current user: public

If you have questions about the server, please let us know.

Query: IDP93928 virulence associated protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007710 [Yersinia enterocolitica subsp. enterocolitica 8081], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
1 -50.300IDP93928 virulence associated protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007710 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali  100  1MSILTNISPSIPSFAEQNLPEMVPGSAIGSEFQKKGANITVAAEREKAALINGADTIDVSNPSELLQFQSRMNNYNHAINFIATLTHKGASAIDSVLKAP 100
2 -41.000IDP04060 gene: mxiI; MxiI, component of the Mxi-Spa secretion machinery [Shigella flexneri] CAC05813 [Shigella flexneri]  ali follow..  20  18...................FQSQEISSLEDVVSAKYSDIKMDTDIQVSQIMEMVSNPESLNPESLAKLQTTLSNYSIGVSLAGTLARKTVSAVETLLKS. 97
3 -30.600IDP91494 type III export protein [Vibrio parahaemolyticus RIMD 2210633] VP1691 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  16  23.......EDGLSERFEQAMSIPEGNNGLEGGLLENISELKNTIDNAKSSLQDSMKMVG-DDPAQLLQMQWALTRITFQEELIAKTVGKTTQNVETLLKA. 113
4 -15.000IDP93816 putative type III secretion apparatus [Yersinia enterocolitica subsp. palearctica Y11] YP_006007033 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  14  32.................................................MQQVEPATPMISPDQFLSVQSEWMHATLSIDLTAKVAGVVGQNINKLVN.. 80
5 -13.900IDP91489 type III export protein YscF [Vibrio parahaemolyticus RIMD 2210633] VP1694 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  22  13.............................DDVKTKLEQQAKDANKSVTDAIKNLET-NADDPSKLAELQHAINKWSVVYNINATTTRAIKDVMQSILQ.. 80
6 -13.600IDP93927 hypothetical protein YE3551 [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007709 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  10  33.............................YRALAPLNGMIAQHGTALAEAFKDPKL-EIDNPVKLAELSILTSNFNFGRQFQSNCLKTFRDTTGVCIR.. 100
7 -13.300IDP93821 putative type III secretion apparatus [Yersinia enterocolitica subsp. palearctica Y11] YP_006007031 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  14  3...............................INALINGLAQSINKIGQDFQSQMASGNPSDPEHMLKMQFAMQQYSSYINFSSALMKNIKDMTSGIIA.. 69
8 -8.850IDP01827 gene: fliE; flagellar hook-basal body protein FliE [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0526c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  1...MNNINDLRLNNNISNTNKSQNSTGIGDEFAKMLKNEINDLNKAQESGEAAMTDIATGQVKDLHQAAIAITKAESSMKFMLEVRNKAISAYKEITRTQ 97
9 -8.320IDP05015 gene: fliE; flagellar hook-basal body protein FliE [Clostridium difficile 630] CD0247 [Peptoclostridium difficile 630]  ali follow..  33............................KKNFEDVIIDTIDKVNFQQVTADDMKEKFIKGEDVSMHEVMLIGQEAQLSMQYLIEVRNKIHDAYQEMNKVQ 104
10 -6.490IDP91172 gene: pcrV; type III secretion protein PcrV [Pseudomonas aeruginosa PAO1] PA1706 [Pseudomonas aeruginosa PAO1]  ali follow..  15  235.................................NPVGNFATTVSDRSRPLNDKVN-------EKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSA. 293

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.