current user: public

If you have questions about the server, please let us know.

Query: IDP95362 set237a-002 [Escherichia coli], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MTIKHAEELTEEVILNMNYPDFVALMQQDNTPPGAEYTIDYWIKHGCINKKSHLLDLACSTGFSSRECFKKEGASAEGIDISESAVMVANEKAKKLKANNLLKYYVADACDLPFEDNTFTHVLGGCNFAFIQNRLIALNETHRCLNHMGSMCISNFYYRRKISDKLINDVYNAINFRPNPLWTLEYWHQFFSERFTLVSEENHEMESQSEDELKADIYDYIFNRNEFTKGLNGSLQNVFFERFLKIRRPLNIQRDYQGVTLQIWRKKLast
1 -84.500IDP95362 set237a-002 [Escherichia coli]  ali  100  1MTIKHAEELTEEVILNMNYPDFVALMQQDNTPPGAEYTIDYWIKHGCINKKSHLLDLACSTGFSSRECFKKEGASAEGIDISESAVMVANEKAKKLKANNLLKYYVADACDLPFEDNTFTHVLGGCNFAFIQNRLIALNETHRCLNHMGSMCISNFYYRRKISDKLINDVYNAINFRPNPLWTLEYWHQFFSERFTLVSEENHEMESQSEDELKADIYDYIFNRNEFTKGLNGSLQNVFFERFLKIRRPLNIQRDYQGVTLQIWRKK 267
2 -74.300IDP95361 set237a-001 [Yersinia pseudotuberculosis PB1/+]  ali follow..  38  6.......ESTSIDFDTISYPDFLGVLGVDNTPPGGMFTLDYWIEKSRINSNTYLLDLACSTGFSARNIVHKTGCSAEGIDISARSIESANQLAVQGNIAECVHFSVGNAESVSFTDNTFTHITAGCCFGFISDKPAALVEVQRVLKQDGFLCISPFFYESEPDNELLSLVEQYIGYRPDIKRDYSYWFNFFNQHFTLLHEELFDLPVYSDDEIEKNV-NISICSKPVFNILSREKQQLAFDRYYNTRLLLNEHAKYQSVALWVMRVK 264
3 -49.800IDP02332 UbiE/COQ5 family methlytransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA1462 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  14  24.......................................GEMIKGITNIQNKQIIDIGCGGGIYTKELALMGAKSVVGLDFSKEILQAAKENCSGFS---NISFIHGDAHSTPYPNDTFDIVISRAVIHHLQDIPTFLREASRILKKNGVLIVQDRTIEDCTIPGSPEHIRGYFFSIFPKLKTTTIQKELQKYFLHVFPTQTQWEVRKIHDSVEALLQDLSPRTGSILYELTDYELSQLLQQVQTALQNVSPIIERDRWTIWSAMK. 257
4 -46.100IDP95440 set236a-042 [Undefined organism]  ali follow..  16  2..................FWDNVAGVYDIFANIINRKTHEGLRTKVEVSKEDVVLECACGTGLLSGVIAEKCK-NLVATDLSVKMLKKASKKHRAY---TNIEFREGNILQIEYPDGKFDVVVAANVIHLLDEPYKALAELDRVCRIGGKIIIPTYMNKNEKTSGFANTVGKAGADFKRQFTYDTYMEFIKEAGYENVKYSLVE............................................................... 187
5 -44.200IDP02273 hypothetical protein GBAA3714 [Bacillus anthracis str. `Ames Ancestor`] GBAA3714 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  79....................................NLDEIVIEHLQLQGRERILEVGCANGKFLSLLQAN-KGQLTGFDQSEAMLSEATKTNNL------IEWRLGDAGKLPFEANYYDLIVARHMLYHMKDVEKTIQGFHKVIHPGGSLLATTNSNVTEMCNRMLDTFDLPKTTSSVTPFCLENGKEILQSVFPTVEVSVIHNALIFHHATPIVNYISSMFPSLNIPDNTLLHAEMKDWLKEEVENELLLHNGIWTLAIYRCQK. 312
6 -37.600IDP92743 hypothetical protein lpp2747 [Legionella pneumophila str. Paris] YP_125052 [Legionella pneumophila str. Paris]  ali follow..  11  27....................................EISSKFLAKISIHSNDYLLDAGCGDGSFTQMLANLVDGYVLGLDRSKTMIDYANKHCR----SINVRFDIGDIQE-PIIYGPFDNILSFWCLHWT-DLEKSLSNLYHVLKPGGKICAIFSSGKQSTLFEVLNSLQFQNLYP-RENYSIQCRRALDNLPFKSISFVVEHCQVEPDLGLFENFIHGAPLFKDLPGKMYQDIVNSMVQFFDEYCKKKYGGKWVYETTPYTITRE 266
7 -36.200IDP02356 gene: ubiE; menaquinone biosynthesis methyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1296 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  21..QKKVAGVFHSVAAKYDLMNDLMSFGIHRI-------KKQTIAKSGVRKGDNVLDLAGGTGDLAYKFCQMVGGKVILSDINSSMLEVGKEKLTNKGCVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKDKALASMCRVLKPGGRSLVLEFSKPIKIITQDAESYKYLAESIRKHPDQQTLKQMMYDAGFDNVEYQNMT............................................................... 238
8 -35.900IDP02069 gene: ubiE; ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Coxiella burnetii RSA 493] CBU_2017 [Coxiella burnetii RSA 493]  ali follow..  17  21..TDKVKHVFESVAAKYDLMNDLMSLGIHRW-------KDFAITQCRLRTGQRILDLAGGTGDLAKRISPLVGGEVVIADINAAMLNVGRRRLLDQGIFRNIQFIQADAEKLPFPNNFFDRIVIGFGLRNVTNQLAALQSMHRVIKPGGFVVILEFSKPTKLVAKDEESYRYLVESIRMHPDQEALLSKMTDAGFEDCDYHNLS............................................................... 238
9 -35.900IDP90893 gene: ubiE; ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia pestis CO92] YPO3781 [Yersinia pestis CO92]  ali follow..  16  22..EGMVAEVFHSVAAKYDLMNDLMSFGVHRI-------KRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVGGEVILADINESMLRMGREKLRDKGIVGNVSYVQANAEALPFPDNFFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLELVAQDAESYRYLAESIRMHPDQETLKGMMADAGFENVTYSNLT............................................................... 239
10 -35.500IDP92740 hypothetical protein lpp2134 [Legionella pneumophila str. Paris] YP_124446 [Legionella pneumophila str. Paris]  ali follow..  13  17....................................KINDVFLKTIHSKLSGNILDIGCGDGHYTSLLAGKVHGQVLGIDSSEQMIMHANQQWARTG----LSFEVHNIEEFHQ-PQSFDLALSFWCLHWT-NIHISFPNIFHLLKREGKLYAV--TWKELAKQNLYRDLTEQYISPINEQYFYGVINLLNRLPFKRIKLDLKTCRVHPHIDYYKNLLLTMPFIKRVPSEITDTLVEDMLKAFQTICDRKYGGQLYYETRPIEAIK. 253
11 -35.100IDP91265 2-heptaprenyl-1,4-naphthoquinone methyltransferase [Bacillus anthracis str. Sterne] NT05BA1551 [Bacillus anthracis str. Sterne]  ali follow..  17  6..EERVHDVFEKISDKYDVMNSVISFQRHKA-------RKETMRIMDVKPGSKALDVCCGTADWTIALAGAVGGKVVGLDFSENMLSVGKQKVEALQLKQ-VELLHGNAMELPFEDNTFDYVTIGFGLRNVPDYMHVLKEMTRVVKPGGKVICLETSQPTKLFAKSYKEYSWLQESASTFPGMKELANMFEKAGLERVQVKPFT............................................................... 222
12 -33.700IDP06181 hypothetical protein jhp0993 [Helicobacter pylori J99] NP_223710 [Helicobacter pylori J99]  ali follow..  18  1MKDTLFNE---SLNKRFCFDEKVAHVFDDMLEPYYHEMLNLGAYFIASLPKPLIYDLGCSTGNFFIALNQQIDIELVGIDNSMPMLKKAQEKLKDFN---NVRFECMDFLEVKFKE--ASAFSLLFVLQFVRQREVLLKKIYNSLALNGVLLVGEKIMSEDYSHNEIAFKREALENVLVPYSLKENIALLESVGFKHVEA................................................................... 228
13 -33.400IDP06161 gene: ubiE; ubiquinone/menaquinone biosynthesis methyltransferase [Helicobacter pylori J99] NP_224094 [Helicobacter pylori J99]  ali follow..  18  9..QEKIINMFDDIASSYDQANRLMSFGLDVK----QRACEHAFLFLENKKALRLVDVACGTGDMLVAWQKSAFKECLGIDPSNNMLELAIKKCEELE--NKASFIQAQAKDLKVENNSVDILSIAYGLRNIVERQEALKEFFRVLKTRGVLVILEFLKKDGAISKNYGAYSYLPQSIEGFLSLEGLKNELKNAGFEILRTEDSI............................................................... 234
14 -32.200IDP02131 methyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1419c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  27....................................KTIDMLISLVG-KKDIKVADIGAGTGNLSIMLLER-GCKVVSVEPNDAMREIGIERTKDQK----IDWVRATGLNSTLQNSEFDWVTFGSSFNVM-DRNEALEEAHRLLKSEGYFSC--MWNHRDLNDPVQKIAEDTIVEFVPNYEDQRPIIESRKDLFDNIVYIEEDFYFHQSIE---NYINAWKSVKNPYWDLETDEGNELFNKISNKISQRLPKEFSIKYTCWSAKK. 252
15 -31.500IDP95402 set236a-004 [Undefined organism]  ali follow..  10  55...............................................IPSAQKIIDIGCGFNPFSYPWLATHQIEYAGFDIDVLLTEMMNNAWKQVGLP--VSVQYNDVFFGLPGHTENDVLFFLKFFPCLEQQEKISAKIFNAVKSNAFVVSFP................................................................................................................ 163
16 -30.600IDP95454 set236a-056 [Undefined organism]  ali follow..  17  98...............................................TGKPRRVLDLACGLN--PIYLAAR-GINVLGLDAHLGAVALVNRFAEENALD--ARAEGADLRTAELPEERFDLALVFKLLPLLGANGY---DLLGRVRAGFVAVSFP................................................................................................................ 197
17 -29.600IDP95435 set236a-037 [Undefined organism]  ali follow..  15  25...............................................LGPVRSVLDLACGLNPLALPWMPLADARYYACDIYADMIAFLNSFFAQAGIR--GQARVCDLVAGA-PDEQVDLALVLKALPPLDQQAKAGRDLLRALNARHILVSFP................................................................................................................ 131
18 -29.200IDP90709 gene: ubiG; 3-demethylubiquinone-9 3-methyltransferase [Yersinia pestis CO92] YPO1215 [Yersinia pestis CO92]  ali follow..  11  15......QEIAKFEAVASRWWDLEGEF--KPLHRINPLRLNYILQRSGGIFEKKVLDVGCGGGILAESMAR-EGAQVTGLDMGYEPLQVARLHALETGVK--LEYVQETVENHQQHPQHYDVVTCMEMLEHVPDPASVVRACAQLVKPGGHVFFSTILMAVVGAEYLLKMVPKGTHDAKKFIRPSELIGWVDQTPLLERHII.................................................................. 212
19 -28.900IDP95415 set236a-017 [Undefined organism]  ali follow..  13  25...............................................LGPVRSVLDLACGLNPLALPWMPLADARYYACDIYADMIAFLNSFFAQAGIR--GQARVCDLVASA-PDEQVDLALVLKALPPLDQQAKHAGRNLLRALNARHILVS................................................................................................................. 129
20 -28.700IDP95413 set236a-015 [Undefined organism]  ali follow..  15  111...............................................TGQPETILDHACGLNPLSFFWMDLPTTQYQAYDIDIEQIELLNKIAQTTGISNQLTATVADIVTDS--YGYADVVFLLKTLPCLEQQEKGISLDILRKQQCKYIVVS................................................................................................................. 216
21 -28.400IDP05651 gene: cfa; guanylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1183c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  115IGNDFYKLWLDD---TMSYSCAYFKEPNNTLYEAQINKIEHTLKKLDLKEGEKLLDIGCGWGWLSIMAAQKYGVKVVGITISEEQCKKAKERVKELGLEDKIEIRLQNYQDLE-FENYFDKVVSVGMFEHVGKEGLYFMKVKQVLKPGGSMLLHSILAMFEGKTNA---IDKYIFPGGYLPSLREVVSAMSEWDFHLLLAESLRMHYAKT--LDLWDENFNKVLDKVREKYDEEFIRMWDLYLRSCASAFRV--GSVDLFQFLITKE 373
22 -28.100IDP95457 set236a-001 [Undefined organism]  ali follow..  11  48...............................................LPPIHSVIDIACGLNPLAHPWMPLAAATYDAYDIYQGMMTFLNDYFALRNIR--GTASACDVIQSC-PTQEVDVALLLKVLPCLEQLEKAAHHLLHTLNARYLIVSYP................................................................................................................ 154
23 -28.000IDP95458 set236a-002 [Undefined organism]  ali follow..  14  96...............................................LPAPHSVLDLACGLNALTLPWFPHMAITYYACDIYRPMIDFLNATMEIMHIR--GCAEVRDILQSC-PTQEADLALVLKTIPCLEQIDKAGTRLLRAINARYMIVSFP................................................................................................................ 202
24 -28.000IDP95434 set236a-036 [Undefined organism]  ali follow..  12  116...............................................LGPVRSVLDLACGLNPLALAWMPLAAVRYYACDIYADMIAFLNGFFAQAGIR--GQARVCDLVAGA-PDEQVDLALVLKALPPLDQQAKHAGRDLLRALNAQHILVS................................................................................................................. 220
25 -28.000IDP01214 gene: cfa; cyclopropane-fatty-acyl-phospholipid synthase BA_3460 [Bacillus anthracis str. Ames]  ali follow..  14  118IGNDFYKLWLDETMT---YSCAYFQNEQDSLTTAQHNKVNHILKKLNLQKGDTLLDIGCGWGELITAAAKQYGVKAMGVTLSEEQYAKASERIKQEGLTDLVEVSLLDYRDIK--NQKFDKIVSVGMIEHVGKDTQYFETVNTLLNDGGISLLHCITSPANGGATN---IEKYIFPGGYVPAVNELITNMTNEQFFIVDVESLRRHYGKT--LQHWARNFENVMEEVRKTKDERFIRMWRLYLNACAASFFT--GNIDLHQFVFTKG 376
26 -27.900IDP95411 set236a-013 [Undefined organism]  ali follow..  13  25...............................................LPPITSILDLACGLNPLAIPWMPLPGVTYAACDIYQDQVDFLQQCFVVFGVE--GAAKPCDLLQAC-PTQAADVVLLLKTIPCLEQVDKIGRKLLDTLNAPILCV................................................................................................................... 128
27 -27.900IDP95425 set236a-027 [Undefined organism]  ali follow..  16  2...................................................RSVLDLACGLNPLALPWMPLADARYYACDIYADMIAFLNSFFAQSGIR--GQARVCDLVAGA-PDEQVDLALVLKALPPLEQQAKAGRDLLRALNARHILVSFP................................................................................................................ 104
28 -27.900IDP06435 gene: E1R; E1R [Monkeypox virus Zaire-96-I-16] NP_536525 [Monkeypox virus Zaire-96-I-16]  ali follow..  15  566...................................LGILSNYVKTLLISNKRKVLAIDFGNGADLEKYFYGEIALLVATDPDADAIARGNERYNKLNSGIKTKYYKFDYIQ-VFYFGKFNIIDWQFAIHYSRHYATVMNNLSELTASGGKVLITFIIHKNLPSSENYMSVEKIADMTEYIIKKNDIVRVFNEYGFVLVDNVDFATIIERSKKFINGASTMEDR---------PSTRNFFELNRGAIKCEGLDVEDLLSYVVYVFSKR 845
29 -27.700IDP95448 set236a-050 [Undefined organism]  ali follow..  17  53...............................................IGTPARILDLACGLNPVYLAHRLP-NAAIAGVDISGQCVNVIRAFGG-------AEARLGDLLC-EIPEDEADAALMFKVLPLLERTGAAMDALMRVNAEWIVASFP................................................................................................................. 152
30 -27.700IDP95459 set236a-003 [Undefined organism]  ali follow..  54...............................................PGEVHSILDVACGLNPLAIPWMPLLDTTYHALDIYADMIQFVGRCLALMQVKGTAALADPTSEAAQVLRRPVDVAFVLKTIPCLEQVDKIGSSLLDILGAKQLVVSFP................................................................................................................ 170
31 -27.400IDP95407 set236a-009 [Undefined organism]  ali follow..  11  81...............................................LPPVRSVVDVACGLNPLAIPWMGLAGTGYVAYDIYEDMMGFLGGVLGIFGVE--GRGETRDVVAEP-SVEEVDLALVLKAIPCLEQIDRAGRRLLDGLKAKNMVVSFP................................................................................................................ 187
32 -27.200IDP01412 cyclopropane-fatty-acyl-phospholipid synthase VC1122 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  169LGNELYQLFLDEE---MLYSSALFTQPELSLEQAQQAKMQRLCEQLQLKPTDHVLEIGTGWGAMAIYMAQHYGCKVTTTTISEEQYAYAQQKITALGLNNQITLLKQDYRLL---SGQYDKLVSIEMIEAVGKAPTFLSQCYALLKPRGKMAIQAITIADQ.......................................................................................................... 325
33 -27.100IDP95396 set236a-061 [Undefined organism]  ali follow..  17  112...............................................TGRPRCILDLACGLNPVYLSVRLPEDCRIVGVDIQGECVHILNEAIGSPE---RIIGIHADLLSRDIPSERFDVALMFKILPLLDRQKAGAAMDVMAAVNARYLVIS................................................................................................................. 216
34 -26.400IDP91053 ENC0002 [Enterobacter cloacae]  ali follow..  17  102...............................................IGTPARILDLACGLNPVYLAHRLP-NAAIAGVDISGQCVNVIRAFGG-------AEARLGDLLC-EIPEDEADAALMFKVLPLLERTGAAMEALMRVNAEWIVASF.................................................................................................................. 200
35 -26.300IDP92075 ubiquinone/menaquinone biosynthesis methyltransferae, putative [Toxoplasma gondii ME49] TGME49_095690 [Toxoplasma gondii ME49]  ali follow..  18  50MVASVFSSVAENDLMSMGLHRCWKDAFVDLVQFPALLPVASPSAGGADSRRFRILDLAGGTGDIAFRFVEKARTQLGGFDGKRTGAESERGYGADSGTPLLLQWVCGNGEQLPFGDESFDVVTIAFGIRNFTDVKKGLREAARVLRPGGRFLCLEF---SRVENPTLAALYDIFSFNALPLPQEEFAAMMADAGFHHVAFSNLT............................................................... 377
36 -26.100IDP95437 set236a-039 [Undefined organism]  ali follow..  14  130...............................................LGQVSSVLDLACGLNPLTLPWMPLADARYYACDIYADMIAFLNGFFTRAGLE--GQTEECALAA-GAPNVQVDLALVLKALPPLDQQAKAGRDLLRALNARHILV................................................................................................................... 233
37 -26.000IDP06499 hypothetical protein spr1856 [Streptococcus pneumoniae R6] NP_359448 [Streptococcus pneumoniae R6]  ali follow..  16  1....................................................................................MLEQARLKVEQQAIKN-IQFLEQDLPKNPL-EKEFDCLAVSRVLHHMPDLDAALSLFHQHLKEDGKLIIADFTKTEANHHG---------------FDLAELENKLIEHGFSSVHSQ.................................................................. 100
38 -25.700IDP91052 gene: rmtD; 16S rRNA methylase [Pseudomonas aeruginosa] PSA0001 [Pseudomonas aeruginosa]  ali follow..  16  102...............................................SGTPARILDLACGLNPVYLAHRLP-NAAITGVDISGQCVNVIRAFGG-------AEARLGDLLC-EIPEDEANAALLFKVLPLLERAGAAMDALMRVNAEWIVASF.................................................................................................................. 200
39 -25.700IDP95395 set236a-060 [Undefined organism]  ali follow..  14  73...............................................ALKGELICDAACGLNPLLL---GNAGYDVLGLDIQLTCVDVINAWARSEGWR--VSARGADLVGCE-ALPECGLTLMLKLLPVMDRAGESMRLLMAARSPRVLVSF.................................................................................................................. 174
40 -25.600IDP91051 gene: rmtC; 16S rRNA methylase [Proteus mirabilis] PRM0001 [Proteus mirabilis]  ali follow..  12  126...............................................TGVPTSITDAGCALNPFSFPFFTEAGGQYIGFDLDKGMIEAIEHSLRTLNAPEGIVVKQGDI--LSDPSGESDLLLMFKLYTLLDRQEEASGLKILQEWKYKNAVISFPIKTISGRDVGMEENYT-----------VKFENDLVGSDLRIMQKLKLGNEM............................................................ 274
41 -25.600IDP00962 gene: cfa; cyclopropane fatty acyl phospholipid synthase STM1427 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  122LGNDLFSRMLDPYMQSCAYWK-----DADTLEAAQQAKLKLICEKLQLQPGMRVLDIGCGWGGLSQYMATHYGVSVVGVTISAEQQKMAQTRCEGLD----VSILLEDYRDL---NDQFDRIVSVGMFEHVGPKNTYFEVVDRNLKPDGLFLLHTIGSKKTDHNV--DPWINKYIFPNGCLPSVRQIAEASESHFVMEDWHNFGADYDTT--LMAWHERFINAWPEIAGNYNERFKRMFSYYLNACAGAFRA--RDIQLWQVVFTRG 373
42 -25.600IDP00532 gene: cfa; cyclopropane fatty acyl phospholipid synthase YPO2390 [Yersinia pestis CO92]  ali follow..  12  122LGNDLFTQILDPNMQSCAYWK-----EATSLEQAQEHKLQMICEKLQLAPGMKLLDIGCGWGGLAAYAARHFGVSVSGVTISVEQQKLAQQRCE----GLDVSILLQDYRDL---NEQFDRIVSVGMFEHVGPKSTYFKVVNRNLKPDGLFLLHTIGANRTNMNV--DPWINKYIFPNGCLPSVQHIAQASEPYFVMEDWHNFGADYDRT--LMAWYERFQAAWPNLSANYSQRFERMFSYYLNACAGAFRA--RDIQLWQVLFSPN 373
43 -25.400IDP95399 set236a-064 [Undefined organism]  ali follow..  17  102...............................................IGTPARILDLACGLNPVYLAHRLP-NAAITGVDISGQCVNVIRAFGG-------AETRLGDLLC-EIPEDEADAALMFKVLPLLERTGAAMDALMRVNAEWIVASF.................................................................................................................. 200
44 -24.900IDP95419 set236a-021 [Undefined organism]  ali follow..  14  117................................................QPPRVIADLACGMNPLTVEWMPVGDVLYRASDIDSRLMAFLDEALTVLGVP--HEVAVHDLLTGP-DPKPADVTLLLKAVPCIETQQKLGWGLIDAINSPVVVV................................................................................................................... 219
45 -23.500IDP95398 set236a-063 [Undefined organism]  ali follow..  15  106...............................................CPPGGIICDAACGLDPLML---GAAGYAVRGLDIQMTCVDVINAWARRESWD--VKAEGADLLGRA-ELPKSDLTLFMKLLPVLDAQRAEGMRLLSLSSSPRVIVSFP................................................................................................................ 208
46 -23.500IDP95444 set236a-046 [Undefined organism]  ali follow..  15  106...............................................CPPGGIICDAACGLDPLML---GAAGYAVRGLDIQMTCVDVINAWARRESWD--VKAEGADLLGRA-ELPKSDLTLFMKLLPVLDAQRAEGMRLLSLSSSPRVIVSFP................................................................................................................ 208
47 -23.400IDP95455 set236a-057 [Undefined organism]  ali follow..  15  106...............................................CPPGGIICDAACGLDPLML---GAAGYAVRGLDIQMTCVDVINAWARREGWD--VKAEGADLLGRA-ELPKSDLTLFMKLLPVLDAQRAEGMRLLSLSSSPRVIVSFP................................................................................................................ 208
48 -22.600IDP02578 gene: yafS; putative SAM-dependent methyltransferase [Salmonella typhimurium LT2] STM0262 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  30......................................EQQLNPWFAKMYGFHLLKIGNLSAEINSEACAVSHQVNVSSQGSPMQV-------------------LADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLS---RKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYS.................................................................. 174
49 -21.100IDP91276 ribosomal protein L11 methyltransferase [Bacillus anthracis str. Sterne] NT05BA4392 [Bacillus anthracis str. Sterne]  ali follow..  14  153.............................AFGTGTHPTTTMCIRALEVQPGDTIIDVGTGSGVLSIAAAKLGASSVQAYDLDPVAVESAEMNVRLNKTDDVVSVGQNSLLEGI--EGPVDLIVANLLAEII---LLFPEDAARVVKSGGLFITSGIIAAK----------------------EKVISEALEKAGFTIEEVLRME............................................................... 302
50 -20.200IDP04650 hypothetical protein FTT_1302 [Francisella tularensis subsp. tularensis SCHU S4] FTT1302 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  43....................................EIAQRLLKRLEFLDPKDILVTGYSDSDYLERLQKR--------------------------------FPNADIHTSQNLKQHFDIIFSNSIIHITDNLSQELDDYYQLLNDNGILLFSTFGDKSFATLKEAVTSVSNYKHTNTMIDLLTWGNTLQASQYKAIESDLITFTYENINTLFEDIRYLNEPLADTNMQFGLTGKNMWLRFVEKFKQNLQLEIEAL.......... 235
51 -20.100IDP06062 gene: pcm; protein-L-isoaspartate O-methyltransferase [Helicobacter pylori J99] NP_223734 [Helicobacter pylori J99]  ali follow..  15  27MESIEREVFVPAPFKHFAYTLNALSMQAQQY--SSPLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFR-RVFSIERIESLYIEARLRLKTLGLDN-VHVKFADGNKGWERYAPYDRILFSACAKNIPQ------ALIDQLEEGGILVA.................................................................................................................. 170
52 -19.000IDP04372 gene: b4371; ribosomal RNA small subunit methyltransferase C [Yersinia pestis CO92] YPO0427 [Yersinia pestis CO92]  ali follow..  10  166...............GVTVKTLPGVFSRDSLDSG----SHLLLSTFNEPFKGSVLDVGCGAGVLASVLAQQSKIKWTLSDVSAAAIEASRATLAVNNIE--AQVIASNVYS----KGRFEMIISNPPFHDGIQTSMLIRGATAHLHVGGKLRIV................................................................................................................. 302
53 -18.400IDP95404 set236a-006 [Undefined organism]  ali follow..  12  150.....................................YPGLYDDLFGSKKPEVILDLCAGLNPCAYEYLGC-TPVYYAIDVSPQLMAFVQQFFDDHAIV--GKAWAEDITTMK-EFPDADTILIFKGMDVLERVKYGYGEQLLNVFLERRIIVS................................................................................................................. 262
54 -17.800IDP01630 gene: hemK; protein methyltransferase HemK [Coxiella burnetii RSA 493] CBU_1964 [Coxiella burnetii RSA 493]  ali follow..  12  94...............................RPETEMLVEWILKNLPKDEKLRIADLGTGSGAVALAIAVERHWTIDATDNSQAALKIAEINAKQHEIKN-CNFYHGEWCQ-ALPRRDYHAIVGNPPYIPDKDQKIIIHEAKSYLVNGGWLLL-----------------------EHGYDQAEKIMTLMQADGYREITDRR................................................................. 263
55 -17.700IDP06056 hypothetical protein jhp1397 [Helicobacter pylori J99] NP_224115 [Helicobacter pylori J99]  ali follow..  14  32...............................................IKNSGAILDIGSGCGVLGLLCARDNLASVHLVEKDSKMAFCSQKNALK---FPNAQVFESDFLDFN-PPILYDAIVCNPPFYALGDFASLVAKVKKCLKPKGYFIFC................................................................................................................. 151
56 -17.300IDP90290 arginine N-methyltransferase 1 [Toxoplasma gondii ME49] TGME49_019520 [Toxoplasma gondii ME49]  ali follow..  15  80...GIHEEMIKDSVRTGCY-------------------QRAICQNAHLFANKVVLDVGSGTGILSLFAAKAGAKHVYGIECSE-IVNIARKIVKENDMEDKVTFVQGKAEEVSLPVEKVDIIISEYFLLYESMLDTVLFCRDKWLKPGGMIF................................................................................................................... 211
57 -17.300IDP90289 arginine methyltransferase protein, putative [Toxoplasma gondii ME49] TGME49_094270 [Toxoplasma gondii ME49]  ali follow..  221...ANQMNMLQDTVRTTTY-------------------QRAIVENRADFEGKTVMDVGAGSGILSFFAAQAGAKKVYAVEASNMAATIALLCKGNPSLGSRIQIINKPLESIEDSEEKVDVLISETLLFNERMIETYLSARDRFLKPGGKMF................................................................................................................... 355
58 -16.900IDP91765 ThiF family protein [Yersinia pseudotuberculosis IP 32953] YPTB1885 [Yersinia pseudotuberculosis IP 32953]  ali follow..  19  375.....................................LDKSVARILTENKYNSVLDVGCGIGTYCRMLDGK-SSYIVGLDINSSMLSTARELGGS------IEYSNGEFMNYD-DNHSFDLVIFSLVLDHVENFVDYILKAKSLLHKGGSIVCITNYFHEGVQRKNRYDVNDEILCEVLSFTLPTYLNAFLTSGFTLHYIEE................................................................. 552
59 -16.700IDP00974 gene: hemK; N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase STM1775 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  95......................................TECLVEQA--VKTCRILDLGTGTGAIALALACERDCEVTAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFS-ALSGQQFDMIVSNPPYIDAQDPTHIIDNARQMLTPGGFLLL-----------------------EHGWQQGEAVRAVFRRSGYSDVET................................................................... 260
60 -16.600IDP00614 modification methylase, HemK family SACOL2109 [Staphylococcus aureus subsp. aureus COL]  ali follow..  12  96......................................TEEVMLHFQLEDDATIVDIGTGSGVLAITLKCEKDLNVIATDISLEAMNMARNNAEKHQSQ--IQFLTGDALKLINEGIKLNGLISNPPYIDEKDMESIIEDLPHVMEKGSPVVF.................................................................................................................. 238
61 -15.800IDP04360 putative protoporphyrinogen oxidase [Yersinia pestis CO92] YPO2018 [Yersinia pestis CO92]  ali follow..  11  95......................................TECLVEQA--AMPCRILDLGTGTGAIALALATERDCAVIAVDINADAVALARHNAEKLTI-DNVCFLQGSWFE----SGRFALIASNPPYIDANDPAAIVSQAPGYLDPGGWLML-----------------------EHGWQQANAVQELLKNSGFSAVMT................................................................... 259
62 -15.000IDP93850 cobalt-precorrin-6Y C(15)-methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001006911 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  14  18....................................AVRVLALERLSLSGAAHLIDVGAGTGSVALEAALRFDLRVTAIERNPVALELINENRQRLGCRK-VDIIAGVAPLPDKADAIF------------GHLTDLIDWSLMMLNPGGRLVLTFILLNN........................................................................................................... 136
63 -15.000IDP95451 set236a-053 [Undefined organism]  ali follow..  17  102...............................................IGTPARILDLACGLNPVYLAHRLP-NAAITGVDISGQCVNVIRAFGG-------AETRLGDLLC-EIPEDEADAALMFKVLPLLERTGAAMDALMRVNAEWIVASF.................................................................................................................. 200
64 -12.800IDP02445 gene: speE; spermidine synthase [Yersinia pestis CO92] YPO3411 [Yersinia pestis CO92]  ali follow..  13  42.................ELGRVMALDGVVQTTERDEFIYHEMMTHVPLGQAKKVLIIGGGDGAMLREVSRHKNIEITMVEIDAGVVEFCRQYLPNHS-DPRFKLVIDDGVNVNQTTEKFDVIISDCT------TSVFYEGCARSLNEGGIFVA.................................................................................................................. 190
65 -12.800IDP04455 putative RNA methyltransferase [Yersinia pestis CO92] YPO1336 [Yersinia pestis CO92]  ali follow..  15  180LEGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLRQWVQEHEVHSMWDLFCGVGGFGLHCAGPET-QLTGIEINAEAIACARQSAEQLGLKN-VSFAALDSTRATAEAQIPELVLVN------PPRRGIGRELCDYLS---QMAPKFILYSSCNAETMAKDISLLAGYHIERVQLFD.................................................................................. 358
66 -12.600IDP00638 gene: gidB; glucose-inhibited division protein B SACOL2736 [Staphylococcus aureus subsp. aureus COL]  ali follow..  39...................MNLTSITDEHDVYLKHFYDSIAPSFYFDFNQPISICDVGAGAGFPSIPLK---QLKVTIVDSLNKRIQFLNHLASELQLQD-VSFIHDRAETFGKGVESYDVVTARA----VARLSVLSELCLPLVKKGGQFVALK................................................................................................................ 172
67 -12.500IDP95408 set236a-010 [Undefined organism]  ali follow..  17  130...............................................LGPVRSVLDLACGLNPLALPWMPLADARYYACDVYADMIA.................................................................................................................................................................................... 170
68 -12.500IDP91784 gene: ermA; rRNA methylase Erm(A) [Staphylococcus aureus subsp. aureus N315] SA1480 [Staphylococcus aureus subsp. aureus N315]  ali follow..  15  17....................................KHVKEILNHTNISKQDNVIEIGSGKGHFTKELVKM-SRSVTAIEIDGGLCQVTKEAVNPS---ENIKVIQTDILKFSFPKGNIPYNISTDIVKRITFESQA-KGFARLQNLQRALGLL................................................................................................................. 145
69 -12.500IDP91589 gene: ermA; rRNA methylase [Staphylococcus aureus subsp. aureus N315] BAB41266 [Staphylococcus aureus subsp. aureus N315]  ali follow..  15  17....................................KHVKEILNHTNISKQDNVIEIGSGKGHFTKELVKM-SRSVTAIEIDGGLCQVTKEAVNPS---ENIKVIQTDILKFSFPKGNIPYNISTDIVKRITFESQA-KGFARLQNLQRALGLL................................................................................................................. 145
70 -12.000IDP02408 23S rRNA m(2)G2445 methyltransferase [Yersinia pestis CO92] YPO1418 [Yersinia pestis CO92]  ali follow..  14  491..................YEKLAQKGEFLLVSEYNAKLWVNLTDYLDTSQGKDFLNLFAYTGTASVHAGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTGQ-RLIQADCLSLSNTDEQFDVIFMETTFDVQRDHLVLMKELKRLLRRKGTIMFSNNKRGFQMDLAGIAALGLEAKEITALTQSEDFAR............................................................................... 689
71 -11.900IDP01700 methyltransferase, putative [Coxiella burnetii RSA 493] CBU_1899 [Coxiella burnetii RSA 493]  ali follow..  14  17......................IDFPDLPDLRPTTDRIRETLFNWLAPYVDANCLDLFAGSGALGFEALSRGAAQVTFVDHSRYVVDKLRKNVEILQATN-AQVLCGDFTSVFLTTTSYNIVFLDPPFYKLVERAALHLEESKLLAPNAFIYV.................................................................................................................. 150
72 -11.800IDP00274 gene: N/A; NS5 methyl transferase and RNA polymerase AF180817_2494-3392 [Dengue virus 1]  ali follow..  10  20LSKSEFNTYKRSGIMEVDRSEAKEGLKRGETTSRGTAKLRWFVERNLVKPEGKVIDLGCGRGGWSYYCAGLKKVEVKGYTKGGNLVKLHSGKDVFFIPPEKCDTLLCDIGESS-PNPTIEEGRTLRVLKMVEPWLRGNQFCIKILNPGGMLVTHEMYWVSCGTGNIVSAVNMTSRMLLNRFTMA................................................................................... 245
73 -11.500IDP00077 gene: yhiQ; putative SAM-dependent methyltransferase NTL01ST3489 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  75......................................GEAVAKAVGIKYLPDVVDATAGLGRDAFVLAS-VGCRVRMLERNPVVAALLDDGLTRGYADERLQLIHASSLTLTDITPRPQVVYLDPMFPHRQKSALVKKEMRVF........................................................................................................................... 190
74 -11.500IDP05733 putative RNA methyltransferase [Clostridium difficile 630] CD1208 [Peptoclostridium difficile 630]  ali follow..  11  60..............................VSRGGLKLEKAMKNFDLTIDGKVCMDIGASTGGFTDCMLKNGAIKVFSIDVGYGQLAWKLRQDDRVVCMERTNIRNVTIEDTK---QFADFASIDVSFISL---KLVLPKAKELVRHDGEVVAL................................................................................................................. 177
75 -11.400IDP00061 hemolysin A BA_4399 [Bacillus anthracis str. Ames]  ali follow..  10  63..............................VSRGGYKLEKALETFHLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLE--RGLPQFASIDVSFISL---KLILPVLKTMLMPNGDVAAL................................................................................................................. 181

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.