDEPAIALYSKLGVREEVLHFDIPVSQNN 155
8 -59.800IDP95418 set236a-020 [Undefined organism]  ali follow..  28  9........................NFLKIERLAENDLPKFIQLIRLFEAVFEMK---NFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFY..... 153
9 -55.100IDP95442 set236a-044 [Undefined organism]  ali follow..  19  1..........................VEYKLLEKEDLELMKEIIEDDDIEF-----------DLEKINEFYNDKNVIGFIAKAENKIVGFAYGYDIIHP-NGKHAYFIYSIGMLPDYQDKGYGTKLLGFIKDYISSNGFFEMFVLTDKGNPRACHVYEKLGGKNDFEDEICY..... 134
10 -53.200IDP92640 gene: phnO; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4093 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  1.......................MPACELRPATQYDTDAVYALICELKQAEFDHHAF------RVGFNANLRDPNMRYHLALLDGEVVGMIGLHLQFHLHHVNWIGEIQELVVMPQARGLNVGSKLLAWAEEEARQAGAEMTELSTNVKRHDAHRFYLREGYEQSHFRF........ 140
11 -52.400IDP91868 gene: aac(6`)-Ig; aminoglycoside 6`-N-acetyltransferase [Acinetobacter haemolyticus] AAA21889 [Acinetobacter haemolyticus]  ali follow..  16  1..........................MNIKPASEASLKDWLELRNKL---------SDSEASHLQEMHQLLAEKYALQLLAYSDHQAIAMLEASIRFEYVETSPVGFLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMHRSLGFQETEKVVYFSKK... 143
12 -52.400IDP00047 streptothricin acetyltransferase, putative BA_3185 [Bacillus anthracis str. Ames]  ali follow..  16  2.........................SLLIRELETNDLDNFPEIDDSFEDVPSYEKSYLQNDNEELVYNEYINKPNQIIYIALLHNQIIGFIVLKKNWN-----NYAYIEDITVDKKYRTLGVGKRLIAQAKQWAKEGNMPGIMLETQNNNVAACKFYEKCGFVIGGFDFLVYKG... 166
13 -51.700IDP91869 gene: aac(6`)-Ih; aac(6`)-Ih [Acinetobacter baumannii] AAC41391 [Acinetobacter baumannii]  ali follow..  18  1..........................MNIMPISESQLSDWLALRCLLWPDHEDVH-------LQEMRQLITQAHRLQLLAYTDTQQAIAMLEASIRYEYVQTSPVAFLEGIFVLPEYRRSGIATGLVQQVEIWAKQFACTEFASDAALDNQISHAMHQALGFHETERVVYFKKN... 144
14 -51.600IDP95034 aminoglycoside acetyltransferase [Corynebacterium striatum]  ali follow..  17  2.......................TTTNEIRVAEVADAGVVAKLLRDFNTEFDTPV----PEGLEERFAQIIAHDDAFVLLAGD----IGFAYVTLRPSPYYDGPVAMLDELYVAPAHRNRGVGTALLQRVFEEIRKHSAGELQINVDEVDTDARRFYERHGLTNIEQGSRM...... 141
15 -51.000IDP95439 set236a-041 [Undefined organism]  ali follow..  10  3........................GDFVVREATQADALALAELAIKLWSSHTISE-------LQSEFLDLICSDNAVCFIKYVGSKAVGFAQCQLRNDYVDTSPVGYLEGIFVEEEYRHNGYAKELLSKCEKWAKEKHCTEFASDCEINNEISLQFHLSMGFEEANRIICFRKD... 148
16 -49.900IDP95445 set236a-047 [Undefined organism]  ali follow..  18  17..............................................................DIDNLKGFLNDTSSFGFIAKENNKIIGFAYCYTLLRP-DGKTMFYLHSIGMLPNYQDKGYGSKLLSFIKEYSKEIGCSEMFLITDKGNPRACHVYEKLGGKNDYKDEIVY..... 125
17 -48.700IDP00087 gene: STM2449; putative acetyltransferase NTL01ST2379 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  14..RQILAESDVCAIILVFPPEKATNTMEIRVFRQEDFEEVITLWERCDLLRPWND-------PEMDIERKVNHDVSLFLVAEVSGEVVGTVMGGY------DGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQIMVRDDNDVVLGMYERLGYEHSDLGKRLIEDE.. 176
18 -48.200IDP92031 N-terminal acetyltransferase complex subunit ARD1, putative [Toxoplasma gondii ME49] TGME49_019760 [Toxoplasma gondii ME49]  ali follow..  16  1.........................MATLRRADVFDLFAMQNA---------NFINLPENYIMKYYFFHAVSWPQLLSVSHDSQGKLVGYVLAKLEED-DPTDHHGHVTSVAVLRQSRKLGLASKLMNMTQHMEEVFDADYASLHVRVTNRAAYSLYKHLGYRIHDIDKEYYADK.. 142
19 -48.200IDP92645 gene: ypeA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2434 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  17  1..........................MEIRVFRQEDFEEVITLWERCDLLRPWND-------PEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGY------DGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADLGKRLIEDE.. 139
20 -48.000IDP02174 putative acetyltransferase [Yersinia pestis CO92] YPO3031 [Yersinia pestis CO92]  ali follow..  15  1..........................MEIRIFQQDDFEEVILLWEHCDLLRPWNDP-------EMDIERKLNHDPELFLVAEVNGTIVGSVMGGY------DGHRGSAYYLGVHPDYRGRGFANALISRLEKKLIARGCPKLNIMVREDNDAVIGMYEKLDYETQDLGKRLIVDQ.. 139
21 -47.900IDP95438 set236a-040 [Undefined organism]  ali follow..  2............................LKIAEKEDVPVAAELAGMLWPHHSREELEGE---------LSFIESGGMVFLWMEEGNPVAFAQCGIYVEGTHGGAIGYLEGIFVLEKFRRRGIGKVLLTACEEWAKEQGCEEFASDTELDNAEGLSFHSGAGFYEANRIVCFVKN... 142
22 -47.600IDP05730 putative acetyltransferase [Clostridium difficile 630] CD0675 [Peptoclostridium difficile 630]  ali follow..  10  2.......................IEGIKFIKAEEKYIYSYWQTFDKIRKYLAMDEAFPFEETVEFIKNIINKNLPQLFIIDLESDNCIGWCDVLPK------TEKVGYLGMGILKEYREKGIGSSLLKQIIDLSKEYGYEKIELDVFKSNSRAIHVYKSLGFVEVNTISSGF..... 147
23 -46.100IDP92642 gene: rimI; ribosomal-protein-S18-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4373 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  17  1.........................MNTISSLETTDLPAAYHI---------EQRAHAFPWSEKTFASNQ--GERYLNFQLTQNGKMAAFAITQVV------LDEATLFNIAVDPDYQRQGLGRALLEHLIDELEKRGVATLWLEVRASNAAAIALYESLGFNEATIRRNYYPTT.. 133
24 -44.900IDP95409 set236a-011 [Undefined organism]  ali follow..  15  7.........................ALHSSRQYNTPLEIVESRNKNLLVPI-----LHDADEDDVRIASAIVDMANISYAAYIGDECVGAAMMHWQ------LDESEILYIAIRAADRGKGYGRELIAAIVNMARERSTQALVVGTASTSVDNILFYQKCGFRMDSVRKDFFNY... 144
25 -44.500IDP00230 putative acetyltransferase YPO3444 [Yersinia pestis CO92]  ali follow..  15  1..................MTTTTPIRLLVRPITAGDNLAIANVIREVSAEFGLTADKGYTVSDPNLLYELYSQPRSAYWVIEVDGHIAGGGGVAPLLG--GEADLCELQKMYFLPILRGKGLAKQLALQALAFARQQGFGRCYLETTASLTSAVGLYERLGFEH............. 146
26 -44.300IDP92644 gene: yjgM; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4256 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  16  1..................MNNIAPQSPVMRRLTLQDNPAIARVIRQVSAEYGLTADKGYTVADPNLLYQVYSQPGHAYWVVEYEGEVVGGGGIAPLTG--SESDICELQKMYFLPAIRGKGLAKKLALMAMEQAREMGFKRCYLETTAFLKEAIALYEHLGFEH............. 146
27 -43.400IDP92643 gene: rffC; TDP-fucosamine acetyltransferase [Escherichia coli K12] b3790 [Escherichia coli K-12]  ali follow..  12  35.....................NNASDSGAVVAQETDIPALRQLASAAFAQSRFRAPWYAPDASSRFYAQWIENDHQCLILRAASGDIRGYVSLRELNA-----------TDARIGLLAGRGAGAELMQTALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR.... 181
28 -43.200IDP91382 histone acetyltransferase HPA2 [Vibrio vulnificus CMCP6] VV1_1470 [Vibrio vulnificus CMCP6]  ali follow..  17  2.....................SEKMDFVLRPITVEDNASIANVIRQVSAEYGLTADKGYSVADPTLLFSIYSQANAAYWVVEHQGKIVGGGGFS---ALAGVEGVCELQKMYFLPICRGQGLAKKIVSLSRSAAKKMGYQRCYLETTACLKEAIALYEKLGFEH............. 143
29 -41.300IDP95422 set236a-024 [Undefined organism]  ali follow..  16  48....................SHKGTNIEIVNFSSELRTHFERLNRGWIERQFEMEPLDYLLLQN---TEIIEKGGAVLFAVASRGEVVGTAALKNE-----GEGVYELSKMAVDEESRGLGIGKALGLAALDRVRKMGAVKVILYTNSALEPAINLYRKLGFID............. 185
30 -40.600IDP91766 gene: yhhY; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3441 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  17  1.......................MSEIVIRHAETRDYEAIRQIHAQPEVY--CNTLQVPHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRPRRSHVADF--GICVDSRWKNRGVASALMREMIEMCDNWRVDRIELTVFVDNAPAIKVYKKYGFEIEGTGKK....... 144
31 -40.300IDP05291 putative acetyltransferase [Clostridium difficile 630] CD1211 [Peptoclostridium difficile 630]  ali follow..  14  1..................MADKMAQNITLQFVEEKDLENVKLLFTEYSNSLNIDLCFQDFNNELKTLPGKYKKPSGSLILAFVDENLAGCVALKKL-----EGKICELKRLYVRNQFRGLKIGKILLEEIIEEAKKFGYTHMRLDTLPSMKSAQGLYEKFGFYD............. 144
32 -39.300IDP95253 acetyltransferase [Acinetobacter baumannii ATCC 17978] YP_001084790 [Acinetobacter baumannii ATCC 17978]  ali follow..  23  30..................................................................VNHKLAQGNSRLWIAIQEGTVVGSVQLSLVSKK-NGVHRAEVEKLMVLTSARKQGIATLLLNELENFSKEKGLRLLVLDTREGD-VSELLYSKIGFVRVGVIPNFALSS.. 136
33 -38.500IDP02595 acetyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1384c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  1..........................MKIREATAKDFDDVVYISEHLLNNCQFFTTNEINNQGKLVVEKYLNNPAFKSFVLTVEDQVIGFSCI----------KDNEILFSTVEQRFLGKGFRSFMLKYLLE-----NYAVDTTYVYSANIQTLAFYTSIGFIIED........... 126
34 -36.600IDP01351 toxin resistance protein VCA0387 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  1..........................MEIXTGEFEDIAGITDIFNFYIEQTNARFEEFPFTLENEWFSQFSRTAKYQIYVAVENGVLQGFACSQKYRAIPAFDDTVEV-SVYLAQEAKGKGLGSKLYTQLFSSIRAYGVHRILSGVALPNDASVALHKRFGFREVGISNEY...... 146
35 -36.300IDP92646 gene: yjaB; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4012 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  16  2.........................VISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRTELEDLVRSFL--EAPLWVAVNERDQPVGFMLL----------SGQHMDALFIDPDVRGCGVGRVLVEHALSMAPE-----LTTNVNEQNEQAVGFYKKVGFKVTG........... 126
36 -35.600IDP92629 gene: yncA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b1448 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  1..........................MSIRFARKADCAAIAEIYNHA--VLYTAAIWNDQTVDADNRIAWFEAAGYPVLVSEENGVVTGYASFGDWRSFDGFRHTVEH-SVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGIESQNQASLHLHQSLGFVVTAQMPQV...... 145
37 -35.400IDP00086 gene: yncA; putative acyltransferase NT01ST1973 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  1..........................MTIRFADKADCAAITEIYNHA--VLHTAAIWNDRTVDTDNRLAWYEALGYPVLVSEENGVVTGYASFGDWRSFDGFRYTVEH-SVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQV...... 145
38 -35.100IDP92634 gene: yedL; predicted acyltransferase [Escherichia coli str. K-12 substr. MG1655] b1932 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  1.........................MFTIKTDDLTH-PAVQALVAYHISGMLQQSPPESSHALD---VQKLRNPTVTFWSVWEGEQLAGIGALKLL-----DDKHGELKSMRTAPNYLRRGVASLILRHILQVAQDRCLHRLSLETQAGFTACHQLYLKHGFADCEPFADYRLDPHS 145
39 -34.700IDP95421 set236a-023 [Undefined organism]  ali follow..  17  1.......................................MTELSAELAALYEVADGSAGFKASD------VEVPRAAFVIARIDGFPVGCGALRPL-----DASTGEVKRMYTRRGFRRKGVAQAILAELERLAIEFGYTTIKLQTGPKQLDAAALYELVGYHRIPRFSGNWDLVL. 126
40 -34.500IDP92637 gene: yiaC; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3550 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  2............................IREAQRSELPAILELWLESTTWGHPFIKANYWRDCIPLVRDAY--ANAQNWVWEEDGKLLGFVSIM---------EGRFLAAMFVAPKAVRRGIGKALMQYVQQRHPH-----LMLEVYQKNQPAINFYQAQGFHIVD........... 124
41 -33.100IDP92633 gene: yafP; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b0234 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  20  1.......................MNNIQIRNYQPGDFQQLCAIFMTASQHYSPQQISAWAQIDESRWKEKLAKSQ--VWVAIINAQPVGFISR----------IEHYIDMLFVDPEYTRRGVASALLKPL-----IKSESELTVDA---SITAKPFFERYGFQ.............. 125
42 -32.200IDP95293 gene: aac(6`)-Ib; aminoglycoside 6`-N-acetyltransferase type Ib [Klebsiella pneumoniae] AAL93141 [Klebsiella pneumoniae]  ali follow..  16  23........................DSVTLRLMTEHDLAMLYEWLNIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGT.......... 176
43 -31.700IDP95424 set236a-026 [Undefined organism]  ali follow..  20  4.......................................................CFQDFETEVATLPGKYAEPRGRLLLAYVDQKPAGCIALRGI-----DDGVCEMKRLFVRDEFRGHRLGLLLVEKVIGEARAAGYLKMRLDTFPPKGKAVKLYESHGFRE............. 108
44 -31.000IDP91819 gene: yjhQ; KpLE2 phage-like element; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4307 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  1.....................MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPAL-------SLLARYEGKAVGHILFTTFKGEMDSPLMHILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHA------TYYPRHGFEPCAGDKGY...... 139
45 -30.100IDP95485 spermidine acetyltransferase [Staphylococcus aureus] ADV68932 [Staphylococcus aureus]  ali follow..  13  1..........................MKLRALEYSDLLFVHELNNEYSMSYWFEEPYESLTELQYLFDKHLLDESERRFIVEDENQVVGIVELVEINYIHRNCEI----QIIIKPEFSGKGYAKFAFEKAINYADILNMHKIYLYVDTDNKKAVHIYESQGFKTEGLLKEQ...... 143
46 -30.000IDP95446 set236a-048 [Undefined organism]  ali follow..  5........................KRVSFRPMSEDDLVLMLKWLTRVLEFYDGRDKKHTQKTIREHYTEQWADE-IYRVIIEYDTIPIGYAQIYRIQGELTEEKIYAMDQFIGEPEYWNMGIGAEYCRVVCQYLTEMDANAVILDPRKNNPRAVRAYQKAGFEIIKELPE....... 160
47 -30.000IDP95450 set236a-052 [Undefined organism]  ali follow..  10  5........................KRVSFRPMSEDDLVLMLKWLTRVLEFYDGRDKKHTQKTIREHYTEQWADE-IYRVIIEYDTIPIGYAQIYRIQGHETEEKIYAMDQFIGEPEYWNMGIGAEYCRVVCQYLTEMDANAVILDPRKNNPRAVRAYQKAGFEIIKELPE....... 160
48 -29.800IDP91767 gene: speG; spermidine N1-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  5........................HSVKLRPLEREDLRYVHQLDNNASVMYWFEEPYEAFVELSDLYDKHIHDQSERRFVVECDGEKAGLVELVEINHVHRRAEF----QIIISPEYQGKGLATRAAKLAMDYGTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMH....... 148
49 -29.600IDP95484 gene: speG; spermidine acetyltransferase [Yersinia pestis Z176003] ADE65402 [Yersinia pestis Z176003]  ali follow..  14  5........................SSVRLRPLEREDLPFVHQLDNNASIMYWFEEPYEAFVELCDLYDKHIHDQSERRFIIESQGTKIGLVELVEINHIHRRAEF----QIIIDPTHQGKGYAGAAAKLAMEYGSVLNLYKLYLIVDKENEKAIHIYSKLGFEIEGELKQ....... 148
50 -28.900IDP01688 GNAT family acetyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1313 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  2.......................IKLKNFAELNSQEIKLIFKWRNHPDISQFMKTKHIDFEEHLRFIRNLHQDSNKKYFLVFQDEQIIGVIDFVNITTKSC--------EFGLYAIPDLKGVGQVLMNEIKKYAEILKVDTLKAYVFKDNHKALKLYQQNHFTIYDEDKDF...... 142
51 -28.100IDP01616 spermidine n1-acetyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] VC_A0947 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  3........................SQLTLRALERGDLRFIHNLNNNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEF----QIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEE...... 148
52 -28.000IDP92639 gene: yhbS; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3156 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  22  1..........................MLIRVEIPIDAPGIDALLRR-----------SFESDAEAKLVHDLREDTLGLVATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDP------ALYSRFGFEL............. 124
53 -28.000IDP00844 acetyltransferase, GNAT family SACOL0519 [Staphylococcus aureus subsp. aureus COL]  ali follow..  16  2.........................QIYLSTLTELDYDKSLNSIE--ESFDDNPETSWQARAKVKHLRKSPCYNFELEVIAKENNDVVGHVLLIEINSDDKTYYGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVVVDHCFD------YFEKLGYQN............. 135
54 -28.000IDP95423 set236a-025 [Undefined organism]  ali follow..  14  21...................................DLDLVHSFLSNSY----------ARNIPREVVRRSVEN--SLCFGVYEGVAQVGFARV-----LPDIATFAYLADVFILESHRGRGLSKWLVESILGHPDLQGLRRWMLAT----RDAHGLYSKSGFVP............. 129
55 -27.400IDP92638 gene: yiiD; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3888 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  13.....................ESIAMYHLRVPQTEE--ELERYYQFRWEMLRKPLHQPKGSERDAW-----DAMAHHQMVVDEQGNLVAVGRLYI-----NADNEASIRFMAVHPDVQDKGLGTLMAMTLESVARQEGVKRVTCSARED---AVEFFAKLGFVNQG........... 142
56 -26.900IDP95401 set236a-066 [Undefined organism]  ali follow..  13  6........................NEICIRTLIDDDFPLMLKWLTRVLEFYGGRDKKYTLESLKKHYTEPWEDE-VFRVIIEYNNVPIGYGQIYKMYDPKTDEIVYGMDQFIGEPNYWSKGIGTRYIKLIFEFLKERNANAVILDPHKNNPRAIRAYQKSGFRIIE........... 157
57 -26.400IDP91190 6`-aminoglycoside N-acetyltransferase [Enterococcus faecalis V583] EF_A0061 [Enterococcus faecalis V583]  ali follow..  13  6........................NEICIRTLIDDDFPLMLKWLTRVLEFYGGRDKKYTLESLKKHYTEPWEDE-VFRVIIEYNNVPIGYGQIYKMYDPKTDEIVYGMDQFIGEPNYWSKGIGTRYIKLIFEFLKERNANAVILDPHKNNPRAIRAYQKSGFRIIE........... 157
58 -25.800IDP00739 acetyltransferase, GNAT family SACOL1063 [Staphylococcus aureus subsp. aureus COL]  ali follow..  19  6..................................NNQKMLEDCFYIRKKVFVEEQGVPEESEIDEY------ESESIHLIGYDNGQPVATARIRP-----INETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCH---AIPFYESLNFKMRGNIF........ 126
59 -23.800IDP92628 gene: rimL; ribosomal-protein-L7/L12-serine acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1427 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  9........................ESLELHAVAENHVKPLYQLICKNKTWLQQSLNWPQFVQSEEDTRKTVQRGYAKMFMIFKEDELIGVISFNRIEPLNKTAEIGY----WLDESHQGQGIISQALQALIHHYQSGELRRFVIKCRVDNPQSNQVALRNGFILEGCLKQ....... 158
60 -23.700IDP91769 gene: yjcK; ribosomal-protein-alanine acetyltransferase [Yersinia pseudotuberculosis IP 32953] YPTB1890 [Yersinia pseudotuberculosis IP 32953]  ali follow..  10  14........................KKIHLLVPDLSRSQEMHQLIVNFSNLHREFLTWADDNSSEETVFSNMSDEYKFLIINNHTNQLVGCISLFIRHAQIPYFEIGY----WLSTQAMGYGFITEACILVRDLAHHLKSKRLEIRMARRNIRSSKLAERCGFYCEAILKN....... 166
61 -23.300IDP92635 gene: elaA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2267 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  1.......................MIEWQDLHHSELSVSQLYALLQLRCAVFVVEQNCPYQDIDGDDL-----TGDNRHILGWKNDELVAYARIL---KSDDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLETCTHHPDKPVYLGAQAH---LQNFYQSFGFIPVTEVY........ 136
62 -22.700IDP92632 gene: rimJ; ribosomal-protein-S5-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1066 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14......................TTDRLVVRLVHDRDAWRLADYYAENRHFLKPDESHCYPSGWQARLGMINEFHKQFGLFDPDEKEIIGVANFSNVVRGSFHACYL---GYSIGQKWQGKGLMFEALTAAIRYMRTQHIHRIMANYMPHNKRSGDLLARLGFEKEGYAKDY...... 170
63 -22.100IDP01725 acetyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA2534 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  4......................KAERLLIRKFEFKDWEAVHEYTSDSDVMKYIPEGVFTEEDTRNFVNKNMGENAKFPVILIGENILVGHIVFHKYFGEHTYE------GWVFNPKYFNKGYASEAAQATLKYGKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYFKK....... 148
64 -20.200IDP91269 acetyltransferase, GNAT family [Bacillus anthracis str. Sterne] NT05BA2958 [Bacillus anthracis str. Sterne]  ali follow..  7......................ETERLQLRELTLLDAETMFHYFSKESVIYFGMDSFENIEQAKTTIQTFKNRYEEWGIEKKGTGQLIGTCGFHLINHHHKRAEIGY----ELDDTYWGQGYASEALQAILTYGETLQLIRIAAVVYVENKASQKLLSKAGFQEEGLLRKH...... 158
65 -17.900IDP92022 glycylpeptide N-tetradecanoyltransferase, putative [Toxoplasma gondii ME49] TGME49_009160 [Toxoplasma gondii ME49]  ali follow..  13  121........................DGFVWCECDVRDPEELKEVYDLLSQHYVEDDDNLFRFNYSADFLDWAHRDWVIGVRVSSTNKLVGFITATPSQIRVFSDPMAEVNFLCVHKKLRSKRLAPVLIKEITRRVNLRSIWQAVYTAGVVLPTPVAQCR................... 262
66 -17.700IDP91818 gene: yfiQ; inhibiting acetyltransferase for acetyl-CoA synthetase [Escherichia coli str. K-12 substr. MG1655] b2584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  724........................ERCLFRPILPEDEPQLQQFISRVTKEDLYYRYFSEINEFTHEDLANMTQDREMAFVAVRREEILGVTRAISDPDNIDAE-----FAVLVRSDLKGLGLGRRLMEKLITYTRDHGLQRLNGITMPNNRGMVALARKLGFN.............. 864
67 -16.800IDP92630 gene: argA; fused acetylglutamate kinase homolog (inactive)/amino acid N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b2818 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  10  297...........................QIRRATINDIGGILELIRPLEQ----------QGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPE----EKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLT----TRSIHWFQERGFTPVDI.......... 418
68 -16.600IDP90696 gene: argA; N-acetylglutamate synthase [Yersinia pestis CO92] YPO1022 [Yersinia pestis CO92]  ali follow..  10  296...........................QVRRATINDIGGILELIRPLEQ----------QGILVRRSREQLEMEIDKFTIIERDNLTIACAALY----PFPDEHIGEMACVAVHPDYRSSSRGEMLLNRITNQARQMGLKKLFVLT----TRSIHWFQERGFTPAEV.......... 417
69 -15.400IDP92641 gene: yjdJ; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4127 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  3......................................................................IREGHNKFYINDKQGKQIAEIVF-----VPTGENLAIIEHTDVDESLKGQGIGKQLVAKVVEKMRREKRKII................................... 69
70 -15.100IDP95397 set236a-062 [Undefined organism]  ali follow..  16  3.................................................................................................................EVDYWSKGIGTKYTKMIFEFLKERNADAVILDPHQDNPRAIRMYQKAGFRIIED.......... 57
71 -12.300CPX_01616_91817 Complex of sperminidine SpeG and DNA-binding response regulator RcsB [Undefined organism]  ali follow..  15  3........................SQLTLRALERGDLRFIHNLNNNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAE----FQIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVE....... 147
72 -12.200IDP92636 gene: tmcA; elongator methionine tRNA (ac4C34) acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b2474 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  10  361..................................SDPETPLKVYQLLSGAHYR--------TSPLDLRRMMDAPGQHFLQAAGENEIAGALWLHGNNPLAATLRGRRVSRIAVHPARQREGTGRQLIAGALQYTQDLDYLSVSFGY---TGELWRFWQRCGFVL--VRMGNHREASS 522
73 -11.000IDP95449 set236a-051 [Undefined organism]  ali follow..  10  5........................KRVSFRPMSEDDLVLMLKLTDDRVLEFYDGRDKKHTQKTIREHYTEQWADEIYRVIIEYDTIPIGYAQIYRIQGELFDEYDYHETG................................................................... 91

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.