current user: public

If you have questions about the server, please let us know.

Query: IDP92767 gene: csy4; Csy4 [Vibrio phage ICP1_2011_A] AGG09394 [Vibrio phage ICP1_2011_A], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MYNTISITVVDADDVGVNFVVSKVLSTLHNKGIFNGEVGVTFPRMDKNVGDIITLFSKTGVDRKVLTSTLNTLTDFIHIGKPKEADKVKTYRKVDTKSKGKLIRRCIKRKGVSAETAESLYGNYKGEKCKLPYIVVNSKSTGQRFSMFLEECENSEKFNSYGLCIVSCLast
1 -101.000IDP92767 gene: csy4; Csy4 [Vibrio phage ICP1_2011_A] AGG09394 [Vibrio phage ICP1_2011_A]  ali  100  1MYNTISITVVDADDVGVNFVVSKVLSTLHNKGIFNGEVGVTFPRMDKNVGDIITLFSKTGVDRKVLTSTLNTLTDFIHIGKPKEADKVKTYRKVDTKSKGKLIRRCIKRKGVSAETAESLYGNYKGEKCKLPYIVVNSKSTGQRFSMFLEECENSEKFNSYGLCIVSC 168
2 -6.520IDP01311 molybdenum ABC transporter, periplasmic molybdenum-binding protein VCA0726 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  132.................................ADSRLAVAQVD-AVPAG----MYAKQALQHAGVWPELE--SRLAQTNNVRLALALVERGESPLGIVYKTDALLSDKVTIVTA-----FSAQSHQPIRYPLAQLNDKAASAEWVAYLRSDAAQQILQRFGFESVS. 253
3 -5.430IDP00064 transcriptional activator tipA, putative BA_5200 [Bacillus anthracis str. Ames]  ali follow..  16  1MAMKVK---------EVANLVGISVRTLHHY----DEIGLLTPDETTESG---RLYSNENLEMLQQILFFKELG------PLKKIKEIIMSPSFDRKEALQLHKKMLLEKRARLDKVIATIDKTIQH......................................... 107
4 -5.270IDP02505 hypothetical protein lmo0526 [Listeria monocytogenes EGD-e] lmo0526 [Listeria monocytogenes EGD-e]  ali follow..  16  5...............ELAELTGVSVRTLHHY----DKIGLLVPQKDDWNG---RIYSEKDVDKLQQILFFKELD------PLKKIQQILDDPLFDKNVALDMQRHLLIEKKQRIETMLATLDLTIKNEKG...................................... 108
5 -5.130IDP01786 hydrolase, putative [Coxiella burnetii RSA 493] CBU_0502 [Coxiella burnetii RSA 493]  ali follow..  10  67LDYYYNHS---ELGKMRDRFRCHV--IIHSRSAQTDTIQIMQEENAQSVGGVMHCFTESWEMAEQAMKLFSGIVTFKNAKNVAEVAKKVPLEKMLIETDAPYLAPVPYRGKKNEPQYIPYVAERIAELKNIPLNEVARKTTENYYHLF.................... 224
6 -5.110IDP90369 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_181 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  74................................TQESGFAIQFPESPEHSEQVIEVPQSDLAIRYDTYVAETPSDSTVYVVSIWEYPEKID------ISRPELNLQEGFAGMLYALPESQVLYLKATALQGHKALEFWIACDHTLYQVFMLDKEYSTFIQSFKVTKVRN 224
7 -4.940IDP04370 iron compound ABC transporter, iron compound-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA4766 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  63SEDLLALGVQP--GMADIKNYNKWVNTKTKPSKDVVDVGTR-PNLEEISRLKPDLIITASFRGKAIKNELEQIAPTVMFDPSTSNNDHFAEMTETFKGKEEEGKKVLADMDKAFADAKAKIEKADLKDKNIAMAQAFTAKNVPTFRILTDNSLALQVTKKLGLTNTFE 236
8 -4.820IDP91025 gene: modA; molybdate transporter periplasmic protein [Yersinia pestis KIM 10] y3037 [Yersinia pestis KIM10+]  ali follow..  14  141.................................EGGRLAVGDPD-HVPAG----IYAKESLENLGAWSTLA--PEMARANNVRSAMALVERAEAPLGIVYGSDAVASKKVKVVGI-----FPEASHKPVEYPMAIVKGHDNVTAFYDYLKSPAAAVIFKNYGFTPR.. 263
9 -4.760IDP06069 gene: exbD_3; biopolymer transport protein [Helicobacter pylori J99] NP_224057 [Helicobacter pylori J99]  ali follow..  20  1MKKVESMNVVPFIDIMLVLL---VIVLTTASFVQTSKLPISIPQVDKD........................................................................................................................ 45
10 -4.710IDP06082 dehydrogenase [Helicobacter pylori J99] NP_223745 [Helicobacter pylori J99]  ali follow..  12  4.....QLFEFENLEDCHKALIERFKEFFNAALKKHHQVSVAFSG-----GRSISLLQKLSVLDLKWHECLISLVDERIIEASHEDSNAKLLHDYLLQNNALKASFTPLLPEKISGDTNELLDFANQHFKQPHLAILGMGTDGHTASLF.................... 142

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.