current user: public

If you have questions about the server, please let us know.

Query: IDP93890 adhesin [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005760 [Yersinia enterocolitica subsp. enterocolitica 8081], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MNMKKFVKKPLAIAVLMLASGGMVNMVHAEPTVINSKDISATKTVKEGGSFSVEFKATENEIVSGKLDADTPAFHLVMSDSGEHKGWNVRPTGASEGGQMVSADGTRVDLHTNELSWDNDHWWIDDGSERVEATFFLAAGDEVKAGEYQFTGRVEEYVELast
1 -108.000IDP93890 adhesin [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005760 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali  100  1MNMKKFVKKPLAIAVLMLASGGMVNMVHAEPTVINSKDISATKTVKEGGSFSVEFKATENEIVSGKLDADTPAFHLVMSDSGEHKGWNVRPTGASEGGQMVSADGTRVDLHTNELSWDNDHWWIDDGSERVEATFFLAAGDEVKAGEYQFTGRVEEYVE 159
2 -94.300IDP02265 gene: psaA; pH 6 antigen precursor (antigen 4) (adhesin) [Yersinia pestis CO92] YPO1303 [Yersinia pestis CO92]  ali follow..  45  1MKMKCFAKNALAVTTLMIAACGMANAS----TVINSKDVSGEVTVKQGNTFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGNNWYINDDSPKIKDHLYVKAGTVLKPTTYKFTGRVEEYV. 157
3 -9.930IDP05159 gene: calY; camelysin [Bacillus anthracis str. Ames] BA_1290 [Bacillus anthracis str. Ames]  ali follow..  17  1MSLKKKLGMGVASAALGLSLIGGGTFAYFSDKEVSNNTFAA-------GTLDLTLDPKTLVDIKDLKPGDSVKKEFLLKNSGS............................................................................ 76
4 -9.190IDP05463 spore coat-associated protein [Bacillus anthracis str. Ames] BA_1288 [Bacillus anthracis str. Ames]  ali follow..  19  1MTLKKKLGMGIASAVLGAALVGGGTFAFFSDKEVSNNTFAT-------GTLDLALNPSTVVNVSNLKPGDTVEKEFKLENKGT............................................................................ 76
5 -7.950IDP05418 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_1561 [Bacillus anthracis str. Ames]  ali follow..  12  1MSINKWLFRFIGFLVMLVVITTLNSLNVFASVNDLAQPIASAKVIE--ELNDDYFNPNVITIPIN----ESTTLLLKNKGKSEHT.......................................................................... 80
6 -7.410IDP05667 hypothetical protein lmo0462 [Listeria monocytogenes EGD-e] lmo0462 [Listeria monocytogenes EGD-e]  ali follow..  13  1..MNKLVLSTLSVAAMGMVIFSGGTAYAADKE--YTLVVPEKVNLSNDNATEMSVKTINRNLEPGKE------VEVTLSSGLSADGEIELERVGATSDVIFKSNNSTVTMANPVIGSFSGY---AIEETEVSKIQIGSPQGDKKAGAYQFTAAFK.... 161
7 -7.350IDP06529 gene: acm; collagen-binding MSCRAMM Acm (Fms8) [Enterococcus faecium DO] AFK59905 [Enterococcus faecium DO]  ali follow..  15  1..MKKCRNIILSMLFIITNITSLIPVHVYADAGRDISSNVTSLTVDPTNKVKFSFDEKKQNIQPG----DYLWINWNIRGEGFQKEIPLMIENKNVGTLTVRKDSAQVVFNEN.............................................. 118
8 -6.960IDP01314 hemolysin VCA0594 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  11..MNKTALLLTVVGAVLLTGCARQENEYTVKEYTSMANPASVYCVEQGGQLEMVTENEQRVTKDGEKIEQWEYF..................................................................................... 86
9 -6.640IDP92001 hypothetical protein SpneCM_05688 [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005688 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  1..MRKLTKGFLIFGVVTTVIGGIKSLLAMSKEPVYDSRMEELTFGKEVENLEITLHQHALTITDSFDDQIHISYHPSLSAHHD------LITNQNDRTLSLTDKKLSESPFISSGIDGILHIVSSSSNRFNDVIIGLPKGRTLK............... 147
10 -6.610IDP02471 hypothetical protein lmo0880 [Listeria monocytogenes EGD-e] lmo0880 [Listeria monocytogenes EGD-e]  ali follow..  13  1..MKKRWLVFAIICLIITGFLSPKAEAATDYGSLQNQNGEQATNFKENSKVRVAYDVITQPVASG----ETMTLTI--------------PDQNYGGFPLMDSQGNTI-----------ANATIDQVTGTITLTFYVNTHTDLS-GSLFYNATFNS... 138

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35