current user: public

If you have questions about the server, please let us know.

Query: IDP95391 set238a-028 [Vibrio cholerae], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MLKYLFFIGFIFSSSANANANANASDECDYTLPLGSIVACYENKNEESDAVLNKSYNDLKKLVMGSPYDDETKGVYWSNIVKSQKNWIQMRDSQCLAKGVFFENGTDLQRIEIKKCLFLSTEIRVLYLNEEILFIKNLPLast
1 -75.400IDP95391 set238a-028 [Vibrio cholerae]  ali  100  1MLKYLFFIGFIFSSSANANANANASDECDYTLPLGSIVACYENKNEESDAVLNKSYNDLKKLVMGSPYDDETKGVYWSNIVKSQKNWIQMRDSQCLAKGVFFENGTDLQRIEIKKCLFLSTEIRVLYLNEEILFIKNLP 139
2 -70.800IDP95389 set238a-026 [Vibrio cholerae]  ali follow..  97  1MLKYLFFIGFIFS----SSASASASDECDYTLPLGSIVACYENKNEESDAVLNKSYNDLKKLVMGSPYDDETKGVYWSNIVKSQKNWIQMRDSQCLAKGVFFENGTDLQRIEIKKCLFLSTEIRVLYLNEEILFIKNLP 135
3 -48.800IDP95343 hypothetical protein VCA0124 [Vibrio cholerae O1 biovar El Tor str. N16961] NP_232525 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  1MNNLLSAYVTMLLILLSISGGAIASENCDTSGVHQKILVCIQNEIAKSETQIRNNISSKSI-----------DYGFPDDFYSKQRLAIHEK---CMLYINV---GGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS. 122
4 -48.800IDP95387 set238a-024 [Vibrio cholerae]  ali follow..  15  1MNNLLSAYVTMLLILLSISGGAIASENCDTSGVHQKILVCIQNEIAKSETQIRNNISSKSI-----------DYGFPDDFYSKQRLAIHEK---CMLYINV---GGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS. 122
5 -8.940IDP04565 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1805 [Clostridium perfringens ATCC 13124]  ali follow..  13  1MIKKIVVAVGLAFSLSF-------------------LVGCGNKSVEQGKAAIKQNYEEATAIFKAASEEDSKDKEEAESLYDLTYNYVISNKA.............................................. 76
6 -7.790IDP05313 putative lipoprotein [Bacillus anthracis str. Ames] BA_1061 [Bacillus anthracis str. Ames]  ali follow..  15  1MRKLLTVIGITFLI----------------------LAGCSNGDFEKEIDA-NKEYKNALSSFERALDEKKDDSGAIVLVEQTKI----MMEAVKLKEEKKIEESQSFEKVENMKDGNATLIKQAKKERTALLAILEQ. 118
7 -7.620IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  22  1MLKKLGILVLGSAVAL-------------------SLVACGDSTKEASNEKKEEPKQEAKKENKENKESKKK................................................................... 53
8 -7.400IDP95390 set238a-027 [Vibrio cholerae]  ali follow..  1.MTYYKFIALLSFLYCGSSFGNELYFSCDTKKGTVFL--EESQG--------VVSYTKNEIVFESKGDGFLGFKYNHYSRFQTDYFNVSFINLEYKYTIFSNYESNQEKKESSYECETV-HIDRLSDLSTKLACDTDSA 143
9 -7.270IDP05485 putative lipoprotein [Bacillus anthracis str. Ames] BA_3234 [Bacillus anthracis str. Ames]  ali follow..  11  3MKGRNVSVVFIAIVIFI-------------------IAGCSNMIGNEDQTIKVQKHVDDTYEDLKVVTDNKQVQQVKKILNDAHFE-FQFKNPKIEAKATLYPNKDKIEIIAGNSQYVQLEGKNAATLFQIITGEK... 138
10 -7.220IDP05592 putative lipoprotein [Bacillus anthracis str. Ames] BA_3194 [Bacillus anthracis str. Ames]  ali follow..  12  1MKILKFGIIGALSITLLIGCTSNSNETKASNKEASTAVKEKEIVYENVMFEQKEVRKLEISPVNSKSSNQVVNTENIKTIFTSMES-VTYQDNSIQEFFVWIESDSDIVIAKASD---DLREDNSKKIIQFFE...... 157

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.