current user: public

If you have questions about the server, please let us know.

Query: IDP95173 pullulanase-specific type II secretion system component B [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002917878 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MREQETVVIVRDDSERGIPPLVAHQPPSAQADAPVSRGRMVQIPGWIIPLYAGLFIALGWFGGEQWRHPSPPQTLPLPVAHAALLPLTAAGETAPKNPPSAVKASAPAAPEVDSDTLPPLRYSAHVYASRPEKRSIVLNGKAWTEGDSPLPNLVVEQIQQDVTIFSFNGTTFTLAALEDWPGGKIDEEPKEELast
1 -64.300IDP95173 pullulanase-specific type II secretion system component B [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002917878 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali  100  1MREQETVVIVRDDSERGIPPLVAHQPPSAQADAPVSRGRMVQIPGWIIPLYAGLFIALGWFGGEQWRHPSPPQTLPLPVAHAALLPLTAAGETAPKNPPSAVKASAPAAPEVDSDTLPPLRYSAHVYASRPEKRSIVLNGKAWTEGDSPLPNLVVEQIQQDVTIFSFNGTTFTLAALEDWPGGKIDEEPKEE 192
2 -15.400IDP00141 gene: mshK; MSHA biogenesis protein MshK VC0401 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  19  13........................................................................................VTYSYAGEDPTAPLGWVSPAKPELQKPSYPVPTLQSIVCAEG-RSCYAIIEQRVVAQGDVV-NGYRVATIHPDQVKLTRAGKEWRLALFTL............. 101
3 -13.900IDP93946 general secretion pathway protein C [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007723 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  13  51................................................LSTTVDNSETHALETHKDSIKGNQIAELKKLSLFSAETADASDNPYRVGYLAADDPLLFHAPPS------AARVVGILSSSIHEKSITIIEQSSYSQGEKMENNAVVIKIFDDRVIINHQGYYESL.................. 177
4 -13.500IDP91490 putative type III export protein PscD [Vibrio parahaemolyticus RIMD 2210633] VP1695 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  352.........................................................................................................LVLKSIPKVSKGTDIDFPFRSVNFGQVPYVILTDNVRYMVGARTPQGYRISSVTPAGIELVKGGRVITIEL--GYEGEKNHDKS... 433
5 -13.000IDP04716 general secretion pathway protein C [Yersinia pestis CO92] YPO0817 [Yersinia pestis CO92]  ali follow..  10  42........................................................YNDSNDMFILYDGQSYDSQNSTEKAKVIDSSNLSKMFDRKINKPDKKIEMNDVLFYSPEYIGEIKLVGVIEHSAPSESIAILEVTTHLTRENIYEDIVIVKIFTDRVIIKRNGKYYSL.................. 164
6 -12.600IDP04699 gene: yscD; virulence protein [Yersinia pestis CO92] YPCD1.53 [Yersinia pestis CO92]  ali follow..  16  360...................................................................................................................EVQAISLGKVPY-------VVLDNHQRYPEGAILNNGVRILAIRRDAVIVSKGKREFVIQ................. 412
7 -10.200IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  893.GTIELYLPSGEVIKKNMADFTGEAPQGNGENKPSENGKVSTGTVENQPTENKPADSLPEAPNEKPVKPENSTDNGMLNPEGNVGSDPMLDPALEEAPAVDPVQEKLEKFTA-----YGLGLDSVIFNMDGTIELRLPSGEVIKKNDLIA.......................................... 1039
8 -9.420IDP92122 DNA-directed RNA polymerase alpha chain, putative [Toxoplasma gondii ME49] TGME49_049560 [Toxoplasma gondii ME49]  ali follow..  10  649.KIDARREASAAGSAASDGGMEKDAKPSVWPVPGRGLGNEIFVASSPQEEEMMRGDTLREKKEAAARTLDLEQTRLQQHIPEGLGPRSGPTYGLSERDLDERLLDEEEEEERIVNTSAIIRKE-EAWKDKQRTYRDLAENEPLKQGD--GKGLV-MMEAPEWVMEDPMGQRKPI----GFSEFNDD...... 836
9 -8.650IDP01324 tonB1 protein VCA0910 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  55.KVAPAQPEQTQTEQSKPESVKPTPVQEVVKTPPAKPKVKPHKPKPQTVKKPVPAEQVPSKSVAKPQPEKVERTAETAQKPAPTPNQQPSQPTAASQGITSQPILVDKPALVSAQVQPR-------YPRIARKR----------EGTVM---YEIW-LDAQG-LLSSSGTE-ALEAIKQWK........... 224
10 -8.530IDP95107 pullulanase-specific type II secretion system component C [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002917874 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  16  45.............................................................PVSPEDISALPLTMPPPADPELKNVRPAFTLFGLAVKISPTPTDAASLNQVPVSSL-KLRLAGLLASSNPARSIAIIEKVSLSTGDPLGYDARIAAILPDRIIVNYQGRKEAI.................. 161

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35