current user: public

If you have questions about the server, please let us know.

Query: IDP95198 gene: wagK; WagK [Acinetobacter baumannii] AHB32695 [Acinetobacter baumannii], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MNNNKIALVVIVYGKALEDAMTIQSLLSFEEKLEHLLIVNNGPAVIDENSAVLTSLAQKHHHVVLENQVQNKPLSWIYNDFIQQYDADYYVLFDDDTEINIEYQNMLFTAQDIDIELPKIISMSDKAQYYPLVDGVIEQKDGIISNAKEVFSIGSGLVISKGVKEYFIENKMELFDSHFALYGVDFSFFRKINRIKQKSKVFNISSRSYINHSLSRAEKETSEWRDKERLYDLVLTLKYYYSYAELRILKLFLRKILGGKIKDALLILSTAFNGAHPRCSTNRKDIYLast
1 -92.100IDP95198 gene: wagK; WagK [Acinetobacter baumannii] AHB32695 [Acinetobacter baumannii]  ali  100  1MNNNKIALVVIVYGKALEDAMTIQSLLSFEEKLEHLLIVNNGPAVIDENSAVLTSLAQKHHHVVLENQVQNKPLSWIYNDFIQQYDADYYVLFDDDTEINIEYQNMLFTAQDIDIELPKIISMSDKAQYYPLVDGVIEQKDGIISNAKEVFSIGSGLVISKGVKEYFIENKMELFDSHFALYGVDFSFFRKINRIKQKSKVFNISSRSYINHSLSRAEKETSEWRDKERLYDLVLTLKYYYSYAELRILKLFLRKILGGKIKDALLILSTAFNGAHPRCSTNRKDIY 287
2 -51.600IDP95202 gene: wagD; WagD [Acinetobacter baumannii] AHB32412 [Acinetobacter baumannii]  ali follow..  15  1...MKFSAIIVTYNPNLNIFKLINVLKL---QGITSIVVDNASKDFDFK------GVENDQNCYLVRLENNLGIATAQNKGIEKAGAEQILFFDQDSSIPEDYIENLYANIDIGAIGPRFIDDRYNFYYKTISVTRNGFRIKHDVSNIDKPLHSTLLISSGSMISINTLKKVGLMRDNYFIDYVDTEWCLRAESLG---YKNFISAKAVMRHTIGDNVINLSAFRRYYRVRNAFYMMREPHVPIILAIREIFFSFI-------HQIILISFERNKSGYLKSYFKGLR 284
3 -49.300IDP95209 gene: wagM; WagM [Acinetobacter baumannii] AHB32686 [Acinetobacter baumannii]  ali follow..  11  2.....NSAIIVLFNPD--LIHLNNFIGQLSGQIDKIILVDNTPY----SLKQYGNDEFSEENIIYIDLKDNLGIATAHNAGIKKADSEYVIIFDQDSSVPEGFVNSLVSGKKIAAVGPSYIDIKTNTMAPVIQFNGLKVNRIIPKEEELYTSA-DYIISSGTLIHVDAFKTVGLMMEELFIDYVDLEWGLRAKKMG---YHCFVANHVVMKHSIGDRSIKVSDFRKYFIIRNAFFLILYSNLQANWRIVQIP-------KTFMYFGFLCLFVSPRLNNVKIFFQAFR 287
4 -49.100IDP95226 gene: wafX; WafX [Acinetobacter baumannii] AHB32312 [Acinetobacter baumannii]  ali follow..  11  2VLGCDVSIIIVNYNTYNLVLQCIESVIKNTKKSYEIIVVDNNS-----PNREIEKLNEIYPNVKLVLNTKNSGFGIANNIGNKYANGKFLFLLNSDTIVLDNSIYTLYENPCVGACGGNLCDIDLKPATSFTRSRILYNKDSFYSTETSPFKISGNISGADLMLSKAVFDELGGFDENFFMYYEETDLLFRLRNKG---YQTYIVPTSKIIHLEGASETF-KPIKLDWTHQSKKKYYIKNKTRFEFMLSNIIFKLMV------MQRLFIFKIINNEGKYSYWLSLY. 294
5 -45.900IDP95168 putative glycosyl transferase family protein [Klebsiella pneumoniae 700603] EMR24411 [Klebsiella pneumoniae 700603]  ali follow..  15  2.....VYIVVLNWNGLLDTLSCLNSLLELQEEKFKVVICDNGSSDGSVLVNFSSIKTTNNSGIYLINIGKNLGYAGGNNVGINFADMSYVWLLNNDTEVDPHSLLKMKEDKKIGICGSRLVYFSERDKLQGLGGVFANENATIEFDDEVISNSIDYVIGASMLISAEALNDIGVLCEDYFLYYEEIDYCLRAKNLG---YRIYCATESIVYHKEGASTQK-GILSDYFWVRNRILIAKKYYPASILPVYLSLFVTFFNRKAKNVLKIIFGSRDLYNLK......... 321
6 -42.900IDP95203 gene: wagE; WagE [Acinetobacter baumannii] AHB32413 [Acinetobacter baumannii]  ali follow..  14  1MIKI-VSSIVIYKHTYVELQDTLNCLIASNHI-KKIILVDNDESDWAST--------FGHDKVIYLKSKGNFGFGYGHNQAINKTDCDFFLICNPDIMFEESEFNNLVSRRTEGLFLPKIVYTNGENQFGARL-MSLDQEYLLKGYSIQQPIFAPYLSGCFMLFRSSALLDLKGFDERFFMYMEDVDLSRRCAK----MFGTMYYPHAQIVHVHEQASYKNKQL-LKAHLKSAIQYFNKWGWFYDIDRSKLNKKCLNQFHI.......................... 267
7 -42.600IDP95157 glycosyl transferase family protein [Klebsiella pneumoniae 700603] EMR18991 [Klebsiella pneumoniae 700603]  ali follow..  11  1MNKPSITVSIKTLNEAQGIEKTIDSVRKQLQPPHQIIVADSLS-----TDNTRELAIAKGAMVVCLDNAADRCCGIGHQLGWLYSEGDYLLLLDGDMELEPGFLDTLETHPEYAGVAGSVEMDDASNYEF---------KSRKQRLHLIYPQGDTDHLGGGGLYRREAIEKIGYLTNLNLHGYEEAELGIRLQAAGYKLHRLAAPYFSHASYTMPTFKMLAYRWKNGFLWAPGELLRNCWGKAHFPAALRIVRNELIFTLYLLVLLVCLLTFNGK............ 267
8 -36.600IDP01257 glycosyl transferase, group 2 family protein BA_5677 [Bacillus anthracis str. Ames]  ali follow..  11  1.........MATCGRRDDILDLLKSLEQQTYKNFELIVVDQNDTPISDLFDEY----KDKFSINYIYT-PIKGLSRARNAGLKVADGDFIAFPDDDCIYEKNVLESILSNKDVHFISTNTTNVEGTGSLIHAPNTDIILN----------NKYGFMGPSFTLFFTKQFVQDVGTFDEDLGV-GEETDFVLRGMK---QNYTGLFRKDLFVYHPVKEEIINEQSLKRAISYAGGFIIRLHYGFPYFLRAVAAATFRMTQNISNDKRKFHANRLRGI............ 261
9 -35.700IDP95221 gene: wafD; WafD [Acinetobacter nosocomialis] AHB32540 [Acinetobacter nosocomialis]  ali follow..  12  4QEQPLVSVVIPCYNHENFVQHCIQSVIDQSYENIELIIIDDGSKDNSVLNEMLEKCKERFTHFEFRYR-SNKGLTSTLNEALEWCRGEYFSAIASDDLMKEKKTEKLRENQQVAAVFGGVELINDKNEIVDIR-----VHPDKTYTFKEIILNKHDLPASTQMARLKLIKDIGGYNTDYKI--EDWYMLLKMAKKEFDIVYMKEVFCSYRFHENNFSKNMEIMGNEMKKIIAEYKDNIFYKEALKIIYKQEFNYFKNKKDYIKAFNTLFKFFI.............. 274
10 -35.300IDP95204 gene: wahC; WahC [Acinetobacter baumannii] AHB32284 [Acinetobacter baumannii]  ali follow..  17  1MSINNVCVLLSTMDN--------KIPLFLKKNSGVAVVINQTKDLD----------FVGFNNIVFHNF-NEKGLSKSRNRAILLANSKYCCIADDDIYYVDDYKEKIIKIPDADVLVFQIYTPEGLPY----------KKYKNYIFKMNKFSIMKVSSIEIIFNREAILSKNIRFDERFGL-GEENIFLADCLKNGLN---IYAVNENLVFHPFESSGKIIND----NFFYDRGAVFFRIYGFFIANLLYFYFSFKKSKSKRQALSNLILMYKG............. 247
11 -34.000IDP95201 gene: wahH; WahH [Acinetobacter baumannii] AHB32860 [Acinetobacter baumannii]  ali follow..  11  1MSDPLVSVVIPCYNHESFVQDCIQSVVDQTYQNIELIIIDDGSKDNSVAKEMISICEARFTRFEFRHR-SNKGLSATLNEALEWSKGDFFETLASDDNILVDKISFFKKNLNIVALFGNVNLIDNNNIII-----KTENFPSRYYSFESIFLNKHHINASTQMIKMAALKAVGGFKNGITI--EDLYMWLKLSQKGDIFVHNKVLSNYRL-HDNNSIKKGEFIYKGTLDVIHEYY.................................................... 232
12 -33.400IDP95195 gene: wafF; WafF [Acinetobacter nosocomialis] AHB32537 [Acinetobacter nosocomialis]  ali follow..  11  3VSKPLISILIPVYNVEAFVKEAVLSICNQTYKNIEIIVVDDCST--DNTYNIVAELAIIDPRIRLYKNDKNSKIVKTLNFALEQAKGEFIARMDGDDISTPERLEKLLKNPQYYLVGCHVNTIDPNNRIIGKQEMPINDNI-------NKTIKYTSPVLHIWLAKREVYTKLKGYRE--IPGAEDYDFLLRMHSLGLLFTNLNSYEYSVRIREGNTTSTIGFNQR.............................................................. 221
13 -33.300IDP95215 gene: wagQ; WagQ [Acinetobacter baumannii] AHB32717 [Acinetobacter baumannii]  ali follow..  11  4KNKPLVSIVIPCYNHEKYVQDTIRSVIDQSYENIELIIIDDGSKDSSVEQQMLYECQNRFTRFEFRSR-ANKGLSATLNEAIEWSKGKYFSAIASDDLMLKDKTSTLEKNNEVVALFGSVNYINENNVVQ-----QINTLEEKEYPFDKIILNECHFYAPTQMLKMEVLRKIGGYNEEIRV--EDWYMWLKMAENG-KVLCISDKLAIYRIHSANTTRNSKFIFEENLKTLNYYKNHELYNQAYHKLRWTYIIWTGQKSKIESLLLLFKFILS.............. 273
14 -32.800IDP95197 gene: wafZ; WafZ [Acinetobacter baumannii] AHB32309 [Acinetobacter baumannii]  ali follow..  11  1MEESSISVVIPMYNASNTIVDVLNSVKEQTLKNYEVLVVNDGSKDNSKDIVEKYIAENKDFNVILIDK-PNGGVSTARNAGLSQSKGDLIAFLDSDDKWFSNKLEKLNEHPEIDLLGCAFDGLYLENEPDGKLLKIEINN----------LIFKNYFQPSTVIMKRKVFKEVGYFDENQ--YAEEGNYFIRIANKFNCFFCNMKVINYGDGSGFGASGLSANLKEMHKGFIKNLKFAYKNNLITFNKYILARTIEQLKYIRRIVIVGLKK................. 266
15 -32.400IDP06234 glycosyl transferase family protein [Streptococcus pneumoniae TIGR4] NP_344649 [Streptococcus pneumoniae TIGR4]  ali follow..  10  5VESLLVSIVISAYNEEKYLPGLIEDLKNQTYEDIEILFINAMST--DGTTAIIQQFIKEDTEFNSIRNNPKKNQASGFNLGVKHSVGDLILKIDAHSKVTETFVMNNVQQGEFVCGGPRPTIVEGKGKWAETLHLVEENMFGSSIANYRNSSEDRYVSIFHGMYKREVFQKVGLVNEQLGR-TEDNDIHYRIREYG---YKIRYSPSILSYQYIRPTFKKMLHQKYSNGLWIGLTSHVQFKCLSLFHYVPCLFVLSLVFSLALLPITFVFI................ 277
16 -31.900IDP02521 gene: waaV; lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1146c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  2...PQLSIIIPLFNSCNFISRALQSCINQTLKDIEILIIDDKSK--DNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACKIALKEMKKGLCFDAFVHRVKTKQFYRFKQDEFFNQKEFLEFLSKQRHFCWSVCFRKDIILKSFEK----IDERLSY-GEDVLFCYVYFMFCEKIAVFKTCIYHYEFNPNGRYENKNKE................................................................ 222
17 -31.600IDP95231 gene: wahD; WahD [Acinetobacter baumannii] AHB32285 [Acinetobacter baumannii]  ali follow..  13  2...NLVSIITPSYNSAKYIGKTIDSVISQTYKKWELIIIDDCST--DSSVEIIKDYENKDNRIKLIQLKENSGAAVARNTGIQLARGRFIAFLDSDDSWLPEKLEKFMLINNYYFTYTSYFKINENNEILGTMYIPSKVNYSQLLKTCVIGCLT--VIYDAEKIGKQEFPLIRKRQ--------DFALWLKILKKVDYAYGLQENLANYTIRSDSISANKLNAAKYNWFLYRNIEKLSLFVS--FYYFLHYVIKGIIRSKFPKMALLFK.................. 256
18 -31.200IDP95116 hypothetical protein KP1_3691 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002920342 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  12  5KSDIIVSVVIPVYNAEEYIADTLKNIVSQSLYEIEIIIINDHSS--DNTLDILKEIASSDERIRIIDNAINIGAGISRNIGLSEAKGEYIIFLDDDDYVDTNMLKHMSDLSGADIVVCRSRSFNLQSLQYAPMPDSIRKDLLPEKAVFSPGDIERDFFRADKLFRREFIIQHSLYQD---RTSNDLFFVCASMLSAEKVTILDEILIAHTINRKTSLSSTRSV................................................................ 233
19 -30.800IDP95207 gene: wahA; WahA [Acinetobacter baumannii] AHB32281 [Acinetobacter baumannii]  ali follow..  18  1...MLISIIIPAYNASKTICKTLESLIKQNRSDFEVLIIDDGST--DDTYEICRDYINQKENFKLIK-QKNKGVSSARNLGLRNASGDYIVFMDADDILSNTAINEIYNKNDSDIIFFDYYVKIENEEKYIKSLNSLQKDALLKDIMKGVM---RGFVWNKIFKRNFILDNRLSFNEKLKY-CEDEEFLLDAIWFSKEISYLERGLYYYIQHENSFTNQKMDD................................................................ 216
20 -30.800IDP02264 putative sugar transferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1438c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  4YNTPKVSIVVPSLNSISYIRECIDSILNQTLKDIEILCIDANST--DGTLEVLKNYEKKDKRLRVII-SDKKSYGYQMNLGIKEAKGEYLGIVESDDYIKTNMYERLYEKNDCEVVKGDFYILESNKGKYSKITPIDFLYNQIISFKTHPNIFNFQSINPIGIYRLDLLRTNQILNETPGASYQDNGLWFQIFALAKSIYFINEAFYMLRRDNPNSSVKSKEKVYCACEEYDFIRDFLKKHPDLEKTLAPICALHRFGNYMFTLERIDERYKLDFLKRFSQDFRKI. 290
21 -30.300IDP02481 putative galactosyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1139c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  2...SQISIILPTYNVEKYIARALESCINQTFKDIEIIVVDDCGN--DKSIDIAKEYASKDDRIKIIHNEENLKLLRARYEGAKVATSPYIMFLDSDDYLELNACEECIKGGKIDLLCFEAFITNAKKSIKKLNIKQGKYNNKEFTMQKNPFWTMWAKIIKKDIYLKAFNMLNLKKEIKINMA-EDALLYYPLTILSNEIFYLTQPLYTQHVNSNSITNNINSLEANIQEHKIVLNVLKSIKNK............................................ 248
22 -30.100IDP95137 putative glycosyl transferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337623 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  14  1MSTPLLSIVAAVYNGEKFLAQFFECIEQQQLDSYELILVNDGST--DNSLAVIAEWQERLQNVQVLE-QENQGVSVARNTGLAAASGKYLAFPDIDDKLYPGMYRTLLEKEHLDIATCNGTYVYEKRRESHPIFPLDRLPSTDVLPGHVWLKQALHVTWLNIYRHDFIRQHHFHFEPG--LRHQDIPWTTEALLAAERVQYTSQQFYDYYIHSESVSHKPDNDDTLMRSA......................................................... 235
23 -30.100IDP95142 putative glycosyl transferase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002921818 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  14  1MSTPLLSIVAAVYNGEKFLAQFFECIEQQQLDSYELILVNDGST--DNSLAVIAEWQERLQNVQVLE-QENQGVSVARNTGLAAASGKYLAFPDIDDKLYPGMYRTLLEKEHLDIATCNGTYVYEKRRESHPIFPLDRLPSTGVLPGHVWLKQALHVTWLNIYRHDFIRQHHFHFEPG--LRHQDIPWTTEALLAAERVQYTSQQFYDYYIHSESVSHKPDNDDTLMRSA......................................................... 235
24 -30.000IDP01764 putative sugar transferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1434c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  4YNTPKVSIVVPSLNSISYIRECIDSILNQTLKDIEILCIDANST--DGTLEVLKNYEKKDKRLRVII-SDKKSYGYQMNLGIKEAKGEYLGIVESDDYIKTNMYERLYEKNDCEVVK-IFAYGKTEYVNVLRNSCEDIYNYKVNWNKDIRIFLGSDGINPIGIYRLDLLRTNQILNETPGASYQDNGLWFQIFALAKSIYFINEAFYMLRRDNPNSSVKSKEK................................................................ 230
25 -30.000IDP95240 gene: wagS; WagS [Acinetobacter baumannii] AHB32714 [Acinetobacter baumannii]  ali follow..  12  3.SQNYISVGIPIYNASAYLEDAIKSVLAQSFQNFELILIDDGST--DDSLKIAKSFND--SRIRVYSDGLNKKLPTRLNQIIQMAKYDYIARMDADDLMDVDRLKNLKNNPNIDLVTTGMYSIGKNNEILGKRIPNNKMMTASEILGGITNLLHASMLARKEWCLR------NPYRVDN-ALAEDYELWLSAAIKND--LKYTVIQEPLYYYREIENVKLDKMIKGYNTQIDVI..................................................... 226
26 -29.600IDP01975 hypothetical protein Cj1442c [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1442c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  2...PLLSVIIPFGLSKIEERVLQKAKFFQSDENIEFIFVEGYSSKDHELKNFIQ--ANHHIYLKDMDQ-KAFSQGRCRNLGASYAHSNVLLFLDVDCYISLDNFEKILKLIQIKIVLPVVYLNKEANEKLKQYDDKFWDQEDLFTAKNTWVKFFAPSSTSSIVINKHQFLRLGGNDENFIGHGEDFDLFARILKACVS---FEKMPTNLSYDARNWNFFNFKGFRSWFSLLGYEACFY................................................. 247
27 -29.100IDP01720 gene: wlaD; general glycosylation pathway protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1128c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  2...PKLSVIVPTFNRQVLLEKAIKSIQNQDFKDLEIIVSDDNSS--DDTKSVVQNLQKDDDRIKYFLNQNKQGPNGNKNNGLDQASGEFVTFLDDDDELLSGALSTLMQEGYAHVFGNCLIEKEGNLSKEFSGKGLEKDSEISKKDFLMAKFSGEFSVFKKSLLENKR------FNEE--FYGNEATLWVNL--YKEKSFYIHKAFRIYRIFRQDSVTLGASK................................................................ 214
28 -29.100IDP95190 gene: wagY; WagY [Acinetobacter baumannii] AHB32616 [Acinetobacter baumannii]  ali follow..  13  2..RKIISVIIPIYKVEDYIEECINSILVQITPEIEVILVNDGTPDNSFNNILELEPLEVRNCFILLE-QENQGQSKARNFGLSIATGDYIAFLDSDDILEKNYFSVLLEKFSPDIISFKSNRFKKNQEDAFLFEVGVNKEGIFPNSFNLLTEIFNQSAWFPNIYKQTLFKNK--FPVG--VYYEDAALIPELFLQAKTICFLKDSLYGYRINQGSSLLNKSLK................................................................ 226
29 -28.700IDP95222 gene: wafM; WafM [Acinetobacter nosocomialis] AHB32667 [Acinetobacter nosocomialis]  ali follow..  15  2...KKLSIVIPAFNAENYIINTLVSMVNQPFNNIELIVVNDGSS--DKTLESVEQFSKGVPGITLIYSKENGGLGSARNFGIEKAKGDYIWFFDADDIMEKGSLSKVMSNDDLDLLGFGVKETYVKTNKIKVVNVKNRPINVVVNGRNYIENYDIGHSACCFIVKKSILIENSIFLED--VLSEDFDFELRLFEKCKNITHIDAICYNYIIREGSLSRRKNSE................................................................ 223
30 -28.400IDP95239 gene: wagN; WagN [Acinetobacter baumannii] AHB32491 [Acinetobacter baumannii]  ali follow..  12  1MS-IELTIFTPSYNRAHTLPRVYQSLKEQTLQNFEWLIIDDGSVD-DTEKVVSEFINEQKLKIRYIK-QENVGKQAAWNKAIAMAEGRIFCCLDSDDALYSRYNVDDIERDDVVGLRFLAYSNVKNTYDGDEVSKTIVVRTYFYELSNHKNYGERIDFIKTHVIKNFLFP----VEKDIKF-IPEIWFYVALAKAGYSFVYIPEPARIFFDDDPNNRLSRSSIRK.............................................................. 225
31 -28.000IDP95206 gene: wafJ; WafJ [Acinetobacter baumannii] AHB32561 [Acinetobacter baumannii]  ali follow..  15  1...MLISVILPAYNAEKYIKEAIDSVLAQSLKDFEFIIINDGSI--DKTEEIVLSYSD--ERIVYVKNHKNLGLIKTLNKGIGLAVGKYIIRMDADDICMPQRFEMLEKNLEYGVVGSCALIHGTKDLY----------IVPESDEDIKNYMFIDSPFIHPSVCIRARLLKENLYSEDFF-RIEDYELWVRLAQKT-KFYNIQETLLKYRVIDGSESHLLKKQIERKNEMMGRVL.................................................... 220
32 -27.600IDP95194 gene: wafL; WafL [Acinetobacter nosocomialis] AHB32668 [Acinetobacter nosocomialis]  ali follow..  15  2...IILSVIVPIYKVEEYIVECIESICNQLISGVEIILVNDGTPDTSMRNYIAQKYPHFENQFVFID-QKNQGQSVARNNALKIAKGEYVGFLDSDDYLLPNYFYELMKEKNVEIIHFNAKQYTEDQGYIDSMCFVKENKVSINNELYREKLFLQLRVIRKDVLNKFQFDANVYMEDKLLFP......................................................................................................... 191
33 -26.300IDP06527 family 2 glycosyl transferase [Enterococcus faecium DO] AFK59581 [Enterococcus faecium DO]  ali follow..  13  3.ENPLVSIITVCYNSSLTIEDTIKAVLNQTYRNWEHIIVDGGSK--DDTIGIIKKYEYQYLGRLKLHQGPDKGIYDAMNKGIGFARGEIIGIINSDDWYSSDALEQVVVDGNEKIITGGLNRVRGNTVIYNQMHREI---------SLGGLKKGMPLQHPAVFVTKAVYDRMGTFDISYPH-IADYDFIWRCYADGNVKFLFVDSVVSFMRDGGASDCLSWKHIWSRTTERFRLRRKYISPVEAFVSCCKFFLKEICFQLVKASI...................... 259
34 -25.500IDP02599 putative galactosyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1138 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  1M--KTVGVVIPIYNVEKYLKECLDSVINQTYTNLEIILVNDGSTD-ENSLNIAKEYTLKDKRIILFD-KKNGGLSSARNVGIEYFSGEYKLKNKTQTIKENSLIEFNIEPYEIYTVY.......................................................................................................................................................................... 116
35 -25.300IDP01973 putative sugar transferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1440c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  1M--KTVGVVIPIYNVEKYLRECLDSVVNQTYKNLQVVLVNDGSTD-ENSLNIAKEYTLKDERFILFD-KENGGQSTARNVGIEFFSKEYDFKNITQELKENSLVEFKLDNED............................................................................................................................................................................... 108
36 -25.000IDP95241 gene: wagV; WagV [Acinetobacter baumannii] AHB32824 [Acinetobacter baumannii]  ali follow..  43.SDAPVIVSLTSYYKRFDVYLVVESLFQQNYQGKYEIIFSISQEDIDKFGGMPKNIEKLISRLQVKILDENIKSYKKAFYVADQNNTKSIITVDDDVYYPSWWLKIMVDSALMAYRGHYIVNKNNRILTYMDWLNKSDKFFDKEALYSFMPTGTSGVYYPIGALNGLSASKEQF--LELCPHADDLWFKYITVMNGFKAKRILERNIHFMILKDGDSLMAIN................................................................. 269
37 -24.600IDP02173 putative galactosyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1136 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  2...KKVGVVIPIYNVEKYLKECLDSVINQTYTNLEIILVNDGSTD-ENSLNIAKEYTLKDKRIILFD-KKNGGLSSARNVGIEYFSGEYETYIEKENELNVFKIIGDNP.................................................................................................................................................................................. 106
38 -23.600IDP95193 gene: wagW; WagW [Acinetobacter baumannii] AHB32834 [Acinetobacter baumannii]  ali follow..  13  2.....ISVCLATYNGEKYIVEQLTSILSQLSPTDEVIISDDHST--DETLLLIKSLNDP--RIKIITNELGKGYTKNFENAINHSSGDYIFLSDQDDVWVENKVELMMKYLDFDLVVSDAIISDSHLKPTLGSHFELHNTKAGFLN----NWLKTRYIGACMAFRREIFSKLLPFPIQSKWCAHDY-WIANVGEFFFKVKLLEAPLIKYRRHGNNASTGGEKSTNSLFH.......................................................... 217
39 -23.500IDP02033 glycosyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1135 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  253QKPKTCALIITTYNQKERLKLVLDSVKNLAFLPNEVLIADDGSKEDTARLIEEYQKDFPCPLKHIWQEDEGFRAAKSRNNAIKASKSEYIILIDGDMILEKDFVKNHLEFAKRKVILLAFNKKGFKNQRSIFLAKCVYKFSKLTKKFFKKSQLVKGSKTCNMSFYKSDFEAIEGFNEKFIGWGEDSEFVARFLFNDGVFKRLKFNALAHIYHEENSKNMLEINHQIYLETIK....................................................... 508
40 -23.500IDP01189 glycosyl transferase, group 2 family protein BA_0505 [Bacillus anthracis str. Ames]  ali follow..  11  269KEKAKYSAIIPVSEEKTTIRSVIQEVKKAGV--DEIIIVANGADIETIK---------NLENVIVVEVTKTLGNNVARAIGAMHATAEICLFVDGDYAIPAKKLVPFLRAIEDGSDM-ALNDLQCLLDIFHPADPISMGKYFVNLVAKRPDLWNNSLTAVPHAIRKKVIEKIGYDSLIILAQMKAILEGFSITTV............................................................................................ 455
41 -21.800IDP01116 glycosyl transferase, group 2 family protein BA_1693 [Bacillus anthracis str. Ames]  ali follow..  17  3VIKPFILACLIVKKRKDILGKCLYSLESIGG---EIIIVDNGS-----TDKKKEIAQKLTDKVYDFKWMNN--FVEARNFAASKVSGTWIIAVDADECIDINNFVAAME.................................................................................................................................................................................. 101
42 -20.800IDP01367 lipopolysaccharide biosynthesis glycosyltransferase, putative VC0224 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  1MSKPTLAVALIVKNEARHLDECLQTVHDWVD---EIVVLDSGSHDETEQ-------VARRYTEKFYVNAKWPGFGLQRQLAQSYVQSDYVLWLDADERVTPELKQSILQ.................................................................................................................................................................................. 99
43 -20.700IDP05261 gene: tuaG; putative teichuronic acid biosynthesis glycosyl transferase [Clostridium difficile 630] CD2772 [Peptoclostridium difficile 630]  ali follow..  10  1......................................MDDCSK--DNSSEIIKSFRKEDARIKYIKLEKNSGAAVSRNVGIKNAEGRFIAFVDSDDLWDSRKLEEYMLKENVGFSFTSYRYMRQDGSKTNKVARAPKKIDYEGLLRNTIIGCST-VVIDKEIVGEFSMPLVR--------RGQDTATWLQLLKKEKYAYGIQEDLVNYRLVGNSISSNKIKALKRTWNTY------RNVENLSLPKSLYVFCFYVFNAIKKRV....................... 212
44 -19.300IDP02133 gene: kdtX; lipopolysaccharide core biosynthesis glycosyl transferase [Yersinia pestis CO92] YPO0054 [Yersinia pestis CO92]  ali follow..  11  3.TKKRLSVVMITKNEASLLTDCLASVAWAD----EIIVLDSGSEDETRA--------AQQFGAKVYSNINWPGYGKQRQLAQQYASGDYILMLDADERVTPELKIAIES.................................................................................................................................................................................. 99
45 -19.000IDP95118 glucosyl transferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337625 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  10  2..SNRLSVVMIAKNAADLLPDCLGSVSWAD----EIIVLDSGSTDNTVE-------LARRLGAQVYTHTDWRGYGIQRQRAQDYATGDWVLMIDTDERVTPELRQAILK.................................................................................................................................................................................. 97
46 -17.800IDP95165 glucosyltransferase MdoH [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002918834 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  10  242...HRTALIMPICNEDVDLRATWESVATGNAAHFDVYILSDSYNPDICVAEQKAWMEQGEGQIFYRRRRRRVKRSGNIDDFCRRSQYSYMVVLDADSVMTGECLSSLVANPNAGIIQSSPRASGMDTLYARCQQFATRVYGPLFTAGLHFWQ-GHNAIIRVKPFIEHPLPGEGNFAGSILSH--DFVEAALMRRAG---WGVWIAYDLPGSYEELPPNLLDELKRDRRWCQGNLMNFRLFLVRGMHPVHRAVFLTGVMSYLSAPLWFMFLAL............... 533
47 -17.800IDP01204 glycosyl transferase, group 2 family protein BA_2274 [Bacillus anthracis str. Ames]  ali follow..  12  11.EEKKLCLCMIVKNESRIMERCLNATKSIVD---FVSICDTGST--DHTPEIIENWCKENEIPGTVHHEPFKNFGYNRSLAVSLAEADYLLILDADMILEVDPEFDKTS.................................................................................................................................................................................. 118
48 -17.800IDP01212 glycosyl transferase, group 2 family protein BA_3024 [Bacillus anthracis str. Ames]  ali follow..  13  256YNGKQLSIIIPAQNEEATIKEVILEARKI--EPKEIIVVINGSTDQTEA-------IAKQLGATVIVYEEALGHDVGRAIGAQEATGDILLFIDADFAIPAKDLHPLTKAVVDGV............................................................................................................................................................................ 361
49 -15.600IDP05189 putative glycosyltransferase [Clostridium difficile 630] CD0240 [Peptoclostridium difficile 630]  ali follow..  18  1...MLLSIVMMVKNEENILEKTLKSLSVLRNSESELIIVDTGS-----TDNTIRIAKQYTEKVYFHNWNDD--FSSMRNISISYAKGEWLLILDADEVLIDY......................................................................................................................................................................................... 93
50 -15.100IDP05174 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_2570 [Bacillus anthracis str. Ames]  ali follow..  18  1MQPIQVALTCITHDPTGSLLSTIKELLIHLNYHKKYITISNVT-----PKEIVKELEECNFHIN---IVEKSGVGNARRDCLKNYNHDYYHYCDFDRLLPAELNSFIQNIADVDYLI.......................................................................................................................................................................... 122

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.