current user: public

If you have questions about the server, please let us know.

Query: IDP04391 gene: cotJB; spore coat protein CotJB [Clostridium perfringens ATCC 13124] CPF_1067 [Clostridium perfringens ATCC 13124], from CSGID

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MKALELLDDIQKLQFYAVELNLYLDNFPENRKATEDYKEISSKLSELIERFECEYGPIRNFGQAYVENPVAWIEQPWPWEIRYLast
1 -7.170sp|Q9NZN1|IRPL1_HUMAN Interleukin-1 receptor accessory protein-like 1 OS=Homo sapiens GN=IL1RAPL1 PE=1 SV=2  ali   11  18......LQTVSAISMAAATSTALATAHPDLRSTFHNTYHSQMRQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIP....... 87
2 -5.710sp|Q8N3S3|PHTF2_HUMAN Putative homeodomain transcription factor 2 OS=Homo sapiens GN=PHTF2 PE=2 SV=2  ali   15  4...SETSKKYSNTSILLTEINLYLEKKPNKKEELTLVNNVLKLATKLLKELDSPF............................ 58
3 -5.670sp|Q8IVL1|NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens GN=NAV2 PE=1 SV=3  ali   14  33VRNMELVKIIDWIPKVWHHLNRFLEAHSSSDVTIG---DVDGSRVWFTDLWNYSIIPYLLEAVREGEDPAKWVMDTYPWAAS. 130
4 -5.580sp|Q9UMS5|PHTF1_HUMAN Putative homeodomain transcription factor 1 OS=Homo sapiens GN=PHTF1 PE=2 SV=2  ali   15  1...SETNKKYSNVSILLTEINLYLEKKPNKKEQLTLVNNVLKLSTKLLKELDTPF............................ 55
5 -5.560tr|F5H4H9|F5H4H9_HUMAN Uncharacterized protein OS=Homo sapiens GN=CCDC78 PE=4 SV=1  ali   18  79.ERAQLLVRATMAEEQLSELQEYVDQH--DPRALVWLE............................................. 123
6 -5.500sp|Q9Y2G1|MRF_HUMAN Myelin gene regulatory factor OS=Homo sapiens GN=MRF PE=1 SV=3  ali   12  9..QGTIIALVVVMAFSVVSMSLYVLSLRTEEDLVDTDGSFAVSTSCLLALLRPQPPGGSE--------------ALCPW.... 72
7 -5.220sp|Q9P2H0|K1377_HUMAN Uncharacterized protein KIAA1377 OS=Homo sapiens GN=KIAA1377 PE=1 SV=3  ali   77...............VCEESYPSVTLRTAEEESVPLWKR............................................ 100
8 -5.120tr|E7EUA9|E7EUA9_HUMAN Uncharacterized protein OS=Homo sapiens GN=NAV3 PE=4 SV=2  ali   13  43IRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIG---DVEGSRVWFMDLWNYSLVPYILEAVREGEDPSKWVLDTYPWSSA. 140
9 -5.120sp|Q8IVL0|NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens GN=NAV3 PE=1 SV=3  ali   13  43IRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIG---DVEGSRVWFMDLWNYSLVPYILEAVREGEDPSKWVLDTYPWSSA. 140
10 -5.020sp|Q9P2H0|K1377_HUMAN Uncharacterized protein KIAA1377 OS=Homo sapiens GN=KIAA1377 PE=1 SV=3  ali   4AEEQKILESLNDLSERLHYIQESICKNPSIKNTLQIIPLLEKREDRTSSCRDKR............................. 57

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.