current user: public

If you have questions about the server, please let us know.

Query: IDP06042 hypothetical protein jhp0369 [Helicobacter pylori J99] NP_223088 [Helicobacter pylori J99], from CSGID

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MGINMCSKKIRNLILCFGFILSLCAEENITKENMTETNTTEENTPKDAPILLEEKRAQTLELKEENEVAKKIDEKSLLEEIHKKKRQLYMLKGELHEKNESILFQQMAKNKSGFFIGVILGDIGINANPYEKFELLSNIQASPLLYGLRSGYQKYFANGISALRFYGEYLGGAMKGFKSDSLASYQTASLNIDLLMDKPIDKEKRFALGIFGGVGVGWNGMYQNLKEIRGYSQPNAFGLVLNLGVSMTLNLKHRFELALKMPPLKETSQTFLYYFKSTNIYYISYNYLLLast
1 -32.7002lhf_A mol:protein length:179 Outer membrane protein H1  ali model follow..  14  1...............................................................................................................ADNFVGLTWGETSNNIQKSKSLNRNLNSPNNTGTWGIRAGQQF---------QGRYYATYENISDTSSGNKLRQQNLLGSYDAFLPIGDNN-----TKLFGGATLGLVKLEQDGKGF-KRDSDVGYAAGLQAGILQELSKNASIEGGYRYLRTNASTELGSLDLHSSSQFYLGANYKF 178
2 -29.0002k0l_A mol:protein length:216 Outer membrane protein A  ali model follow..  13  1...............................................................................................ARIMKAIFVLNAAPKDNTWYAGGKLGWSQYHDTGFYGNNNNGPTRNDQLGAGAFGGYQ--VNPYLGFEMGYDWLGRMAYKGSVDNGAFKAQGVQLTAKLGYPI------TDDLDIYTRLGGMVSKGNYASTGVSRSEHDTGVSPVFAGGVEWAVTRDIATRLEYQW-VNNIGDAGTVGTRPDNGMLSLGVSYRF 192
3 -27.9002ge4_A mol:protein length:177 Outer membrane protein A  ali model follow..  14  1..........................................................................................................MAPKDNTWYTGAKLGFSQYHDTGFINNNGPTHENQ--LGAGAFGGYQ--VNPYVGFEMGYDFLGRMPYKGSVENGAYKAQGVQLTAKLGYPI------TDDLDIYTRLGGMVFR-ADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQF-TNNIGDAHTIGTRPDNGMLSLGVSYRF 171
4 -27.9002maf_A mol:protein length:238 Opacity protein opA60  ali model follow..  12  1.........................................................................................................ASEDGGRGPYVQADLAYAYEHITHDYPEPTARNIRTRSVHPRVSVGYD--FGGWRIAADYARYRKWNNNKYSNQENGTFHAVSSLGLSAIYDFQINDKFKPYIG--ARVAYGHVRHSIDSTKDYQSNSIRRVGLGVIAGVGFDITPKLTLDAGYRY----HNWGRLENTRFKTHEASLGVRYRF 238
5 -27.8001p4t_A mol:protein length:155 outer membrane protein NspA  ali model follow..  13  1............................................................................................................EGASGFYVQADAAHAKAS---------SSLGSAKGFSPRISAGYR------INDLRFAVDYTR---YKNYKAPSTDFKLYSIGASAIYDFDTQSP----VKPYLGARLSLNR-ASVDLGGSDSFSQTSIGLGVLTGVSYAVTPNVDLDAGYRYNYIGKVNTVKNV---RSGELSAGVRVKF 155
6 -27.4001bxw_A mol:protein length:172 PROTEIN (OUTER MEMBRANE PROTEIN A)  ali model follow..  14  1..........................................................................................................MAPKDNTWYTGAKLGWSQYHDTGLINNNGPTHENK--LGAGAFGGYQ--VNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPI------TDDLDIYTRLGGMVWR-ADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQW-TNNIGDAHTIGTRPDNGMLSLGVSYRF 171
7 -26.4004rlc_A mol:protein length:175 Outer membrane porin F  ali model follow..  1....................................................................................................ANVRLQLEQGQNSVEIEAFGKRYFTD---------SVRNMKNADLYGGSIGY--FLTDDVELALSYGEYHDVRGTYETGNKKVHGN--LTSLDAIYHFGTPGV---GLRPYVSAGLAHQNI--TNINSDSQGRQQMTMANIGAGLKYYFTENFFAKASLD---GQYGLEKRDNGHQGEWMAGLGVGFNF 168
8 -25.5002f1t_A mol:protein length:197 Outer membrane protein W  ali model follow..  12  1............................................................................................................HEAGEFFMRAGSATVRPTEGAGGTLGSLGGFSTNNTQLGLTFTY--MATDNI---GVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQDPWVFMFSAGYRF 191
9 -25.2002x27_X mol:protein length:212 OUTER MEMBRANE PROTEIN OPRG  ali model follow..  14  1........................................................................................................DIQGHKAGDFIIRGGFATVDPDDSSSDIKLDGAKQRDSDTQLGLTFTY--MFADKWGVELVAATPFNHQVDVKGLGPGLDGKLADIKQTLLLQYYPMGGTNSAFQPYGGLGVNYTTFFDEDQGFSSMKLQDSWGLAGELGFDYMLNEHALFNMAVWYMDIDTKASINGPSALDPWVYMIGFGYKF 210
10 -24.2003qra_A mol:protein length:157 Attachment invasion locus protein  ali model follow..  10  2..............................................................................................................EGESSISIGYAQSRVK-------EDGYKLDKNPRGFNLKYRYE--FNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFRINEY----VSLYGLLGAGHGK-AKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYE----------SKLDDVKVGTWMLGAGYRF 157
11 -23.8002n6l_A mol:protein length:215 Outer membrane protein OprG  ali model follow..  14  2............................................................................................................HKAGDFIIRGGFATVDPDDSSSDIKLDGAKQRDSDTQLGLTFTY--MFADKWGVELVAATPFNHQVDVKGLGPGLDGKLADIKQTLLLQYYPMGGTNSAFQPYGGLGVNYTTFFDEDLASNRKKLQDSWGLAGELGFDYMLNEHALFNMAVWYMDIDTKASINGPSALDPWVYMIGFGYKF 207
12 -23.4002jmm_A mol:protein length:156 Outer membrane protein A  ali model follow..  14  2............................................................................................................PKDNTWYTGAKLGWSQYS-------------RENQLGAGAFGGYQ--VNPYVGFEMGYDWL---------GRMPRKAQGVQLTAKLGYPKLGTDD--LDIYTRLGGMVWRADTSDKDGNGYISAAEASVSPVFAGGVEYVIRRRITPEIATRLEYQWTNNASDNG------MLSLGVSYRF 150
13 -16.3001orm_A mol:protein length:148 Outer membrane protein X  ali model follow..  11  5.....................................................................................................................VTGGYAQSDAQGQMNKMG-----------GFNLKYRYEEDNSPLGVI-FTYTEKSRTASSGDYNKNQYYGITAGPAYRIN---------WASIYGVVGVGYGKFQTTEYPT-YKNDTSDYGFSYGAGLQFNPMENVALDFSYEQ---------SRIRSVDVGTWIAGVGYRF 148
14 -14.4002f1c_X mol:protein length:286 Outer membrane protein G  ali model follow..  11  123..............................................................................................................TDDLRFNGWLSMYKFA-------NDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLG-------NHSVTPYTRIGLDRWSNWDWQDDIEREGHDF---NRVGLFYGYDFQNGLSVSLEYAF----EWQDHDEGDSDKFHYAGVGVNYSF 280
15 -12.9005o65_A mol:protein length:334 FapF  ali model follow..  30..................FSFETGITYARYDARQLTLNGFLALDSIFLGNINLDRIKADNWTLDLTGRYNLDNRWQFDVNVPVVYRESTYQSGGASGGDPQATSEESVSRDPTI-VSVRVKAPTGKEPFGIKLVRSTANDNLYVPESLPTGNGVWMVKTFDPAVLFGSVSYTHNLEDSFDDISSDVNVRLGDSFQFGVGVAFALNERMSMSFSVSDLIQRKSKLKPDGGGWQSIVSSDGYFNVGMTIAASENLTIVPNLAIGMTDD---------APDFTFSLKFPYYF 328
16 -12.7002qom_A mol:protein length:285 Serine protease espP  ali model follow..  10  90.............................................................................................................FDSGAYIDGKYVHHDNEYTATFAGLGTRDYSTHSWYAGAEAGYRYHVTEDAW----QAELVYGSVSGKQFAWKDQGMHLSMKDK-------YNPLIGRTGVDVGLLANGETVLRDASGEKRIKGEKDSRMLMSVGLNAEIRDNVRFGLEFE--------KSAFGKYNVDNAVNANFRYSF 277
17 -12.7003slj_A mol:protein length:313 Serine protease espP  ali model follow..  10  121..............................................................................................................DSGAYIDGKYVHHDNEYTATFAGLGTRDYSTHSWYAGAEAGYRYHVTEDAW----QAELVYGSVSGKQFAWKDQGMHLSMKDKDYNPLI--------TGVDVGLLANGETVLRDASGEKRIKGEKDSRMLMSVGLNAEIRDNVRFGLEFE--------KSAFGKYNVDNAVNANFRYSF 307
18 -12.5004d5b_A mol:protein length:339 CYMA  ali model follow..  33VGTSVEYEDKVT--VFNFFYNNPQWNFMGFYSFKIENREQKEPGYYENEDGIKQLFSLNKGHDLGNGWATGLIYELEYTRSKVYSPDVSGLRKNLAEHSIRPYLTYWNNDNMGFYSNLEYLLS--------KEDRNAWGKRQEQGYSALFKPYKRFGNWEVGVE--FYYQIKTNDEKQPDGTINEKSDFNERYIEPIVQYSFDDAGTLYTRVRVGKNETKNTDRSGGGNAGINYFKDIRKATVGYEQSIGESWVAKAEYEY-SRLSGWEARNKSELTQHTFYAQALYRF 332
19 -12.4003aeh_A mol:protein length:308 Hemoglobin-binding protease hbp autotransporter  ali model follow..  10  119.............................................................................................................FRSGAYFDAKYIHNENKYDLNFAGAGKQNFRSHSLYAGAEVGYRYHLTDTTF----QAELVWGRLQGQTFNWNDSGMDVSMRRNSVNPLV--------TGVVSGKTFSADVHLKDAAGEHQINGRKDSRMLYGVGLNARFGDNTRLGLEVE--------RSAFGKYNTDDAINANIRYSF 306
20 -12.1004fuv_A mol:protein length:233 porin protein associated with imipenem resistance  ali model follow..  10  1...............................................................................................DEAVVHDSYAFDKNQLIPVGARAEVG---------------------TTGYGGALLWQ--ANPYVGLALGYNGGDISWSDDVKVNGSTYDLDMDNNVYLNAEIRPWGASTNGLYVAAGAAYLDNDYDLTRNVDATRSYKNDIAPYLGFGFAPKINKNWGVEVGAYYTGNPTVKLVSSGSAVTTGVGKVGVNFFW 225
21 -12.0005onu_A mol:protein length:356 Outer membrane protein OmpU  ali model follow..  5LGLNKMNKTLIALAVSAAAVATGAYADGINQSGDKAGSTVYSAKGTSLEVGGRAEARLSLKDGKAQDNSRVRLNFLGKAEINDSLYGVGFYEGEFTTNDQGKNASNNSLDNRYTYAGIGGTYGEVTIAVADRVDNMLAYKGQFGDLGVKASYRDNGEDGYSLSAIYTFGDTGFNVGAGYADQDDQNEYMLAASYLFTDGELAKDVDYTGYELAAGYKLGQAAFTATYNNAETAKETSADNFAIDATYYFKPNFRSYISYQF---NLLDSDKVGKVASEDELAIGLRYDF 350
22 -11.8004rlb_A mol:protein length:253 Carbapenem-associated resistance protein  ali model follow..  19............................................................................................GAMDEAVVHDSYAFDKNQLIPVGARAEVG---------------------TTGYGGALLWQ--ANPYVGLALGYNGGDISWSDDLSINGDMDNKLAYLNAEIRPWGASTNPWAQGLYVAAGAAYVDNQYDLTKNVGTNASVENDIAPYIGFGFAPKFSKNWGVEVGAYYSGNPKVSLASNNDALIGSVGKVGVNFYW 247
23 -11.7004rl9_A mol:protein length:255 Carbapenem-associated resistance protein  ali model follow..  10  19............................................................................................GAMDEAVVHDSYAFDKNQLIPVGARAEVG---------------------TTGYGGALLWQ--ANPYVGLALGYNGGDISWTDDVSVNGTKYDLDMDNNVYLNAEIRPWGASTNGLYIAAGAAYLDNDYDLAKRIGNGDSYKNDIAPYLGFGFAPKISKNWGVEVGAYY---EANEIRNDNKYEWMPVGKVGVNFYW 249
24 -10.6002j1n_A mol:protein length:346 OUTER MEMBRANE PROTEIN C  ali model follow..  10  78AGL----QDVGSFDY--GVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNI----------YLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDF----------GLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF 346
25 -10.6001i78_A mol:protein length:297 PROTEASE VII  ali model follow..  12................INADISLGTLSGKTKERVYLAEEGGRKVSQLDKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDEARHPDTQLNYANEFDLNIKGWLLNEP--------------NYRLGLMAGYQES--TARGGSYIYSSEEGFRDDIGSFPNGERAIGYKIGLTGSYRYEFELGGTFKYSGWVESSDNDEHYDPKGRITYRSKVKDQNYYSVAVNAGYYVTPNAKVYVEGAWNRVTNKKGNTSLYDNYNFITTAGLKYTF 297
26 -10.5003nb3_A mol:protein length:346 Outer membrane protein A  ali model follow..  15  2.......................................................................................KKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYH--DTGFINNNGPTHENKLGAGAFGGYQ--VNPYVGFEMGYDWL--GRMPYKGSVENGAYKAQGVQLTAKLGYPITDD----LDIYTRLGGMVWR-ADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQ............................. 163
27 -10.4001uyn_X mol:protein length:308 NALP  ali model follow..  91...................................................................................GRSTWSENSANAKTDSISLFAGIRHDAGDIGYLKGLFSYGRYKNSISRDEHAEGSVNGTLMQLGALGGVNVPFAATEGGLRYFAE-KGSALGWSGNSLTEGTLVGLAGLKLSQPLSDKAVLFATAGVFTGAT--------AATGKTGARNMPHTRLVAGLGADVEFGNGWNGLARYS---------YAGSKQYGNHSGRVGVGYRF 308
28 -10.3003cx5_F mol:protein length:146 Cytochrome b-c1 complex subunit 6  ali model follow..  10  1.GMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDDDDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPG................................................................................................................................................................................ 112
29 -10.2003qq2_A mol:protein length:284 BrkA autotransporter  ali model follow..  11  100.............................................................................................................GDGGYYLDTVLRLGQYNIAGTDGGRVTADYRTSGAAWSLEGGRRFELPNDW----------FAEPQAEVMLWRTSGKRYRASNGLRVKVDANTATLGRLGLRFGRRIALAG-DVRTNGIGHAGAGRHGRVELGAGVDAALGKGHNLYASYE--------YAAGDRINIPWSFHAGYRYSF 284
30 -10.1005uh7_A mol:protein length:169 DNA-directed RNA polymerase subunit beta`  ali model follow..  12  6SGLVPRGMDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERKAVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTRYGEYFTGAMGAESI.................................................................................................................................................................... 153
31 -9.9602x4m_A mol:protein length:298 COAGULASE/FIBRINOLYSIN  ali model follow..  99......................................................................................................SSHPATNVNHANEYDLNVKGWLLQ--------------DENYKAGITAGYQET--TATGGSYSYNNGAYTGNFPKGVRVNQRFSMPYIGLAGQYRIN---ELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAKVFAEFTYSKYDEGKGGTQTIDNKNYTVTAGLQYRF 292
32 -9.9504dcb_A mol:protein length:297 Coagulase/fibrinolysin  ali model follow..  95......................................................................................................SSHPATNVNHANEYDLNVKGWLLQ--------------DENYKAGITAGYQET--TATGGSYSYNNGAYTGNFPKGVRVNQRFSMPYIGLAGQYRIN---ELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAKVFAEFTYSKYDEGKGGTQTIDNKNYTVTAGLQYRF 288
33 -9.9102xe1_A mol:protein length:354 OUTER MEMBRANE PROTEIN C  ali model follow..  78AGL----QDIGSFDYVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGQNGSVSGENDPDFTGHGITNNGRKALRQNGDGVGGSITYDYEGFGVGAAVSSSKRTWDQNNTGLIGTGDRAETYTGGLKYDANNI----------YLAAQYTQTYNATRVGSLGWANKAQNFEAVAQY------QFDFGLRPSVAYLQSKGKNLGVVAGRNYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRAAGINTDDIVALGLVYQF 354
34 -9.7904rl8_A mol:protein length:275 Protein involved in meta-pathway of phenol degradation-like protein  ali model follow..  12  104............................................................................................................LNEANDILGATVYLTAPTGNYNRDDALNLGENR--WKVDLQAAYVKHLGEKWAVDLVGDAIWYSDNDDFGSSSARREQDVSYGAQLMGRYIVDPGTSLAIGLG---------HTWGGENQIDGTAQDDRAETTNFRVTANKFFTAKDQLQMQL----GRDLAVENGPKENFRLNLRYVRVF 269
35 -9.6105nup_A mol:protein length:344 OmpK36  ali model follow..  189...................................................................................................................ISAGFAYSHSKRTDEQNSVPALGRGDNAETYTGGLKYDA---------NIYLASRYTQTYNATRAGSLGFANKAQNFEVVAQYQFDFGLRPSVA----------YLQSKGKDLERGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTRNAGISTDDVVALGLVYQF 344
36 -9.5202xe2_A mol:protein length:343 OUTER MEMBRANE PORIN C  ali model follow..  10  188...................................................................................................................FGIGAAVSSSKRTWDQNNTGLIGTGDRAETYTGGLKYDA---------NIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLA----------YLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNRFTRDAGINTDDIVALGLVYQF 343
37 -9.5105cyb_A mol:protein length:152 Lipoprotein  ali model follow..  1....MKLKRFTLSLASLASFSLLVACSQRAQQVQQPVAQQQVQQPAQQNTNTANAGGNQNQAAPVQNQPVAQPTDIDGTYTGQDDGDRITLVVTGTTGTWTELESDGDQKVKQV............................................................................................................................................................................... 110
38 -9.4303kvn_X mol:protein length:632 Esterase estA  ali model follow..  427.............................................................................................................QENRWWADAALTGGYLDYDDLKERSEKGDTNGHLWAFSARLGYDIAQQADFVSADYYSEKGASATALDYDDQKRSSKRLGAGLQGKYAF------GSDTQLFAEYAHEREYEDDTQDLTMSLNSLPGNRFTVSLGFSQKLAPELSLRGGYN---------WRKGEDDTQQSVSLALSLDF 625
39 -9.4302erv_A mol:protein length:150 hypothetical protein Paer03002360  ali model follow..  1...................................................................................................................ADVSAAVG------------ATGQSGMTYRLGLSWDWDK---SWWQTSTGRLTGYWDAGYTYWEGGDEGAGKHSLSFAPVFVYEFAGD-SIKPFIEAGIGVAAF----SGTRVGDQNLGSSLNFEDRIGAGLKFANGQSVGVRAI----HYSNAGLKQPNDGIESYSLFYKIPI 150
40 -9.4305nxn_A mol:protein length:342 Porin 1  ali model follow..  12  138...........................................................................................................NNNAFGYVDGLSFALQYQGKNGDNNKSSAGMAKDNGDGYGFSTAYE--LGWGVTLGGGYSSSSRTPNQKAGSATGKRAQAWNVGGKFDANVELVAQYLFDFGLKPSIGYNQSKGKNLGGGYDNQDLVKY----ISVGSYYYFNKNMSAVVDYKINLLKDNDFTKEYGINTDNVLGLGLVYQF 342
41 -9.3304frt_A mol:protein length:400 Probable porin  ali model follow..  10  132.GGLLEVNEIDGLALQFGQLRQVKQRDSTNAEDLGITRGNKRNVLAGRHPGSDRFDFAGGTYRWSERLSSSYHYANLEDFYRQHHLGVQHLLPLADDQSLKSDIRWARSTDEG-ALNALFTYRL--------------------GHAFGLGYQRMSGDSGFAYLAGTDPYLVNFVQIGDFANKDERSWQLRYD--YDFA-------AIGL--GLTFMSR-YLRGEHIDLLDGGGRGKEWERDTDIAYLVQSG-----NLGIKLRNGTFRSDFGNDIDETRLIVSYALPL 393
42 -9.3304fso_A mol:protein length:406 Probable porin  ali model follow..  137.GAQLTSEEIAGLRFSATRLERYTARDSSDAQDIRLHCKNKRYACDTTGNRFDAYQLDYQVNDGLLLQYAQGGLRNVYRQVGKRQVGAGKLSADLRWFDSEDAGAARAGKIDNRALSLLLAYAQ--------------------GHTLSAGWQRMNGASSMPYLDGSNPYLANYLQVNDFANPEERSWQLRYD--FDLR-------SVGV--GLSFMTRYVNGDHIRLANGDEGKEWERDIELKYIVQSGRFKDLSLRLRNATYRTDFERSARDV-DEVRLIASYNLSL 399
43 -9.3301k24_A mol:protein length:253 outer membrane protein  ali model follow..  15................................................................................................DLSSISSTRAFLKEKHKAAKHIGVRADINKLGKTKNVKLPTGVPENRIDLYTGYTYTQTLSDSLNGLGFESSKDSIKTTKHTLHSSRQSWLAKVHADLLSQL----GNGWYINPWSEVKFDLLNTGVTNLKKDINQKTNGWGFGLGANIGKKLGESASIEAGPFYKQRTYKESGEFSVTTSIREYGLRVGIKF 253
44 -9.3205vjs_A mol:protein length:196 Reaction Center Maquette  ali model follow..  105.....................ELRQKHQQLAQKIQQLLQKHQQLGAKILEDEEKHIELLETILGGSGGDELRELLKGELQGIKQYRELQQLGQKAQQLVQKLQQTGQKLWQLG................................................................................................................................................................................ 196
45 -9.3005dl7_A mol:protein length:419 Porin  ali model follow..  141.GIRFVSNEIPNLQLEGFYVDEVRQRDSIRYTDVGTDNINHRFNKAATTDSFSYQLKDYRLRAYHAELKDIYQQQFLGFNGKQPLNDQLNFLSDVRFFNSEETGSKKIGEVDNRHISGLFGLNY--------------------NHTVSLGYMQSFGSTGLPFLSGTESPVVLDFMSSDYSNKDEKVYSIRYE--YDFKNARIGDVSL----GLRFMTRYAKGEDIDLLQYGDQRFKEDSLEFDLGYKIPEGKLKGLGMRARFSHYRNDMPTNMTFHSANLNVDYTFKF 412
46 -9.2305cwd_A mol:protein length:179 Designed helical repeat protein  ali model follow..  1......................MSTKEDARSTCEKAARKAAESNDEEVAKQAAKDCLEVAKQAGMPTKEAARSFCEAAARAAAESNDEEVAKIAAKACLEVAKQAGMPTKEA................................................................................................................................................................................. 90
47 -9.1702wjq_A mol:protein length:215 PROBABLE N-ACETYLNEURAMINIC ACID OUTER MEMBRANE CHANNEL PROTEIN NANC  ali model follow..  27..............................................................................................................QNGWWASMESNTWNTIHDNKKENAALNSSNGTRYGPYVKLSWD--ATKDLNFGIRYRYDWKAYRQQDLSGDMSRDNVHRWDGYVTYHINSD------------FTFAWQTTLYSKQNDYRYANHKKWATENAFVLQYHMTPDIT----IEYDYLDRQGVYNGRDNLSENSYRIGVSFKL 215
48 -9.1204jg9_A mol:protein length:174 Lipoprotein  ali model follow..  15  1......MKKIGTMLLFSILIAGCTQAQPDLKKPKKEAIATSSTQVNAPSFFHLSVLKDVNWEETPSFIQEKIPLKGIEEKIAMADSPIIANEKN-PEMPTGKLSIIALKQGSVTPTPLLFQQESSEPTWTTSNTIDSTTNELPLTMSLSSGLNIYVNEKYYD............................................................................................................................... 167
49 -9.0404ft6_A mol:protein length:394 Probable porin  ali model follow..  12  132.GGMLTSREIAGLTLHGGQMRSLSQRNSSDHQDLSVDGRGGAFSDRFDYL-EYRFNAERSQVGLWQARLQDIYRQDYYSLSHKQSFGGWRLGASVGLFDTRDEGAAKLGELENRALTGFFSATR--------------------GHSLGAGYQRMYGDDGMLYIAGTSTPLVNDIQVRNFTSAGERSWQLRYD--YDFV-------ALGI--GLTAMARYASGAHARTKAMDDGRAWERDVDVAYVIQSGPLKNLGLRWRNAMLRSNHAADVDENR----LILSYSLPL 387

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.