current user: public

If you have questions about the server, please let us know.

Query: IDP95381 set238a-018 [Vibrio cholerae], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370
# Score Template Links and tools%idFirst MESDIIMFWKKKSHDIDLKELVPKAGDTRKFLTGEAVFFSPKPLPSAKIAQETIVQSPDILEINDTYLDIGQRNQGKAWQVQMVNTIIGFGVIVILLISILLAYRDLDAYGSFLTAFIQISIEDWMPMTIGFALGIVAGWSSIIQTSFEFARQRPIRLNRQRREVCYYSDKEKKPIIAPWEEVVCWVALNRGTTGNSMVTHFTFGLAIPTSDGKDYWILRRPIASVTDGQRMWETMRMYMDEPLTRRPEPSPFIKEDRAYFDKSRREMCDRFQKGPKCWFILNSNAPWVSYTSMFFYYLFHILSGWKLPYWVSEWTDNLAKVDLPKEIEEWSKPIPESEWAKPSEELLRQRAAIEKHYEAGGGIMDFNPATQLast
1 -154.000IDP95381 set238a-018 [Vibrio cholerae]  ali  100  1MESDIIMFWKKKSHDIDLKELVPKAGDTRKFLTGEAVFFSPKPLPSAKIAQETIVQSPDILEINDTYLDIGQRNQGKAWQVQMVNTIIGFGVIVILLISILLAYRDLDAYGSFLTAFIQISIEDWMPMTIGFALGIVAGWSSIIQTSFEFARQRPIRLNRQRREVCYYSDKEKKPIIAPWEEVVCWVALNRGTTGNSMVTHFTFGLAIPTSDGKDYWILRRPIASVTDGQRMWETMRMYMDEPLTRRPEPSPFIKEDRAYFDKSRREMCDRFQKGPKCWFILNSNAPWVSYTSMFFYYLFHILSGWKLPYWVSEWTDNLAKVDLPKEIEEWSKPIPESEWAKPSEELLRQRAAIEKHYEAGGGIMDFNPATQ 372
2 -4.860IDP05430 hypothetical protein lmo1265 [Listeria monocytogenes EGD-e] lmo1265 [Listeria monocytogenes EGD-e]  ali follow..  14  70.DAPIIIKATKKSEKTTVTKNSIEKDTTGKLSENMTIKVLEYSVENVLVEGEEYDDGYKNMEKGEEYT................................................................................................................................................................................................................................................................................................................ 158
3 -4.610IDP06433 gene: E3R; E3R [Monkeypox virus Zaire-96-I-16] NP_536527 [Monkeypox virus Zaire-96-I-16]  ali follow..  10  1M--DIFIVKDNKYPKVDNDDNEVFLGNHNDFKLKEHVFFSEYIVTPDTYGSLCVELNGSSFQHGGRYIEVEE-DAGRQVRWCSTSNHISEDIHTDKFVIYDIYTFDSFKNKRLVFVQVPPSLGDDSYLT---------LLSPYYRNSVARQMVNDMIFNQDSFLKYLLEH----------------------IRSHYRVSKHITIVRYKDTEELNLTRICYNRDKFKAFVFAWEKVLDTYKKVSDLI............................................................................................................................. 233
4 -4.460IDP93945 gene: tcaC`(1); putative insecticidal toxin complex protein [Yersinia enterocolitica W22703] CAI77375 [Yersinia enterocolitica W22703]  ali follow..  16  1......MENNKQQVNVAPLSLPKGGGAIAIGPSGLASLTVPLPISAGRGYAPALALSYSSGGGNSPF................................................................................................................................................................................................................................................................................................................. 69
5 -4.310IDP05237 putative cellsurface protein [Listeria monocytogenes EGD-e] lmo1653 [Listeria monocytogenes EGD-e]  ali follow..  55.DADYVFVGKVTQETGTDYKNETPIEQEDDSIKYIGEAYTNYKVEVISNLKNELAMDKEIPEVGNIYI................................................................................................................................................................................................................................................................................................................ 144
6 -4.210IDP02709 gene: tsf; elongation factor Ts [Bacillus anthracis str. `Ames Ancestor`] GBAA3964 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  30.NGDMFLREKGIAKAAKKADRIAAEGLTFIETNGNDGLILELNSETD------------FVAKNEGFQTLIKE........................................................................................................................................................................................................................................................................................................... 94
7 -4.160IDP05317 hypothetical protein lmo0638 [Listeria monocytogenes EGD-e] lmo0638 [Listeria monocytogenes EGD-e]  ali follow..  13  64...........................................................................................................................................................ITFDSPLKQYKVNPSIGSEMTTEKIEAVNKQVAENNLLTLATNDSSTNVIAVTPEGKETVVKRGLLKGAGVNKVTYHWNYARIRLSKN................................................................................................................................. 152
8 -3.890IDP91623 gene: ECs2229; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB35652 [Escherichia coli O157:H7 str. Sakai]  ali follow..  17  105.EEGVFVKNSEGSLVCTLFDSVSFSHLVRD---------GKHPL------TREPITSSMIVSQEQCIYDQTKGNFVIK...................................................................................................................................................................................................................................................................................................... 167
9 -3.880IDP02386 Signal peptidase I [Bacillus anthracis str. `Ames Ancestor`] GBAA3086 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  10  60.HGEIVIIKEEDESKYYVKRVIGLPGDVINITNGS-VYVNDKKQEEPYTNKDLFNNTQVFYNFQNKLFVMGDNRELSR...................................................................................................................................................................................................................................................................................................... 141
10 -3.850IDP90407 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_656 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  1MDTQFIASQSVRNQEVTSVSGMTFEGPVRSLDQLRQALIAKMGEQKGQEMYDRFIQSLLISTFTTVHKEMDRAQRASKKM.................................................................................................................................................................................................................................................................................................... 91

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.