current user: public

If you have questions about the server, please let us know.

Query: IDP92743 hypothetical protein lpp2747 [Legionella pneumophila str. Paris] YP_125052 [Legionella pneumophila str. Paris], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MDNESLLAILNNWSATNYAKGNYILREISSKFLAKISIHSNDYLLDAGCGDGSFTQMLANLVPDGYVLGLDRSKTMIDYANKHCRSINVRFDIGDIQEPIIYGPFDNILSFWCLHWTDLEKSLSNLYHVLKPGGKICAIFSSGKQSTLFEVLNSLQFQNLYPDVAKNVVQSKMMRENYSIQCRRALDNLPFKSISFVVEHCQVELPDLGLFENFIHGAPLFKDLPGKMYQDIVNSMVQFFDEYCKKKYGGKWVYETTPYFLTITRELast
1 -89.200IDP92743 hypothetical protein lpp2747 [Legionella pneumophila str. Paris] YP_125052 [Legionella pneumophila str. Paris]  ali  100  1MDNESLLAILNNWSATNYAKGNYILREISSKFLAKISIHSNDYLLDAGCGDGSFTQMLANLVPDGYVLGLDRSKTMIDYANKHCRSINVRFDIGDIQEPIIYGPFDNILSFWCLHWTDLEKSLSNLYHVLKPGGKICAIFSSGKQSTLFEVLNSLQFQNLYPDVAKNVVQSKMMRENYSIQCRRALDNLPFKSISFVVEHCQVELPDLGLFENFIHGAPLFKDLPGKMYQDIVNSMVQFFDEYCKKKYGGKWVYETTPYFLTITRE 266
2 -80.200IDP92740 hypothetical protein lpp2134 [Legionella pneumophila str. Paris] YP_124446 [Legionella pneumophila str. Paris]  ali follow..  36  2...........IWDPERYVLGNYIQNKINDVFLKTIHSKLSGNILDIGCGDGHYTSLLAGKVKHGQVLGIDSSEQMIMHANQQWARTGLSFEVHNIEEFHQPQSFDLALSFWCLHWTNIHISFPNIFHLLKREGKLYAVMSSFSDHSILQTWKELAKQNLYRDLTEQYISP--INEQYFYGVINLLNRLPFKRIKLDLKTCRVHLPHIDYYKNLLLTMPFIKRVPSEITDTLVEDMLKAFQTICDRKYGGQLYYETRPIFLEAIK. 253
3 -52.900IDP02273 hypothetical protein GBAA3714 [Bacillus anthracis str. `Ames Ancestor`] GBAA3714 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  53VKRQYSVSNNLQTRIDTHKHYEEKQVNLDEIVIEHLQLQGRERILEVGCANGKFLSLLQANGHKGQLTGFDQSEAMLSEATKT--NNLIEWRLGDAGKPFEANYYDLIVARHMLYHMDVEKTIQGFHKVIHPGGSLLA--TTNSNVTLPRIVEMCNRMLDTFDLPKTTSSVTPFCLENGKE----ILQSVFPTVEVSVIHNALIFHHATPIVNYISSMFLNIPDNTLLHAEMKDWLKEEVENEL-LLHNGIWRDPKTLAIYRCQKE 313
4 -44.300IDP02332 UbiE/COQ5 family methlytransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA1462 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  1......MPINFHDANNKYTYAQRNAHISWGEMIKGITNIQNKQIIDIGCGGGIYTKELALM-GAKSVVGLDFSKEILQAAKENCSGSNISFIHGDAHSPYPNDTFDIVISRAVIHLQDIPTFLREASRILKKNGVLIVQDRTIEDCTIPGSPEHIRG---FFSIFPKLIEIESKRRPKTTTIQKELQKYFLHVFPTQTQWEVRKIHDSVEALL--TGRSILYELTDYELSQLLQQVQTALQN------VSPIIERDRWTIWSAMK. 257
5 -42.700IDP02131 methyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1419c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  1.MQKLVEQVWDYTKHAKFYSYRPNYAPKTIDMLISLVGKKDIKVADIGAGTGNLSIMLLER--GCKVVSVEPNDAMREIGIERTKDQKIDWVRATGLNTLQNSEFDWVTFGSSFNVMDRNEALEEAHRLLKSEGYFSCMWNHRDNDPVQKIAEDT--------IVEFVPNYTRGTRREDQRPIIESRKDLFDNIVYIEEDFYFHQSIENYINAWKSVKNPYWDLETDEGNELFNKISNKISQ----RLPKEFSIKYTTRCWSAKK. 252
6 -40.000IDP95440 set236a-042 [Undefined organism]  ali follow..  18  3..........WDNVAGVYDIFANIINRKTHEGLRTKEVSKEDVVLECACGTGLLSGVIAEKC--KNLVATDLSVKMLKKASKKHRATNIEFREGNILQEYPDGKFDVVVAANVIHLLEPYKALAELDRVCRIGGKIIIPTYMNKNEKGKTSGFANTVGKAGADFKRQF---------TYDTYMEFIKEAGYENVKYS..................................................................... 184
7 -37.900IDP04650 hypothetical protein FTT_1302 [Francisella tularensis subsp. tularensis SCHU S4] FTT1302 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  15  19MFNYNLFLNRLSKRK--LYPKSFIKNEIAQRLLKRLEFLDPKDILVTGYSDSDYLERLQKRFPNADIHTSQNL----------------------------KQHFDIIFSNSIIHITNLSQELDDYYQLLNDNGILL--FSTFGDKSFATLKEAVTSVSNYKHTNT---------MIDLLTWGNTLQASQYKTPAIESDLITFTYENINTLFEDIRYLNEPLADTNMQFGLTGKNMWLRFVEKF----KQNLQLEIEALYGYAVRK 242
8 -37.600IDP95362 set237a-002 [Escherichia coli]  ali follow..  11  37..........................YTIDYWIKHGCINKKSHLLDLACSTGFSSRECFKKE-GASAEGIDISESAVMVANEKAKNNLLKYYVADACDPFEDNTFTHVLGGCNFAFINRLIALNETHRCLNHMGSMCISNFYYRRKISDKLINDVYNAINFR------------NPLWTLEYWHQFFSERFTLVSEENHEMESQ-SEDELKADIYDYIFNRNEFTKGLNGSLQNVFFERFLKIRRPLNIQRDYQGVTLQ--IWRKK 267
9 -37.400IDP95361 set237a-001 [Yersinia pseudotuberculosis PB1/+]  ali follow..  16  35..........................FTLDYWIEKSRINSNTYLLDLACSTGFSARNIVHKT-GCSAEGIDISARSIESANQLAVAECVHFSVGNAESSFTDNTFTHITAGCCFGFIDKPAALVEVQRVLKQDGFLCISPFFYESEPDNELLSLVEQYIGYRP-----------DIKRDYSYWFNFFNQHFTL--LHEELFDLPVYSDDEIEKNVNISICSKPVFNILSREKQQLAFDRYYNTRLLLNEHAKYQSVALWVMRVKK. 265
10 -34.000IDP06181 hypothetical protein jhp0993 [Helicobacter pylori J99] NP_223710 [Helicobacter pylori J99]  ali follow..  15  21...AHVFDDMLERSIPYYHEMLNLGAYFIAQNLKENKSLPKPLIYDLGCSTGNFFIALNQQIQDIELVGIDNSMPMLKKAQEKLKDNNVRFECMDFLE-VKFKEASAFSLLFVLQFVQREVLLKKIYNSLALNGVLLVGEKIMSEDRILDKQMIELYYLYKQNQGYSHNEENVLVPYSLKENIALLESVGFKHVEA...................................................................... 228
11 -31.900IDP95435 set236a-037 [Undefined organism]  ali follow..  19  8..................RERLPILESFYASTLASLG--PVRSVLDLACGLNPLALPWMPLAPDARYYACDIYADMIAFLNSFFAQAGIRARVCDLVAGAPDEQVDLALVLKALPPLDQQAAGRDLLRALNARHILV................................................................................................................................. 128
12 -31.700IDP91265 2-heptaprenyl-1,4-naphthoquinone methyltransferase [Bacillus anthracis str. Sterne] NT05BA1551 [Bacillus anthracis str. Sterne]  ali follow..  18  5..KEERVHDVFEKISDKYDVMNSVIKAWRKETMRIMDVKPGSKALDVCCGTADWTIALAGAVEQGKVVGLDFSENMLSVGKQKVEAKQVELLHGNAMEPFEDNTFDYVIGFGLRNVPDYMHVLKEMTRVVKPGGKVICLETSQPTMIGFRIMPLFGKLFAKSYKEYSWLQESASTFPGMKELANMFEKAGLERVQVK..................................................................... 219
13 -31.400IDP02356 gene: ubiE; menaquinone biosynthesis methyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1296 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  20  20..KQKKVAGVFHSVAAKYDLMNDLMRIWKKQTIAKSGVRKGDNVLDLAGGTGDLAYKFCQMVQQGKVILSDINSSMLEVGKEKLTNGNIEYVQANAECPFPDNYFDCIISFGLRNVTDKDKALASMCRVLKPGGRSLVLEFSKPIIPLLSALPFLGKIITQDAESYKYLAESIRKHPDQQTLKQMMYDAGFDNVEYQ..................................................................... 235
14 -31.200IDP95457 set236a-001 [Undefined organism]  ali follow..  15  12..DNETFKAVSLQLMGKHASTRE-RRSILPDFYPRIELPPIHSVIDIACGLNPLAHPWMPLAPAATYDAYDIYQGMMTFLNDYFALRRGTASACDVIQSCPTQEVDVALLLKVLPCLEQLEAAHHLLHTLNARYLIV................................................................................................................................. 151
15 -31.100IDP06161 gene: ubiE; ubiquinone/menaquinone biosynthesis methyltransferase [Helicobacter pylori J99] NP_224094 [Helicobacter pylori J99]  ali follow..  15  8..KQEKIINMFDDIASSYDQANRLRQRACEHAFLFLENKKALRLVDVACGTGDMLVAWQKSALNKECLGIDPSNNMLELAIKKCEENKASFIQAQAKDLVENNSVDILIAYGLRNIVERQEALKEFFRVLKTRGVLVILEFLKKDNPTNKVLPLVGGAISKNYGAYSYLPQSIEGFLSLEGLKNELKNAGFEILRTE..................................................................... 231
16 -31.100IDP02069 gene: ubiE; ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Coxiella burnetii RSA 493] CBU_2017 [Coxiella burnetii RSA 493]  ali follow..  16  20..KTDKVKHVFESVAAKYDLMNDLMRWWKDFAITQCRLRTGQRILDLAGGTGDLAKRISPLVDEGEVVIADINAAMLNVGRRRLLDRNIQFIQADAEKPFPNNFFDRIIGFGLRNVTNQLAALQSMHRVIKPGGFVVILEFSKPTLAPLKLLPRLGKLVAKDEESYRYLVESIRMHPDQEALLSKMTDAGFEDCDYH..................................................................... 235
17 -31.000IDP90893 gene: ubiE; ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia pestis CO92] YPO3781 [Yersinia pestis CO92]  ali follow..  20  21..KEGMVAEVFHSVAAKYDLMNDLMRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVEQGEVILADINESMLRMGREKLRDGNVSYVQANAEAPFPDNFFDCIISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLLEPLSILPKIGELVAQDAESYRYLAESIRMHPDQETLKGMMADAGFENVTYS..................................................................... 236
18 -30.900IDP95425 set236a-027 [Undefined organism]  ali follow..  18  2.........................................RSVLDLACGLNPLALPWMPLAPDARYYACDIYADMIAFLNSFFAQSGIRARVCDLVAGAPDEQVDLALVLKALPPLEQQAAGRDLLRALNARHILV................................................................................................................................. 101
19 -30.400IDP95458 set236a-002 [Undefined organism]  ali follow..  17  76...............ASTRERLPLLEQFYSTLLAELP--APHSVLDLACGLNALTLPWFPHMEAITYYACDIYRPMIDFLNATMEIMHIRAEVRDILQSCPTQEADLALVLKTIPCLEQIDAGTRLLRAINARYMIV................................................................................................................................. 199
20 -30.400IDP95411 set236a-013 [Undefined organism]  ali follow..  13  5...............ASTRERLVILDEFYCTLFADLP--PITSILDLACGLNPLAIPWMPLPAGVTYAACDIYQDQVDFLQQCFVVFEGAAKPCDLLQACPTQAADVVLLLKTIPCLEQVDIGRKLLDTLNAPILCV................................................................................................................................. 128
21 -30.300IDP95415 set236a-017 [Undefined organism]  ali follow..  19  2................RHHASTRERLPILEGFYATTSLGPVRSVLDLACGLNPLALPWMPLAPDARYYACDIYADMIAFLNSFFAQAGIRARVCDLVASAPDEQVDLALVLKALPPLDQAKHAGRNLLRALNARHILVSFPA............................................................................................................................ 132
22 -30.100IDP95434 set236a-036 [Undefined organism]  ali follow..  17  99..................RERLPILESFYATTLASLG--PVRSVLDLACGLNPLALAWMPLAPAVRYYACDIYADMIAFLNGFFAQARGQARVCDLVAGAPDEQVDLALVLKALPPLDQQAAGRDLLRALNAQHILV................................................................................................................................. 219
23 -29.900IDP95407 set236a-009 [Undefined organism]  ali follow..  11  50...KGGCRRIMGSHASTRERLPILE-EFYGRIFEELP--PVRSVVDVACGLNPLAIPWMGLADGTGYVAYDIYEDMMGFLGGVLGIFGVEGETRDVVAEPSVEEVDLALVLKAIPCLEQIDAGRRLLDGLKAKNMVV................................................................................................................................. 184
24 -29.700IDP95448 set236a-050 [Undefined organism]  ali follow..  14  6MTEREYKRAMELAAARDWEALLGMHASTRERLFDQLAIGTPARILDLACGLNPVYLAHRL--PNAAIAGVDISGQCVNVIRAFG---GAEARLGDLLCEIPEDEADAALMFKVLPLLRTGAAMDALMRVNAEWIVASF................................................................................................................................ 151
25 -29.000IDP95437 set236a-039 [Undefined organism]  ali follow..  18  107................RNHASTRERLPILEDFYAATSLGQVSSVLDLACGLNPLTLPWMPLAPDARYYACDIYADMIAFLNGFFTRAGLETEECALAAGAPNVQVDLALVLKALPPLDQQAAGRDLLRALNARHILV................................................................................................................................. 233
26 -28.100IDP95459 set236a-003 [Undefined organism]  ali follow..  15  23....SRIMHHHASTRERLPILDPFYTTIFEALRENPG--EVHSILDVACGLNPLAIPWMPLLPDTTYHALDIYADMIQFVGRCLALMQVKADTCDVVAQVLRRPVDVAFVLKTIPCLEQVDIGSSLLDILGAKQLVV................................................................................................................................. 167
27 -27.900IDP06435 gene: E1R; E1R [Monkeypox virus Zaire-96-I-16] NP_536525 [Monkeypox virus Zaire-96-I-16]  ali follow..  549...RLNPEVSYFTNKRTRGPLGILSNYVKTLLISMYDDSNKRKVLAIDFGNGADLEKYFYG---ALLVATDPDADAIARGNERYNKLNQETIRSDVREVFYFGKFNIIDWQFAIHYSHYATVMNNLSELTASGGKVLITTMDGDSSENYMSVEKIADDRIVVYNPSTMSTPMTEYIIKKNDIVRVFNEYGFVL--VDNVDFATIIERSKKFINGASTM--------EDRPSTRNFFELNRGAIKCEGLDVEDLLSYYVVYVFSKR. 845
28 -27.900IDP95419 set236a-021 [Undefined organism]  ali follow..  12  99...................ERLPILTEFYAAVFERLP-QPPRVIADLACGMNPLTVEWMPVGEDVLYRASDIDSRLMAFLDEALTVLGVEVAVHDLLTGPDPKPADVTLLLKAVPCIETQQLGWGLIDAINSPVVVV................................................................................................................................. 219
29 -27.800IDP95402 set236a-004 [Undefined organism]  ali follow..  13  19..NNDDLKTVCKNILLRHNSTKE-RMGFIDDFYAAIAIPSAQKIIDIGCGFNPFSYPWLATHGQIEYAGFDIDVLLTEMMNNAWKQVGLPVQYNDVFFLPGHTENDVLFFLKFFPCLEEKGISAKIFNAVKSNAFVV................................................................................................................................. 160
30 -26.900IDP90709 gene: ubiG; 3-demethylubiquinone-9 3-methyltransferase [Yersinia pestis CO92] YPO1215 [Yersinia pestis CO92]  ali follow..  15  12.VDEQEIAKFEAVASRWWDLEGEFKPLHRINILQRSGGIFEKKVLDVGCGGGILAESMARE--GAQVTGLDMGYEPLQVARLHALETKLEYVQETVENHAQQQHYDVVTCMEMLHVPDPASVVRACAQLVKPGGHVFF-------STINRNTKSWLMAVVGAEYLLKMVPKGTHKFIRPSELIGWVDQTPLLERHII..................................................................... 212
31 -26.600IDP91053 ENC0002 [Enterobacter cloacae]  ali follow..  13  55MTEREYKRAMELAATRDWEALLGMHASTRERLFDQLAIGTPARILDLACGLNPVYLAHRLP--NAAIAGVDISGQCVNVIRAFG---GAEARLGDLLCEIPEDEADAALMFKVLPLLRTGAAMEALMRVNAEWIVASF................................................................................................................................ 200
32 -26.500IDP91052 gene: rmtD; 16S rRNA methylase [Pseudomonas aeruginosa] PSA0001 [Pseudomonas aeruginosa]  ali follow..  12  55MTEREYKRAMEMAAARDWEALLGMHASTRERLFDQLASGTPARILDLACGLNPVYLAHRLP--NAAITGVDISGQCVNVIRAFG---GAEARLGDLLCEIPEDEANAALLFKVLPLLRAGAAMDALMRVNAEWIVASF................................................................................................................................ 200
33 -26.000IDP95399 set236a-064 [Undefined organism]  ali follow..  13  55MTEREYKRAMELAAARDWEALLGMHASTRERLFDQLAIGTPARILDLACGLNPVYLAHRLP--NAAITGVDISGQCVNVIRAFG---GAETRLGDLLCEIPEDEADAALMFKVLPLLRTGAAMDALMRVNAEWIVASF................................................................................................................................ 200
34 -26.000IDP95413 set236a-015 [Undefined organism]  ali follow..  17  88................VLQSSTRERAPIVTEFYNQIITGQPETILDHACGLNPLSFFWMDLPNTTQYQAYDIDIEQIELLNKIAQTTGISATVADIVT-DSYGYADVVFLLKTLPCLQQEKGISLDILRKQQCKYIVVSYPI............................................................................................................................ 219
35 -24.900IDP95454 set236a-056 [Undefined organism]  ali follow..  21  100.......................................KPRRVLDLACGLNPIY--LAAR--GINVLGLDAHLGAVALVNRFAEENALRAEGADLRTELPEERFDLALVFKLLPLLGANG--YDLLGRVRAGFVAVS................................................................................................................................ 195
36 -24.900IDP95395 set236a-060 [Undefined organism]  ali follow..  21  50................AQHASTRERLANVDEYLALIHALKGELICDAACGLNPLL--LGNA--GYDVLGLDIQLTCVDVINAWARSEGWSARGADLVGCEALPECGLTLMLKLLPVMDAQRSMRLLMAARSPRVLVSF................................................................................................................................ 174
37 -23.500IDP95396 set236a-061 [Undefined organism]  ali follow..  12  72...AGLDVADEENLIRILEQHASTRERLPLATMDALITGRPRCILDLACGLNPVYLSVRLP-EDCRIVGVDIQGECVHILNEAIGSERIIGIHADLLSRIPSERFDVALMFKILPLLDQKAGAAMDVMAAVNARYLVISYPT............................................................................................................................ 219
38 -22.700IDP92075 ubiquinone/menaquinone biosynthesis methyltransferae, putative [Toxoplasma gondii ME49] TGME49_095690 [Toxoplasma gondii ME49]  ali follow..  17  47..KQQMVASVFSSVAERYDLMNDLMRCWKDAFVDLVQFSRRFRILDLAGGTGDIAFRFVEKAERTQLGGFDGKRTGAESERGYGAPLLLQWVCGNGEQPFGDESFDVVIAFGIRNFTDVKKGLREAARVLRPGGRFLCLEFSRVENPTLAALYDIFSFNALPLMGSLVAGDRDAYFPPQEEFAAMMADAGFHHVAFS..................................................................... 374
39 -22.600IDP95398 set236a-063 [Undefined organism]  ali follow..  17  83................GQHASTRERMATREEYMSLIHCPPGGIICDAACGLD----PLMLGAAGYAVRGLDIQMTCVDVINAWARRESWKAEGADLLGRAELPKSDLTLFMKLLPVLDAQREGMRLLSLSSSPRVIVS................................................................................................................................ 206
40 -22.500IDP95444 set236a-046 [Undefined organism]  ali follow..  18  86...................ASTRERMATREEYMSLIHCPPGGIICDAACGLDPLM--LGAA--GYAVRGLDIQMTCVDVINAWARREDVKAEGADLLGRAELPKSDLTLFMKLLPVLDAQREGMRLLSLSSSPRVIVS................................................................................................................................ 206
41 -22.500IDP06056 hypothetical protein jhp1397 [Helicobacter pylori J99] NP_224115 [Helicobacter pylori J99]  ali follow..  20  7...............RLYQPLNAYSYNSDSLFLYDFFIKNSGAILDIGSGCGVLGLLCARDNPLASVHLVEKDSKMAFCSQKNALFPNAQVFESDFLDFNPPILYDAIVCNPPFY-LDFASLVAKVKKCLKPKGYFIFCYEALSLCLVIESLKS................................................................................................................ 166
42 -22.500IDP04372 gene: b4371; ribosomal RNA small subunit methyltransferase C [Yersinia pestis CO92] YPO0427 [Yersinia pestis CO92]  ali follow..  23  185............................SHLLLSTFNEPFKGSVLDVGCGAGVLASVLAQQSPKIKWTLSDVSAAAIEASRATLAVNNIEAQVIASNVYSIKGRFEMIISNPPFH----EMLIRGATAHLHVGGKLRIV............................................................................................................................... 302
43 -22.400IDP95455 set236a-057 [Undefined organism]  ali follow..  17  86...................ASTRERMATREEYMSLIHCPPGGIICDAACGLD----PLMLGAAGYAVRGLDIQMTCVDVINAWARREGWKAEGADLLGRAELPKSDLTLFMKLLPVLDAQREGMRLLSLSSSPRVIVS................................................................................................................................ 206
44 -21.900IDP91051 gene: rmtC; 16S rRNA methylase [Proteus mirabilis] PRM0001 [Proteus mirabilis]  ali follow..  17  103................NLHTSTNERTVAYDELYQKIVTGVPTSITDAGCALNPFSFPFFTEAMLGQYIGFDLDKGMIEAIEHSLRTLNAPVVKQGDILSDPSGESDLLLMFKLYTLLDQEEASGLKILQEWKYKNAVISFPIKTISG----------------------RDVGMEENYTVKFENDLVGSDLRIMQ....................................................................... 266
45 -21.400IDP00532 gene: cfa; cyclopropane fatty acyl phospholipid synthase YPO2390 [Yersinia pestis CO92]  ali follow..  18  131......LDPNMQYSCAYWKEATSLQEHKLQMICEKLQLAPGMKLLDIGCGWGGLAAYAARHF-GVSVSGVTISVEQQKLAQQRCEGLDVSILLQDYRD--LNEQFDRIVSVGMFEHVGPKTYFKVVNRNLKPDGLFLLHTIGANRT........................................................................................................................ 273
46 -21.300IDP00962 gene: cfa; cyclopropane fatty acyl phospholipid synthase STM1427 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  19  131......LDPYMQYSCAYWKDADTLQQAKLKLICEKLQLQPGMRVLDIGCGWGGLSQYMATHY-GVSVVGVTISAEQQKMAQTRCEGLDVSILLEDYRD--LNDQFDRIVSVGMFEHVGPKTYFEVVDRNLKPDGLFLLHTIGSKKT........................................................................................................................ 273
47 -20.900IDP01630 gene: hemK; protein methyltransferase HemK [Coxiella burnetii RSA 493] CBU_1964 [Coxiella burnetii RSA 493]  ali follow..  14  100...........................LVEWILKNLPKDEKLRIADLGTGSGAVALAIAVERPHWTIDATDNSQAALKIAEINAKQKNCNFYHGEWCQALPRRDYHAIVGNEAL---AIKIIIHEAKSYLVNGGWLLLEHGYDQAEKIMTLMQA................................................................................................................ 253
48 -20.800IDP06499 hypothetical protein spr1856 [Streptococcus pneumoniae R6] NP_359448 [Streptococcus pneumoniae R6]  ali follow..  19  1...........................................................................MLEQARLKVEQKNIQFLEQDLPKNPLEKEFDCLAVSRVLHHMDLDAALSLFHQHLKEDGKLIIADFTKTEANHHGF--------------------------DLAELENKLIEHGFSSVHSQILYSAEDLFQGNHSEFFL................................................... 118
49 -20.500IDP01412 cyclopropane-fatty-acyl-phospholipid synthase VC1122 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  159..AKDNIHQHYDLGNELYLSLEQAQQAKMQRLCEQLQLKPTDHVLEIGTGWGAMAIYMAQHY-GCKVTTTTISEEQYAYAQQKITNNQITLLKQDYRL--LSGQYDKLVSIEMIEAVGKATFLSQCYALLKPRGKMAIQAITIADQRYESYSNN-------VDFIQKYIFPGGFLPSISVLTELATKRTGLVLRNLHDIGIDY----ALTLQHWRDR--FEQQLPKVRDLGYDERFIRMWRYYFCYCEGGFLARSISTVHMTFERD 432
50 -20.400IDP05651 gene: cfa; guanylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1183c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  105..ESKNIKSHYDIGNDFYNTLYEAQINKIEHTLKKLDLKEGEKLLDIGCGWGWLSIMAAQKY-GVKVVGITISEEQCKKAKERVKEDKIEIRLQNYQDLEFENYFDKVVSVGMFEHVGKELYFMKVKQVLKPGGSMLLHSILAMFEGKTN---AWIDKYIFPG-----------YLPSLREVVSAMSEWDFHLLLAESLRMHY----AKTLDLWDEN---FNKVLDKVREKYDEEFIRMWDLYLRSCASAFRVGSVDLFQFLITKE 373
51 -19.400IDP00974 gene: hemK; N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase STM1775 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  22  78............WSLPLFVSPATLIPRPDTECLVEQALAKTCRILDLGTGTGAIALALACERPDCEVTAVDRMPDAVALAIRNAEHRNVRILQSCWFSALSGQQFDMIVSNSAL---DLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRR................................................................................................................ 252
52 -19.400IDP06062 gene: pcm; protein-L-isoaspartate O-methyltransferase [Helicobacter pylori J99] NP_223734 [Helicobacter pylori J99]  ali follow..  20  60........................SPLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIF--RRVFSIERIESLYIEARLRLKTDNVHVKFADNKGWERYAPYDRILFSACA-----KNIPQALIDQLEEGGILVAPIQENNEQVIKRFVKQ................................................................................................................ 186
53 -19.200IDP00614 modification methylase, HemK family SACOL2109 [Staphylococcus aureus subsp. aureus COL]  ali follow..  18  57...DLALQRMLLGEPIQYNSNCLIPRPETEEVMLHFQLEDDATIVDIGTGSGVLAITLKCEKPDLNVIATDISLEAMNMARNNAEQSQIQFLTGDALKPLINEKLNGLISNQALF---YESIIEDLPHVMEKGSPVVFEIGYNQGEALKSIILN................................................................................................................ 254
54 -19.200IDP01214 gene: cfa; cyclopropane-fatty-acyl-phospholipid synthase BA_3460 [Bacillus anthracis str. Ames]  ali follow..  12  108..NKDDIAHHYDIGNDFYDSLTTAQHNKVNHILKKLNLQKGDTLLDIGCGWGELITAAAKQY-GVKAMGVTLSEEQYAKASERIKTDLVEVSLLDYRD-IKNQKFDKIVSVGMIEHVGKDQYFETVNTLLNDGGISLLHCITSPANGGAT--NGWIEKYIFPG-----------YVPAVNELITNMTNEQFFIVDVESLRRHY----GKTLQHWARN---FENVMEEVRKTKDERFIRMWRLYLNACAASFFTGNIDLHQFVFTKG 376
55 -18.900IDP95404 set236a-006 [Undefined organism]  ali follow..  12  126...KGLATADTEKILTAHRSTIERQMHYPGLYDDLFGSKKPEVILDLCAGLNPCAYEYLGC--TPVYYAIDVSPQLMAFVQQFFDDHAIKAWAEDITTMKEFPDADTILIFKGMDVLERVKYGEQLLNVF-LERRIIVSFAT............................................................................................................................ 265
56 -18.100IDP04360 putative protoporphyrinogen oxidase [Yersinia pestis CO92] YPO2018 [Yersinia pestis CO92]  ali follow..  23  78............WSLPLSVSSATLIPRPDTECLVEQALAMPCRILDLGTGTGAIALALATERRDCAVIAVDINADAVALARHNAEKDNVCFLQGSWFEPV-SGRFALIASNSAL---DLAAIVSQAPGYLDPGGWLMLEHGWQQANAVQELLKN................................................................................................................ 251
57 -18.000IDP91765 ThiF family protein [Yersinia pseudotuberculosis IP 32953] YPTB1885 [Yersinia pseudotuberculosis IP 32953]  ali follow..  14  349.GDETVFNKIAGYYREHRDTSSTNKTVLDKSVARILTENKYNSVLDVGCGIGTYCRMLDGK--SSYIVGLDINSSMLSTAREL--GGSIEYSNGEFMNYDDNHSFDLVIFSLVLDHVNFVDYILKAKSLLHKGGSIVCIIPEGKYMEVTNYFHEGVQRKNRYDVNDEILCEVLSFKRTLPTYLNAFLTSGFTLHYIEEPRHPDSNHRAHHIPYFT................................................... 569
58 -17.700IDP02578 gene: yafS; putative SAM-dependent methyltransferase [Salmonella typhimurium LT2] STM0262 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  7...SQTVVAPGCWGELPWGNY--YREALEQQLNPWFAKMYGFHLLKIGNLSAEINSEACAVSHQVNVSSQGSPMQVLADPLH----------------PFADKSVDVCLLAHTLPWCDPHRLLREADRVLIDDGWLVIS--GFNPLSLMGLRKLVPVLRK--------TPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQGGRLNTHIPALGCLQLIVARKRTIPLTLNPLRHNK........................ 220
59 -17.600IDP93850 cobalt-precorrin-6Y C(15)-methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001006911 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  19  16........................KEAVRVLALERLSLSGAAHLIDVGAGTGSVALEAALRFPDLRVTAIERNPVLINENRQRLGCRKVDIIAGVAPLPLSDKADAIFIGGSG----HLTDLIDWSLMMLNPGGRLVLTFIL............................................................................................................................ 133
60 -17.100IDP91276 ribosomal protein L11 methyltransferase [Bacillus anthracis str. Sterne] NT05BA4392 [Bacillus anthracis str. Sterne]  ali follow..  19  153................AFGTGTHPTTTMCIRALEKT-VQPGDTIIDVGTGSG-VLSIAAAKLGASSVQAYDLDPVAVESAEMNVRDDVVSVGQNSLLE-GIEGPVDLIVANLLAEII---LFPEDAARVVKSGGLFITS............................................................................................................................... 274
61 -16.900IDP95408 set236a-010 [Undefined organism]  ali follow..  26  120.............................ESFYASTSLGPVRSVLDLACGLNPLALPWMPLAPDARYYACDVYADMIA............................................................................................................................................................................................ 170
62 -14.600IDP00638 gene: gidB; glucose-inhibited division protein B SACOL2736 [Staphylococcus aureus subsp. aureus COL]  ali follow..  16  58............................SIAPSFYFDFNQPISICDVGAGAGFPSIPLKIMFPQLKVTIVDSLNKRIQFLNHLASELQLQ-RAETFGKGVYRESYDVVTARAV---ARLSVLSELCLPLVKKGGQFVALKSSKGEEELEEAKFAIS.............................................................................................................. 188
63 -14.100IDP95451 set236a-053 [Undefined organism]  ali follow..  14  55MTEREYKRAMELAAARDWEALLGMHASTRERLPVESAIGTPARILDLACGLNPVYLAHRL--PNAAITGVDISGQCVNVIRAFG---GAETRLGDLLCEIPEDEADAALMFKVLPLLRTGAAMDALMRVNAEWIVASF................................................................................................................................ 200
64 -13.800IDP90289 arginine methyltransferase protein, putative [Toxoplasma gondii ME49] TGME49_094270 [Toxoplasma gondii ME49]  ali follow..  13  198.MGGHMGDMDASVVETYFQYYGKMTTTYQRAIVENRADFEGKTVMDVGAGSG-ILSFFAAQAGAKKVYAVEASNMAATIALLCKGNPSLG-PLESIEDSEVPEKVDVLISEPIGTLLFNERMIETYLRFLKPGGKMF................................................................................................................................. 355
65 -13.400IDP92092 ribosomal RNA large subunit methyltransferase J, putative [Toxoplasma gondii ME49] TGME49_020940 [Toxoplasma gondii ME49]  ali follow..  15  116..SSHTSEWIKRQITDRYAQERNLRSRAAFKLEQL--FRKNQVVVDLGAYPGGWSQVALDRIGEGRVIAVDPVA---------DPLPHHTFIQGSVGQALGESKADVVLSDMAVKQDDHLFASDLMEQVLKLGGTFVTKM.............................................................................................................................. 277
66 -13.300IDP90290 arginine N-methyltransferase 1 [Toxoplasma gondii ME49] TGME49_019520 [Toxoplasma gondii ME49]  ali follow..  23  62...EQENLSSADYYFNSYAHFGIHEEMIKDSICQNAHLFANKVVLDVGSGTGILS-LFAAKAGAKHVYGIECSE-IVNIARKIVKENDVTFVQGKAEEVLPVEKVDIIISEWMGYFLLYESMLDTVLKWLKPGGMIF................................................................................................................................. 211
67 -13.200IDP02445 gene: speE; spermidine synthase [Yersinia pestis CO92] YPO3411 [Yersinia pestis CO92]  ali follow..  11  54................QTTERDEFIYHEMMTHVPLLAHGQAKKVLIIGGGDGAMLREVSRHKNIEQITMVEIDAGVVEFCRQAYDDPRFKLVIDDGVNFVTTEKFDVIISDCT-----TSVFYEGCARSLNEGGIFVAQNGV............................................................................................................................ 194
68 -13.000IDP91784 gene: ermA; rRNA methylase Erm(A) [Staphylococcus aureus subsp. aureus N315] SA1480 [Staphylococcus aureus subsp. aureus N315]  ali follow..  11  6...............PKDTQNFITSKKHVKEILNHTNISKQDNVIEIGSGKGHFTKELVKM--SRSVTAIEIDGGLCQVTKEAVNPENIKVIQTDILKFSFPKHINYIYGN--IPYNISTDIVKRITFESQAKYSYLIV............................................................................................................................... 127
69 -13.000IDP91589 gene: ermA; rRNA methylase [Staphylococcus aureus subsp. aureus N315] BAB41266 [Staphylococcus aureus subsp. aureus N315]  ali follow..  11  6...............PKDTQNFITSKKHVKEILNHTNISKQDNVIEIGSGKGHFTKELVKM--SRSVTAIEIDGGLCQVTKEAVNPENIKVIQTDILKFSFPKHINYIYGN--IPYNISTDIVKRITFESQAKYSYLIV............................................................................................................................... 127
70 -12.700IDP05733 putative RNA methyltransferase [Clostridium difficile 630] CD1208 [Peptoclostridium difficile 630]  ali follow..  10  36RCDKAGTEVKEDCSIEVKGNPIPYVSRGGLKLEKAMKN-DGKVCMDIGASTGGFTDCMLKN-GAIKVFSIDVGYGQLAWKLRQDDRVVCRTNIRNVTIEDTKQFADFASID--VSFISLKLVLPKAKELVRHDGEVVALIKPQFEAGREKVGK------------KGVVREKSTHIEVIKMISDFSVENGFEILGLDFSPIKGPEGNIEYLIHLRNGNEGYEFDGETYNNKIVEVVEASHNLD....................... 269
71 -12.400IDP04727 hemolysin A [Clostridium perfringens ATCC 13124] CPF_2072 [Clostridium perfringens ATCC 13124]  ali follow..  42RVDKAGEKVPVSSNIIFRGEKLPFVSRGGFKLDKAVKS-KGKRCLDIGASTGGFTDCMLQN--ASKVFSIDVGYGQFAWKLRVDPRVVCRTNVRYVTPEQIGELCDFASID--VSFISLTTVLPAVLNLLNDKGEVMALIKPQFEAGREKVGK------------KGVVREASTHKEVIKKIVDFALSHKLNILGLDFSPIKGPEGNIEYLI-YLKKDNNTEEFDYNIIDEVVDKSHSDL.......................... 271
72 -12.200IDP00061 hemolysin A BA_4399 [Bacillus anthracis str. Ames]  ali follow..  11  39RLDKPGEKIPQDTEITVKGQVMPYVSRGGYKLEKALET-QDKVMIDIGSSTGGFTDCALQN-GAKLSYALDVGYNQLAWKLRQDER--VVMERTNFRYVTPAGLPQFASID--VSFISLKLILPVLKTMLMPNGDVAALIKPQFEAGREQVGK------------KGIVRDRKVHEAVVEMIVDFAIKEGYDVEGLTFSPITGGDGNIEFLIHLKWHGE--RENGENHSPVSVEQVVTEAHDVLKQKGKGE............... 279
73 -11.900IDP04455 putative RNA methyltransferase [Yersinia pestis CO92] YPO1336 [Yersinia pestis CO92]  ali follow..  14  193ALPERFNQVPLYIRPQSFFQTNPQVAALYATARQWVQEHEVHSMWDLFCGVGGFGLHCAGP--ETQLTGIEINAEAIACARQSAEQKNVSFAALDSTRFATAQIPELVLVN-----PPRRGIGRELCDYLSQMAPKFILYSSCNAETMAKDISLLA.............................................................................................................. 347
74 -11.900IDP01328 gene: ksgA; dimethyladenosine transferase VC0443 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  12...MRNDVHLGHKARKRFGQNFLNDPYIIDGIVSAINPKPGQNLVEIGPGLGAITEPVGRE--VDKFTVIELDRDLAERLRNHPELSKLTIHEGDAMRFDFKQLVK-ISTPLMFHLFEFHRDIQDMHFMLQPGGRLTVMA.............................................................................................................................. 174
75 -11.700IDP04517 gene: ksgA; dimethyladenosine transferase [Clostridium perfringens ATCC 13124] CPF_2840 [Clostridium perfringens ATCC 13124]  ali follow..  10  12...KELVQKYNFRFSKSLGQNFLIDDSVPRDIVNGADVCEDDLVIEIGPGVGTLTVQLLKR--AKRVVAIELDSSLIPILTAELGDPKFQLIHNDALKVDFNEIIGYVTTPIIVNLLKGGYNFKSLTIMIQPNGALSILV.............................................................................................................................. 174

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.