current user: public

If you have questions about the server, please let us know.

Query: IDP95326 hypothetical protein A51_C0019 [Vibrio cholerae MZO-3] EAY41860 [Vibrio cholerae MZO-3], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330
# Score Template Links and tools%idFirst MKKFIVICLMLLHSAVWANTPIEQGIRLFNQKEYQQAQQIFQQQSDVGSAYATFWLGVTQYKNRQHFEAGDTFLKAAEMGDPWAMGVLGDVNLYANNPCKFLGWPCDEKWLTKAKQGWKVLAENGNGKAAFALKINQREWWEYIPFYRQSRYQEIVSKAIPNGGYKFLDYNTYWDSSEAKLPYLKLAANQGYAPAMETLYYRMDTIGYDEAMKWINKAIELGYAEAARTLYLAYRVGEKDRDGNVILQPDPKKAYFYNRLTGALGGEEKLAHLITQEPVHDDDGIPLADENGEPVFEILVTEQEQAEMDKQVAEFVKDIKPNLFLDETSIDLFLast
1 -132.000IDP95326 hypothetical protein A51_C0019 [Vibrio cholerae MZO-3] EAY41860 [Vibrio cholerae MZO-3]  ali  100  1MKKFIVICLMLLHSAVWANTPIEQGIRLFNQKEYQQAQQIFQQQSDVGSAYATFWLGVTQYKNRQHFEAGDTFLKAAEMGDPWAMGVLGDVNLYANNPCKFLGWPCDEKWLTKAKQGWKVLAENGNGKAAFALKINQREWWEYIPFYRQSRYQEIVSKAIPNGGYKFLDYNTYWDSSEAKLPYLKLAANQGYAPAMETLYYRMDTIGYDEAMKWINKAIELGYAEAARTLYLAYRVGEKDRDGNVILQPDPKKAYFYNRLTGALGGEEKLAHLITQEPVHDDDGIPLADENGEPVFEILVTEQEQAEMDKQVAEFVKDIKPNLFLDETSIDLF 333
2 -91.500IDP95380 set238a-017 [Vibrio cholerae]  ali follow..  69  8MKKIIVICLMLLHSAAWAMESVEQGIRLFNQKEYQQAQQIFQQQSDAGSAYATFWLGVAQYKNRQHFEAGQTFLQAAEMGDPWAMGVLSEYEYYVNHPCGYLGWPCDKKWYDLAIKGWKKEAEKGNGKALLQLQFFTNQWRNYIPFLGRYLIDKKYIEAFELGSVLYVSRFSNIS-VEDEIKYLKLAANQGYAPAMETLYYRMNTIGYDEAMKWINKAIELGYAEAARTLLLSYTLGEKDRDGNIIMPPDPKKAYYYSRLTEALGGPKQDNSLILYRNVIKD-GLPVSDENGEAVLEILVTEQEQADMDKQVAEFVKDIKPNLFLDETSIDLF 341
3 -78.500IDP95323 hypothetical protein A55_A0022 [Vibrio cholerae 1587] EAY35133 [Vibrio cholerae 1587]  ali follow..  19  52...........ISSTVKPGDKMYEILVNIQHGRHDIASSKLQSLIEGNDSDAMVWYAKLIYRASNRPKALSLYQKAMDDGNPYAYIMLSPGLISSGCVSYFGEKNCTLEHFNKAIELFKPLAAQGDLRAQYFLLQQKETRAQYIQEVIRFSQAHYYQPLMDYVNTILTRPQRTTEQYNLAIDLLTIAANNNYIPAINKLSFLLEDTAQEESERLINLSLKLGSTSTVKYKYHRSNRGS-------------EEKYFYNALYKGLSGEYSFD-------------------------VHTLNDEEKAKVNEKVKLFMKDITPMVYIDGFTSR.. 348
4 -72.800IDP95329 tryptophanase [Vibrio cholerae V51] EAZ51002 [Vibrio cholerae V51]  ali follow..  16  52...........ISSTVKPGDKMYEILVNIQHGRHDIASSKLQSLIEVNDSDAMVWYAKLIYRANNRTKALSLYQKAMDNDNPYAYIMLSPGLISSGCVSYFGEKNCTLEHFNKAIELFKPLAAQGDVRAQYFLLQQKETRAQYIQEVIRFSQAHYYQPLMDYVNTILKYEARTTEQYNLAIDLLTIASNYNYVPAIKRLLEV--DLDEEVFTKRMEQLTRLGSTFEIYENYFNS--------------QDEHERHYYSMLFKQLTGDNKLSS------------------------SYSATDDEVKMINEKIEKVISSMTPMVYIDGFT.... 344
5 -70.500IDP95345 FOG: TPR repeat [Vibrio cholerae AM-19226] EDN17312 [Vibrio cholerae AM-19226]  ali follow..  16  52...........ISSTVKPGDKMYDILVNIQHGKWDVAEGGLLSLIDEGNPDAMLWYALMLLLDNKRREVTNLIFKSLTSGNPYAALAIAKNSHACA--DPNSARLCTDNNFKKAIELFKPLAAQGDLRAQYFLLQQKETRAQYIQEVIRFSQAHYYQPLMDYVSTILTREAKTPELYQLAIQLLTVAANNNYIPAIEFLVRQDS--DLKSNDDLYLKLKTLGGTHFYKTRFFEFKNEFNNR-----------QLYCYATLYEAITGSDK--------------------------FFIGIENEENITADCNIEESMKEMTPMVYIDGFT.... 360
6 -47.100IDP90083 hypothetical protein CGSHiII_00664 [Haemophilus influenzae PittII] ZP_01795671 [Haemophilus influenzae PittII]  ali follow..  18  10..............................TALFGASIFSFQSTAWADTPEQQFQQGLTAYEQSDYQTAFKLWLPMAEQGYAQAQGGLGMMYERGLGVKQ--DDFKAVNWYRKAAEQGDADAQLNLGAMYAIGHGVKQDGVEAVKWFRKAAEQGNAKAQNGLGMMYRGRLGIKQDYFK-AVKWYRKAAEQGYGGAQVMLGFSYLQVNKSLAKEWFGKACDNGEQVGCEYYSKLNRGER............................................................................................... 219
7 -40.900IDP91582 hypothetical protein CBU_0295 [Coxiella burnetii RSA 493]  ali follow..  69..CVNYFNYITQLPDDIPAKSYLLGMAYFLKQNTGRAKFFLRKATKAGEPNATVELFEIYSEEREKDQAQIYLNQALEKNHPRAQWLAANHSLEKEELEN------AKTLFQKAAIQGMPLAKHNLFLYQ----------RQNLTPLFEAVQAGSVEALARLFAVCGNKYQI-----KEAKRCYEAVLFTNNPYAIYRFACFLEHEKYSKLLSEWTETAPLLLSLVFSSIAYMLYEKRIGQESNLDPIVYYGKAIEYCIKNYLISNYQSLSLENKSKLRRALEIANTLLSQPFHTAEAYLG-DEIKEKKLNALVNWLTARENREENLS..... 443
8 -39.100IDP92722 hypothetical protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0369c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  39..ESCKPYLKTDARATGLLAEANIQLDSSDLEDALWAVNFYQKNGAPKDPELVYLIGELYFFGVDQKKGIEYIIKSANLGYDIAQNQLGNLYVR-VGKVPGPNFAKAYKWYKLAIANGSLDARNAYLMNNER---------SFIENYPYCISIG----RALIGDTYLNGLAGLPKSPDFAIQWYQKAYELDHISVETGLARAYAKGDKKLAYKYAREAIQQPYAPAFVVIADLTDNKVAKYAYLAEAVELYKNPALKFFNEYCMPDISDNGLKQAQRNLAKIKLSKQELELATKEQQSLRN................................ 343
9 -35.400IDP90084 hypothetical protein CGSHiII_00674 [Haemophilus influenzae PittII] ZP_01795673 [Haemophilus influenzae PittII]  ali follow..  18  10..............................TALFGASVFSFQSTAWADTLEQQFQQGSEATTRGDYQTTFKFLLPLAEQGNALAQMMLGVMYAKGQGV---------------------------------------------------------------------------KQDDVEAVKWYRKAAEQGYADAQAMLGFSYLQVNKSLAKEWFGKACDNGDQNGCEYYGKLNRGE................................................................................................ 147
10 -29.500IDP06196 hypothetical protein HP0336 [Helicobacter pylori 26695] NP_207134 [Helicobacter pylori 26695]  ali follow..  12  8..............................KKDLKKAIQYYVKACELNEMFGCLSLVS---SQINKQKLFQYLSKACELNSGNGCRFLGDFYENGKY--------------------------------------VKKDLRKAAQYYSKACGLNDQDGCLILGYKQYAGKGVVKNEKQ-AVKTFEKACRLGSEDACGILNNY................................................................................................................................... 138
11 -15.800IDP92665 lipoprotein [Bordetella bronchiseptica RB50] NP_887361 [Bordetella bronchiseptica RB50]  ali follow..  1MTLRFHATLLGCAASDQAERDLQQIRQSYSAGAYGDVIRQVAHADALARIEAWKLQAFSYCVTDHRVLCEAGFRRILQADPAFTL........................................................................................................................................................................................................................................................ 108
12 -14.400IDP90409 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_667 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  15  15.....................FEAGMVAIKQGDEASAKALFQALQDPEHTAHELGSGLLHLHKMELTKAEVLFRAIVEKENWSAKAFLSLTLMM-IVLQQGSSFEVRRESLERCLQLADQVLESCEVESTRALAKSVLDWHDGL............................................................................................................................................................................................. 140
13 -13.900IDP93914 type III secretion apparatus protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007694 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  11  47.....................YAYAYEFYEQGKLKEAETFFRFLSIYDFYNTDYVLAAVYQLTKRYEKAVELYSLAFVLDDYRPLFHAGQCNLMLKKSSA------ALHCFESTFNGSDDLELKQKSSVYLTALKKNLTESEPAE............................................................................................................................................................................................ 168
14 -13.600IDP91307 putative YscY [Vibrio parahaemolyticus RIMD 2210633] VP1663 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  1...........MLSTKDIELLLVHAALQVQYQQPDQAIAILDAVLEPEREDALHTLAVACLQTGRYTRAVAVCEGLLKSQSQSVQFCLSQARWKQNDVEG------ARQAHRRYLQSLHSESHE................................................................................................................................................................................................................. 114
15 -13.200IDP04289 gene: yscY; hypothetical protein YPCD1.35c [Yersinia pestis CO92] YPCD1.35c [Yersinia pestis CO92]  ali follow..  1........MNITLTKRQQEFLLLNGWLQLQCGHAERACILLDALLNPEHLAGRRCRLVALLNNNQGERAEKEAQWLISHLQAGNWLCLSRAQQLNGDLDK------ARHAYQHYLELKDHNES.................................................................................................................................................................................................................. 113
16 -13.100IDP93896 secretion system chaperone SscA [Yersinia enterocolitica subsp. palearctica Y11] YP_006007024 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  18  34.....................YDYSVQLCQGGEYDGAKRLLNLLVDHWNFSYWLTLGLCYQQTADFHQAIYCFSRAGQIDDPRSSCSAGECYLACGNRIY------AEKAFRAALNWCHARPEWIHQQAERGLAALLLE.................................................................................................................................................................................................. 151
17 -12.700IDP93884 secretion system chaperone SscB [Yersinia enterocolitica subsp. palearctica Y11] YP_006007028 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  12  39.....................YEQGYQAWLADNYITAVEDFSWLTLHRPLEPHFHLAGALQMQQEFILALSAYASALLLKSPGPVYQMAVCLHAIKRDAD------AREALQMVIEMSYMRPEYAPIAEK........................................................................................................................................................................................................... 145
18 -12.500IDP91180 gene: lcrH_1; low calcium response protein H [Chlamydia trachomatis D/UW-3/CX] CT576 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  18  82.....................YTVAYTFYSQGKYQEAIGLFQILTKPQCYKYILGLSSCYHQLKMYDEAAFGFFLAFDAQNPIPPYYIADSLMKLNQPEE------SQDFLDITIDMCKNKPE.................................................................................................................................................................................................................. 181
19 -12.400IDP93894 lipoprotein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005558 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  13  1MKLTLLLAASVLAGCATAPKPIYHYEYYKSDASPEQQIAALKESIEKSRPGLHAHLGMLYGNTGHTDLAMTEFNTEKSA-FPESTPFMD.................................................................................................................................................................................................................................................... 107
20 -12.200IDP05313 putative lipoprotein [Bacillus anthracis str. Ames] BA_1061 [Bacillus anthracis str. Ames]  ali follow..  21  1MRKLLTVIGITFCSNGDFEKEIDAGKTALTNKEYKNALSSFERALDKDDSGAIVLVAVKLKEEKKIEESIQSFEKVENMKDGNATLI...................................................................................................................................................................................................................................................... 102
21 -12.000IDP91388 TPR repeat-containing protein [Vibrio vulnificus CMCP6] VV1_1438 [Vibrio vulnificus CMCP6]  ali follow..  181.........VELTQEQLAEKAIGRAEKALDANNLQNALSAYSDALTPNNEVVRQKLAALYFGKGDSRKAYELLQAGIALEGETLRIALSKMLIKANQ-------------NEAALTPLVALYDDSGKEYLAMRAALAQK----------------------------------IKKDDIALESYQRLMDSENARWWLGLAIQQERALDKSAQVSYQAALSKVGISNQ.......................................................................................................... 358
22 -12.000IDP91492 putative type III secretion protein [Vibrio parahaemolyticus RIMD 2210633] VP1693 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  10  24.EANTIADCLEETSNSEEVVVMIRAMSLMNKGAYEEAHRLLEPLCTA-YPDLISLAALAAAKAGLLSQAERWMELAAQGSEESQAFAAS.................................................................................................................................................................................................................................................... 110
23 -11.700IDP90425 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_547 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  11  1MKVILRALCLFLV------------LPCGCYARVPSFEPFRGAIAPN-SPELYFEMGDKYFQAKKFKQALLCFGMITHH--PKAQFLVGLCYLEMGH-------------PDLADKALTQYQE-------LADTEYSEQLFAIKYSIAQSFANGKRKNIVPLEGFPK-----LLKADTDALRIFEEIVTA--ASALYAKGLLFDRKEYSEAIKTLKKVSLQ--PESFTLIAKIHCLQALQEPYNEQYLQDARMNA------AALRKQHPNHPSNTEVENYIHHMCEAYASCLYSTGRFYEKKRKASSAKIYYSIALENFPDTSYVAKCNKRL. 310
24 -11.000IDP06057 hypothetical protein jhp0260 [Helicobacter pylori J99] NP_222981 [Helicobacter pylori J99]  ali follow..  13  114IDKAIELLHKIRKEEKTIATDNVLGTLYLTQKRLDKAFPLLNKFYNVHDEDSLEKLITIYFLQNRKKEGLDLLQSHIDRCSEQLCQKALNTFTQFNELDLYIGVLILLKEFDKAQQIAELFPFD---RLLLDLYTAQKKFDQASKQASLIYQERKDPKFLGLEAIYHYESLSANKKKLTKEEMLPDKEDAQDAFFYNFLGYSLYDMDVKRGMDLVRKALALNSVLYLDSLAWGYYKLGNCLEAKKIFSSIAKE................................................................................ 411
25 -11.000IDP01392 lipoprotein NlpI VC0648 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  60...........LEPEIRAKMLFERGNYYDSVGLRDLARLDFTQSLSPAQPDVFNLLGVYYTEAGEFDAAYESFDSTLELSNEYAVRNRAIALYYGER-------------PQLALEEITKQQDPQDPFRALWLYIIESDIDPTKARTELLERYQQHDEQWGWVLVGLLDQLSEEVAFKAIIAGSRENEAQRLTEAYFYLGKRYQMQGEAHALSLYKLAISFNHRYAFLELGRIYQQAREEQLARAKAEAMTQ................................................................................. 303
26 -10.400IDP04095 hypothetical protein [Yersinia pestis CO92] YPO1987 [Yersinia pestis CO92]  ali follow..  76........................ADWIAGTGNPDKAMVFLSQIGKPSSFSAYKNYVDAWIEKKQPESALKLLMLDNSARNYYLPAVLDAYRDTPDQAVTIYKDIYGDN-PTNQLRMLLAIAVNGAPKNTLIYTDKAQVMFIDVLKKKKNNEIHFYKDYLNLINLYS-----FAGNKQQALILSEQLLRTYYDLALSGIMAFYHANGTEEYNALIATSIATPKPIEEIKLIRLLNA................................................................................................. 305
27 -10.400IDP91435 DNA uptake lipoprotein [Vibrio vulnificus CMCP6] VV1_0485 [Vibrio vulnificus CMCP6]  ali follow..  10  1MKHHTLAGLLAVVPDVPPAELYAEAQTSLQGGNWLTAIEKLEALDSR--EQVQLDLIYAYYKNDDLALGLATISRFTRL--DWVLYMRGLTHMA-HDLFNIDRSDRDPEPVKQAFDDFKKLLER------------NSPYAEDSQKRMFALKNRLAEYDLATADYYL-----RREAWIAAINRSQELQKT-ARKSLKIQLEAYKQLGLQDAIARTEELIR................................................................................................................. 237
28 -9.920IDP00560 gene: hemY; putative protoheme IX biogenesis protein YPO3852 [Yersinia pestis CO92]  ali follow..  10  83................RARNQMKAALIKLAEGDFLQVEKLLTRNADHAEQPMVNYLAEAAQQRGDEFRTNQYLERAAEVAD-RVRIQLAQGH------------------IHAARHGVDRLLDQA--RLAEQAYLRSGAYRSLLDILPAMSKTQIHTPEEQQAYIGIMNQCMADEGSEGLKRWWKDQSRRNEIPLQVALAEHLIECDDDVAQKIILDSLKHQYDERLALL-IPRLKAGNPEPLEKSLRQQIKQHGATPLLNSTLGQLMLKHGEWEKASEAFKAALAQRPDGYDYAWLADA--DKLHRPEDAAQARREGLL............. 389
29 -9.800IDP90377 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_274 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  16  22......................ISGYSFLRQGHYQKAILFFEALVDPLSVYDFQTLGGLYLQISENTKALYVLDQALRMDHLPTLLNKTKALFC-------LGRIEEASAIASYLTSCPDPIIADDAEAL........................................................................................................................................................................................................... 126
30 -9.540IDP91182 gene: lcrH_2; type III secretion chaperone [Chlamydia trachomatis D/UW-3/CX] CT862 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  21  84.....................YKEGYNAYLQGDYEESSTAFYWLIFFNPFVSKFWLGASLHMLQKYQQALHAYGVAAREKDPYPHYYAYICYTLLNNPEE------AEKALDLAWQKVKTSSAYSSLKEE........................................................................................................................................................................................................... 190
31 -9.520IDP90308 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_700 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  13  149VDAACRIIEPWIGPLAHQEVFISVGHIYFATKRYADAIDFYRRARSSCPIDVLYNLAHSLRICGQYVDAGMLFRELLGDYKDEAMFNIGLCEQKLGNSKK------ALLIYQNSELW-DALMMRYAALAAADQQDYQLAEHCWTLAFRCQSYADDWNCCVHYGLALC-----HLKKYAEAEKVYLRVKTPDCLVACKALAWHATMISAREGIAYAKRALQIKSPEVLELLSACEAR................................................................................................. 387
32 -9.070IDP04565 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1805 [Clostridium perfringens ATCC 13124]  ali follow..  21  2IKKIVVAVGLAFSLSFLVGSLVEQGKAAIKQGNYEEATAIFKAASEEKDKEEAESLSNKAYNEFKLDVALDSLKKVEENKNKELMKE...................................................................................................................................................................................................................................................... 103

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.