current user: public

If you have questions about the server, please let us know.

Query: IDP95410 set236a-012 [Undefined organism], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MLIYRRLTEADAEAMRQMNQMFGAAFKDTKTYRYDQGDDAYFQRILGKDHVIVLACFHAGQVVGGLVAYVLDKLEMARSEIYIYDLAVDESHRRQGIATELINELKAIAAKTGAWVIFVQADREDEPAIQLYEKLGVREEPLHFDINLEEGNLast
1 -75.200IDP95410 set236a-012 [Undefined organism]  ali  100  1MLIYRRLTEADAEAMRQMNQMFGAAFKDTKTYRYDQGDDAYFQRILGKDHVIVLACFHAGQVVGGLVAYVLDKLEMARSEIYIYDLAVDESHRRQGIATELINELKAIAAKTGAWVIFVQADREDEPAIQLYEKLGVREEPLHFDINLEEGN 152
2 -69.200IDP95033 ; aminoglycoside acetyltransferase [Pseudomonas aeruginosa] CAD53575 [Pseudomonas aeruginosa]  ali follow..  50  6.TKITRLNSQDVGVMRAMLGMFGEAFEDAENYCRAQPSDSYLQDLLCGSGFIAIAALQGQEVIGGLAAYVLPKFEQQRKEIYIYDLGVQGAYRRRGIATALINELQRIAHDIGAYVIFVQADYGDDPAVALYTKLGIREDVMHFDIEPQPA. 155
3 -67.500IDP92718 gene: aacC1; aminoglycoside-(3)-N-acetyltransferase [Serratia marcescens] AAB20441 [Serratia marcescens]  ali follow..  50  26IIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPST.. 175
4 -67.300IDP95405 set236a-007 [Undefined organism]  ali follow..  52  3.YRIQQVTPADLDLMNELLSVFGQAFDDEETYNGKRPGAGYMRRLLESDNFIALAALNDQKVVGGLAAYELKKFERERSEIYIYDLAVAKNHRRKGIATALIMELKKIAAARGAYVIFVDTGAEDEPAIELYTKLGIREDVLHFDIPVENGD 155
5 -66.800IDP95032 ; aminoglycoside acetyltransferase [Salmonella enterica subsp. enterica serovar Newport] AAR21614 [Salmonella enterica subsp. enterica serovar Newport]  ali follow..  47  3.VEIIHLTGNDVALLQSINAMFGEAFNDQDSYARNKPSSSYLQKLLSTSSFIALAAVDEQKVIGAIAAYELQKFEQQRSEIYIYDLAVAATRRREGIATALIKKLKAIGAARGAYVIYVQADVEDQPAIELYKKLGTIEDVFHFDIAVEQSK 155
6 -65.700IDP95031 ; aminoglycoside 3`-N-acetyltransferase [Pseudomonas aeruginosa] AAA88422 [Pseudomonas aeruginosa]  ali follow..  48  26.IATVKIGPDEISAMRAVLDLFGKEFEDIPTYSDRQPTNEYLANLLHSETFIALAAFDRGTAIGGLAAYVLPKFEQARSEIYIYDLAVASSHRRLGVATALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVREDVMHFDIDPRT.. 174
7 -64.900IDP95403 set236a-005 [Undefined organism]  ali follow..  52  3.LDVHQLSPNEVALMETLLATFGEAFNDMETYTGNRPRGAYSRRLLESDYFIALAALEYGEIVGGLAAYELKKFEQERSEIYIYDLAVAKAHRRRGIATALIEKLKELGAARGAYVIFVQTAIEDEPAIALYSKLGVREEVLHFDIPVSQNN 155
8 -62.600IDP95418 set236a-020 [Undefined organism]  ali follow..  30  10FLKIERLAENDLPKFIQLIRLFEAVFEMKNFSI---PDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYT... 155
9 -56.400IDP95442 set236a-044 [Undefined organism]  ali follow..  20  1.VEYKLLEKEDLELMKEIIEDDDIEF-----------DLEKINEFYNDKNVIGFIAKAENKIVGFAYGYDIIHP-NGKHAYFIYSIGMLPDYQDKGYGTKLLGFIKDYISSNGFFEMFVLTDKGNPRACHVYEKLGGKNDFEDEICYVYDFE 139
10 -55.000IDP92640 gene: phnO; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4093 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  4.CELRPATQYDTDAVYALICELKQAEFDHHAF------RVGFNANLRDPNMRYHLALLDGEVVGMIGLHLQFHLHHVNWIGEIQELVVMPQARGLNVGSKLLAWAEEEARQAGAEMTELSTNVKRHDAHRFYLREGYEQSHFRFTKAL.... 144
11 -54.900IDP91868 gene: aac(6`)-Ig; aminoglycoside 6`-N-acetyltransferase [Acinetobacter haemolyticus] AAA21889 [Acinetobacter haemolyticus]  ali follow..  14  1.MNIKPASEASLKDWLELRNKLWS--------DSEASHLQEMHQLLAEKYALQLLAYSDHQAIAMLEASIRFEYVNTSPVGFLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMHRSLGFQETEKVVYFSKK... 143
12 -54.400IDP95034 aminoglycoside acetyltransferase [Corynebacterium striatum]  ali follow..  20  5.NEIRVAEVADAGVVAKLLRDFNTEFDTP----VPEGLEERFAQIIAHDDAFVLLA----GDIGFAYVTLRPSPYYDGPVAMLDELYVAPAHRNRGVGTALLQRVFEEIRKHSAGELQINVDEVDTDARRFYERHGLTNIEQGSRMLLYIRE 147
13 -54.200IDP91869 gene: aac(6`)-Ih; aac(6`)-Ih [Acinetobacter baumannii] AAC41391 [Acinetobacter baumannii]  ali follow..  15  1.MNIMPISESQLSDWLALRCLLWPDHEDVH-------LQEMRQLITQAHRLQLLAYTDTQQAIAMLEASIRYEYVQTSPVAFLEGIFVLPEYRRSGIATGLVQQVEIWAKQFACTEFASDAALDNQISHAMHQALGFHETERVVYFKKN... 144
14 -53.700IDP95439 set236a-041 [Undefined organism]  ali follow..  15  5.FVVREATQADALALAELAIKLWSSHTISEL-------QSEFLDLICSDNAVCFIKYVGSKAVGFAQCQLRNDYVDTSPVGYLEGIFVEEEYRHNGYAKELLSKCEKWAKEKHCTEFASDCEINNEISLQFHLSMGFEEANRIICFRKD... 148
15 -52.100IDP00047 streptothricin acetyltransferase, putative BA_3185 [Bacillus anthracis str. Ames]  ali follow..  19  3.LLIRELETNDLDNFPEIDDSFEDVPSYEKSYLQNDNEELVYNEYINKPNQIIYIALLHNQIIGFIVLKKNWN-----NYAYIEDITVDKKYRTLGVGKRLIAQAKQWAKEGNMPGIMLETQNNNVAACKFYEKCGFVIGGFDFLVYKGLNM 169
16 -50.900IDP95445 set236a-047 [Undefined organism]  ali follow..  15  17.....................................DIDNLKGFLNDTSSFGFIAKENNKIIGFAYCYTLLRP-DGKTMFYLHSIGMLPNYQDKGYGSKLLSFIKEYSKEIGCSEMFLITDKGNPRACHVYEKLGGKNDYKDEIVYVYDYE 130
17 -50.400IDP92031 N-terminal acetyltransferase complex subunit ARD1, putative [Toxoplasma gondii ME49] TGME49_019760 [Toxoplasma gondii ME49]  ali follow..  18  1MATLRRADVFDLFAMQNA---------NFINLPENYIMKYYFFHAVSWPQLLSVSHDSQGKLVGYVLAKLEED-DPTDHHGHVTSVAVLRQSRKLGLASKLMNMTQHMEEVFDADYASLHVRVTNRAAYSLYKHLGYRIHDIDKEYYADKED 144
18 -50.400IDP95438 set236a-040 [Undefined organism]  ali follow..  11  1..MLKIAEKEDVPVAAELAGMLWPHHSREELEGE---------LSFIESGGMVFLWMEEGNPVAFAQCGIYVEGTHGGAIGYLEGIFVLEKFRRRGIGKVLLTACEEWAKEQGCEEFASDTELDNAEGLSFHSGAGFYEANRIVCFVKN... 142
19 -49.200IDP92645 gene: ypeA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2434 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  20  1.MEIRVFRQEDFEEVITLWERCDLLRPWND-------PEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGY------DGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADV.......... 128
20 -49.100IDP02174 putative acetyltransferase [Yersinia pestis CO92] YPO3031 [Yersinia pestis CO92]  ali follow..  18  1.MEIRIFQQDDFEEVILLWEHCDLLRPWNDP-------EMDIERKLNHDPELFLVAEVNGTIVGSVMGGY------DGHRGSAYYLGVHPDYRGRGFANALISRLEKKLIARGCPKLNIMVREDNDAVIGMYEKLDYETQDLGKRLIVDQ.. 139
21 -48.900IDP05730 putative acetyltransferase [Clostridium difficile 630] CD0675 [Peptoclostridium difficile 630]  ali follow..  10  5.IKFIKAEEKYIYSYWQTFDKIRKYLAMDEAFPFEETVEFIKNIINKNLPQLFIIDLESDNCIGWCDVL------PKTEKVGYLGMGILKEYREKGIGSSLLKQIIDLSKEYGYEKIELDVFKSNSRAIHVYKSLGFVEVNTISSGFTWNDR 152
22 -47.500IDP00087 gene: STM2449; putative acetyltransferase NTL01ST2379 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  38.MEIRVFRQEDFEEVITLWERCDLLRPWND-------PEMDIERKVNHDVSLFLVAEVSGEVVGTVMGGY------DGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQIMVRDDNDVVLGMYERLGYEHSDLGKRLIEDEE. 177
23 -47.300IDP92642 gene: rimI; ribosomal-protein-S18-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4373 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  19  1MNTISSLETTDLPAAYHI---------EQRAHAFPWSEKTFASNQ--GERYLNFQLTQNGKMAAFAITQVVL------DEATLFNIAVDPDYQRQGLGRALLEHLIDELEKRGVATLWLEVRASNAAAIALYESLGFNEATIRRNYY..... 130
24 -44.700IDP95409 set236a-011 [Undefined organism]  ali follow..  18  8.LHSSRQYNTPLEIVESRNKNLLVPI-----LHDADEDDVRIASAIVDMANISYAAYIGDECVGAAMMHWQ------LDESEILYIAIRAADRGKGYGRELIAAIVNMARERSTQALVVGTASTSVDNILFYQKCGFRMDSVRKDFFNYKPT 147
25 -44.200IDP92643 gene: rffC; TDP-fucosamine acetyltransferase [Escherichia coli K12] b3790 [Escherichia coli K-12]  ali follow..  15  40.SGAVVAQETDIPALRQLASAAFAQSRFRAPWYAPDASSRFYAQWIENDHQCLILRAASGDIRGYVSLRELNA-----------TDARIGLLAGRGAGAELMQTALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLY..... 180
26 -42.700IDP00230 putative acetyltransferase YPO3444 [Yersinia pestis CO92]  ali follow..  19  9.LLVRPITAGDNLAIANVIREVSAEFGLTADKGYTVSDPNLLYELYSQPRSAYWVIEVDGHIAGGGGVAPLLG--GEADLCELQKMYFLPILRGKGLAKQLALQALAFARQQGFGRCYLETTASLTSAVGLYERLGFEH............. 146
27 -41.900IDP92644 gene: yjgM; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4256 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  21  9.PVMRRLTLQDNPAIARVIRQVSAEYGLTADKGYTVADPNLLYQVYSQPGHAYWVVEYEGEVVGGGGIAPLTG--SESDICELQKMYFLPAIRGKGLAKKLALMAMEQAREMGFKRCYLETTAFLKEAIALYEHLGFEH............. 146
28 -41.500IDP91382 histone acetyltransferase HPA2 [Vibrio vulnificus CMCP6] VV1_1470 [Vibrio vulnificus CMCP6]  ali follow..  21  7.FVLRPITVEDNASIANVIRQVSAEYGLTADKGYSVADPTLLFSIYSQANAAYWVVEHQGKIVGGGGFSALAG---VEGVCELQKMYFLPICRGQGLAKKIVSLSRSAAKKMGYQRCYLETTACLKEAIALYEKLGFEH............. 143
29 -41.200IDP91766 gene: yhhY; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3441 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  20  4.IVIRHAETRDYEAIRQIHAQPEV--YCNTLQVPHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRPRRSHVADF--GICVDSRWKNRGVASALMREMIEMCDNWRVDRIELTVFVDNAPAIKVYKKYGFEIEGTGKKYALRNGE 151
30 -40.100IDP02595 acetyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1384c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  1.MKIREATAKDFDDVVYISEHLLNNCQFFTTNEINNQGKLVVEKYLNNPAFKSFVLTVEDQVIGFSCI----------KDNEILFSTVEQRFLGKGFRSFMLKYLLE-----NYAVDTTYVYSANIQTLAFYTSIGFIIED........... 126
31 -40.000IDP95422 set236a-024 [Undefined organism]  ali follow..  21  54.IEIVNFSSELRTHFERLNRGWIERQFEMEPLDYLLLQN---TEIIEKGGAVLFAVASRGEVVGTAALKNE-----GEGVYELSKMAVDEESRGLGIGKALGLAALDRVRKMGAVKVILYTNSALEPAINLYRKLGFID............. 185
32 -39.200IDP95253 acetyltransferase [Acinetobacter baumannii ATCC 17978] YP_001084790 [Acinetobacter baumannii ATCC 17978]  ali follow..  23  30.........................................VNHKLAQGNSRLWIAIQEGTVVGSVQLSLVSK--NGVHRAEVEKLMVLTSARKQGIATLLLNELENFSKEKGLRLLVLDTREGD-VSELLYSKIGFVRVGVIPNFALSSNG 138
33 -38.400IDP05291 putative acetyltransferase [Clostridium difficile 630] CD1211 [Peptoclostridium difficile 630]  ali follow..  16  9.ITLQFVEEKDLENVKLLFTEYSNSLNIDLCFQDFNNELKTLPGKYKKPSGSLILAFVDENLAGCVALKKL-----EGKICELKRLYVRNQFRGLKIGKILLEEIIEEAKKFGYTHMRLDTLPSMKSAQGLYEKFGFYD............. 144
34 -37.900IDP92646 gene: yjaB; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4012 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  2VISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRTELEDLVRSFL--EAPLWVAVNERDQPVGFMLL----------SGQHMDALFIDPDVRGCGVGRVLVEHALSMAPE-----LTTNVNEQNEQAVGFYKKVGFKVTG........... 126
35 -37.200IDP01351 toxin resistance protein VCA0387 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  1.MEIXTGEFEDIAGITDIFNFYQTNARFEEFPFTLENREEWFSQFSRTAKYQIYVAVENGVLQGFACSQKYRAIPAFDDTVEV-SVYLAQEAKGKGLGSKLYTQLFSSIRAYGVHRILSGVALPNDASVALHKRFGFREVGISNEYAKKHGQ 152
36 -35.900IDP92637 gene: yiaC; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3550 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  1..MIREAQRSELPAILELWLESTTWGHPFIKANYWRDCIPLVRDAY--ANAQNWVWEEDGKLLGFVSIM---------EGRFLAAMFVAPKAVRRGIGKALMQYVQQ-----RHPHLMLEVYQKNQPAINFYQAQGFHIVD........... 124
37 -35.300IDP95421 set236a-023 [Undefined organism]  ali follow..  20  1..............MTELSAELAALYEVADGSAGFKASD------VEVPRAAFVIARIDGFPVGCGALRPL-----DASTGEVKRMYTRRGFRRKGVAQAILAELERLAIEFGYTTIKLQTGPKQLDAAALYELVGYHR............. 114
38 -35.200IDP92629 gene: yncA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b1448 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  1.MSIRFARKADCAAIAEIYNHA--VLYTAAIWNDQTVDADNRIAWFEAAGYPVLVSEENGVVTGYASFGDWRSFDGFRHTVEH-SVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGIESQNQASLHLHQSLGFVVTAQMPQVGTKFGR 151
39 -35.000IDP00086 gene: yncA; putative acyltransferase NT01ST1973 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  1.MTIRFADKADCAAITEIYNHA--VLHTAAIWNDRTVDTDNRLAWYEALGYPVLVSEENGVVTGYASFGDWRSFDGFRYTVEH-SVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQVGVKFGR 151
40 -35.000IDP92634 gene: yedL; predicted acyltransferase [Escherichia coli str. K-12 substr. MG1655] b1932 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  1MFTIKTDDLTH-----AVQALVAYHISGMLQQSPPESSHALDVQKLRNPTVTFWSVWEGEQLAGIGALKLL-----DDKHGELKSMRTAPNYLRRGVASLILRHILQVAQDRCLHRLSLETQAGFTACHQLYLKHGFADCEPFADYRLDPHS 145
41 -33.200IDP95293 gene: aac(6`)-Ib; aminoglycoside 6`-N-acetyltransferase type Ib [Klebsiella pneumoniae] AAL93141 [Klebsiella pneumoniae]  ali follow..  18  25.VTLRLMTEHDLAMLYEWLHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVAWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGT.......... 176
42 -32.100IDP92633 gene: yafP; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b0234 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  21  4.IQIRNYQPGDFQQLCAIFIR-SQHYSPQQISAWAQIDESRWKEKLAKSQ--VWVAIINAQPVGFISR----------IEHYIDMLFVDPEYTRRGVASALLKPL-----IKSESELTVDA---SITAKPFFERYGFQ.............. 125
43 -31.800IDP95424 set236a-026 [Undefined organism]  ali follow..  15  4..............................CFQDFETEVATLPGKYAEPRGRLLLAYVDQKPAGCIALRGI-----DDGVCEMKRLFVRDEFRGHRLGLLLVEKVIGEARAAGYLKMRLDTFPPKGKAVKLYESHGFRE............. 108
44 -31.700IDP95446 set236a-048 [Undefined organism]  ali follow..  11  7.VSFRPMSEDDLVLMLKWLTRVLEFYDGRDKKHTQKTIREHYTEQ-WADEIYRVIIEYDTIPIGYAQIYRIQGELFDEKIYAMDQFIGEPEYWNMGIGAEYCRVVCQYLTEMDANAVILDPRKNNPRAVRAYQKAGFEIIKELPEHELHEGK 167
45 -31.700IDP95450 set236a-052 [Undefined organism]  ali follow..  11  7.VSFRPMSEDDLVLMLKWLTRVLEFYDGRDKKHTQKTIREHYTEQWADE-IYRVIIEYDTIPIGYAQIYRIQGELTEEKIYAMDQFIGEPEYWNMGIGAEYCRVVCQYLTEMDANAVILDPRKNNPRAVRAYQKAGFEIIKELPEHELHEGK 167
46 -31.700IDP95485 spermidine acetyltransferase [Staphylococcus aureus] ADV68932 [Staphylococcus aureus]  ali follow..  15  1.MKLRALEYSDLLFVHELNNEYSIMYWFEEPYESLTELQYLFDKHLLDESERRFIVEDENQVVGIVELVEINYIHRNCEI----QIIIKPEFSGKGYAKFAFEKAINYADILNMHKIYLYVDTDNKKAVHIYESQGFKTEGLLKEQFYTKGK 149
47 -31.400IDP91767 gene: speG; spermidine N1-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  7.VKLRPLEREDLRYVHQLDNNASVMYWFEEPYEAFVELSDLYDKHIHDQSERRFVVECDGEKAGLVELVEINHVHRRAEF----QIIISPEYQGKGLATRAAKLAMDYGTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQ 155
48 -31.000IDP95484 gene: speG; spermidine acetyltransferase [Yersinia pestis Z176003] ADE65402 [Yersinia pestis Z176003]  ali follow..  14  7.VRLRPLEREDLPFVHQLDNNASIMYWFEEPYEAFVELCDLYDKHIHDQSERRFIIESQGTKIGLVELVEINHIHRRAEF----QIIIDPTHQGKGYAGAAAKLAMEYGSVLNLYKLYLIVDKENEKAIHIYSKLGFEIEGELKQEFFINGE 155
49 -30.600IDP91819 gene: yjhQ; KpLE2 phage-like element; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4307 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  6.FTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPAL-------SLLARYEGKAVGHILFTTFKGEMDSPLMHILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHA------TYYPRHGFEPCAGDKGYPAP... 142
50 -29.700IDP01688 GNAT family acetyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1313 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  4LKNFAELNSQEIKLIFKWRNHPDISQFMKTKHIDFEEHLRFIRNLHQDSNKKYFLVFQDEQIIGVIDFVNITTKSC--------EFGLYAIPDLKGVGQVLMNEIKKYAEILKVDTLKAYVFKDNHKALKLYQQNHFTIYDEDKDFYYVCLK 148
51 -29.700IDP01616 spermidine n1-acetyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] VC_A0947 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  5.LTLRALERGDLRFIHNLNNNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEF----QIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGR 154
52 -29.300IDP92639 gene: yhbS; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3156 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  22  1.MLIRVEIPIDAPGIDALLRR-----------SFESDAEAKLVHDLREDTLGLVATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDP------ALYSRFGFELAA........... 126
53 -28.600IDP00844 acetyltransferase, GNAT family SACOL0519 [Staphylococcus aureus subsp. aureus COL]  ali follow..  17  3.IYLSTLTELDYDKSLNSIEES-------DDNPETSWQARAKVKHLRKSPCYVIAKNENNDVVGHVLLIEINSDDKTYYGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVVVDHCF------DYFEKLGYQNAA........... 137
54 -28.300IDP95423 set236a-025 [Undefined organism]  ali follow..  16  11FSISTDRSRIDLDLVHSFLSNSY----------ARNIPREVVRRSVEN--SLCFGVYEGVAQVGFARV-----LPDIATFAYLADVFILESHRGRGLSKWLVESILGHPDLQGLRRWMLAT----RDAHGLYSKSGFVP............. 129
55 -28.000IDP95401 set236a-066 [Undefined organism]  ali follow..  15  8.ICIRTLIDDDFPLMLKWLTRVLEFYGGRDKKYTLESLKKHYTEPWEDE-VFRVIIEYNNVPIGYGQIYKMYDYPKTDEIVYGMDQFIEPNYWSKGIGTRYIKLIFEFLKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGK 168
56 -28.000IDP91190 6`-aminoglycoside N-acetyltransferase [Enterococcus faecalis V583] EF_A0061 [Enterococcus faecalis V583]  ali follow..  13  8.ICIRTLIDDDFPLMLKWLTDVLEFYGGRDKKYTLESLKKHYTEPWEDE-VFRVIIEYNNVPIGYGQIYKMYDPKTDEIVYGMDQFIGEPNYWSKGIGTRYIKLIFEFLKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGK 168
57 -27.300IDP92638 gene: yiiD; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3888 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  17MYHLRVPQTEE--ELERYYQFRWEMLRKPLHQPKGSERDAW-----DAMAHHQMVVDEQGNLVAVGRLYI-----NADNEASIRFMAVHPDVQDKGLGTLMAMTLESVARQEGVKRVTCSARED---AVEFFAKLGFVNQG........... 142
58 -25.600IDP00739 acetyltransferase, GNAT family SACOL1063 [Staphylococcus aureus subsp. aureus COL]  ali follow..  26  38...............................................ESESIHLIGYDNGQPVATARIRP-----INETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCH---AIPFYESLNFKMRGNIF........ 126
59 -23.600IDP01725 acetyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA2534 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  13  8.LLIRKFEFKDWEAVHEYTSDSDVMKYIPEGVFTEEDTRNFVNKNMGENAKNFVILIGENILVGHIVFHKYFGEHTYE------GWVFNPKYFNKGYASEAAQATLKYGKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYFKKCIPHGNE 155
60 -23.600IDP92628 gene: rimL; ribosomal-protein-L7/L12-serine acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1427 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  11  11.LELHAVAENHVKPLYQLICKNKTWLQQSLNWPQFVQSEEDTRKTVQRGYAKMFMIFKEDELIGVISFNRIEPLNKTAEIGY----WLDESHQGQGIISQALQALIHHYQSGELRRFVIKCRVDNPQSNQVALRNGFILEGCLKQAEFLNDA 165
61 -23.400IDP92632 gene: rimJ; ribosomal-protein-S5-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1066 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  18.LVVRLVHDRDAWRLADYYAENRHFLKPDESHCYPSGWQARLGMINEFHKQFGLFDPDEKEIIGVANFSNVVRGSFHACYL---GYSIGQKWQGKGLMFEALTAAIRYMRTQHIHRIMANYMPHNKRSGDLLARLGFEKEGYAKDYLLIDGQ 176
62 -23.200IDP91769 gene: yjcK; ribosomal-protein-alanine acetyltransferase [Yersinia pseudotuberculosis IP 32953] YPTB1890 [Yersinia pseudotuberculosis IP 32953]  ali follow..  12  16.IHLLVPDLSRSQEMHQLIVNFSNLHREFLTWADDNSSEETVFSNMSDEYKFLIINNHTNQLVGCISLFIRHAQIPYFEIGY----WLSTQAMGYGFITEACILVRDLAHHLKSKRLEIRMARRNIRSSKLAERCGFYCEAILKNNRI.... 169
63 -22.700IDP92635 gene: elaA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2267 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  1MIEWQDLHHSELSQLYALLQLRCAVFVVEQNCPYQDIDGDDL-----TGDNRHILGWKNDELVAYARIL---KSDDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLETCTHHPDKPVYLGAQAH---LQNFYQSFGFIPVTEVY........ 136
64 -21.400IDP91269 acetyltransferase, GNAT family [Bacillus anthracis str. Sterne] NT05BA2958 [Bacillus anthracis str. Sterne]  ali follow..  17  11.LQLRELTLLDAETMFHYFSKESVIYFGMDSFENIEQAKTTIQTFKNRYEEWGIEKKGTGQLIGTCGFHLINHHHKRAEIGY----ELDDTYWGQGYASEALQAILTYGETLQLIRIAAVVYVENKASQKLLSKAGFQEEGLLRKHMIQNGV 164
65 -18.500IDP91818 gene: yfiQ; inhibiting acetyltransferase for acetyl-CoA synthetase [Escherichia coli str. K-12 substr. MG1655] b2584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  726.CLFRPILPEDEPQLQQFISRVTKYFSEINEFTHEDLAN----TQIDYDREMAFVAVRREEILGVTRAISDPDNIDAE-----FAVLVRSDLKGLGLGRRLMEKLITYTRDHGLQRLNGITMPNNRGMVALARKLGFN.............. 864
66 -18.100IDP92022 glycylpeptide N-tetradecanoyltransferase, putative [Toxoplasma gondii ME49] TGME49_009160 [Toxoplasma gondii ME49]  ali follow..  15  125WCECDVRDPEELKEVYDLLSQHYVEDDDNLNYSADFLDWALTAPGCHRDWVIGVRVSSTNKLVGFITATPSQIRVFSDPMAEVNFLCVHKKLRSKRLAPVLIKEITRRVNLRSIWQAVYTAGVVLPTPVAQCR................... 262
67 -16.900IDP92630 gene: argA; fused acetylglutamate kinase homolog (inactive)/amino acid N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b2818 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  297..QIRRATINDIGGILELIRPLEQ----------QGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPE----EKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLT----TRSIHWFQERGFTPVDI.......... 418
68 -16.900IDP90696 gene: argA; N-acetylglutamate synthase [Yersinia pestis CO92] YPO1022 [Yersinia pestis CO92]  ali follow..  13  296..QVRRATINDIGGILELIRPLEQ----------QGILVRRSREQLEMEIDKFTIIERDNLTIACAALYPFPD----EHIGEMACVAVHPDYRSSSRGEMLLNRITNQARQMGLKKLFVLT----TRSIHWFQERGFTPAEV.......... 417
69 -16.300IDP95397 set236a-062 [Undefined organism]  ali follow..  20  3........................................................................................EVDYWSKGIGTKYTKMIFEFLKERNADAVILDPHQDNPRAIRMYQKAGFRIIEDLPEHELHEGK 67
70 -15.500IDP92641 gene: yjdJ; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4127 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  19  3.............................................IREGHNKFYINDKQGKQIAEIVF-----VPTGENLAIIEHTDVDESLKGQGIGKQLVAKVVEKMRREKRKII................................... 69
71 -12.900CPX_01616_91817 Complex of sperminidine SpeG and DNA-binding response regulator RcsB [Undefined organism]  ali follow..  16  5.LTLRALERGDLRFIHNLNNNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAE----FQIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGR 154
72 -12.300IDP92636 gene: tmcA; elongator methionine tRNA (ac4C34) acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b2474 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  356....QTLWQSDPETPLKVYQLLSGAHYRTSPLD--------LRRMMDAPGQHFLQAAGENEIAGALWLHGNNPLAATLRGRRVSRIAVHPARQREGTGRQLIAGALQYTQDLDYLSVSFGY---TGELWRFWQRCGFVLVRMGNHREASSGC 524
73 -11.200IDP95449 set236a-051 [Undefined organism]  ali follow..  11  7.VSFRPMSEDDLVLMLKLTDDRVLEFYDGRDKKHTQKTIREHYTEQWADEIYRVIIEYDTIPIGYAQIYRIQGELFDEYDYHETG................................................................... 91

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.