current user: public

If you have questions about the server, please let us know.

Query: IDP90101 gene: sseL; deubiquitinase [Salmonella typhimurium LT2] STM2287 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2], from CSGID

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MSDEALTLLFSAVENGDQNCIDLLCNLALRNDDLGHRVEKFLFDLFSGKRTGSSDIDKKINQACLVLHQIANNDITKDNTEWKKLHAPSRLLYMAGSATTDLSKKIGIAHKIMGDQFAQTDQEQVGVENLWCGARMLSSDELAAATQGLVQESPLLSVNYPIGLIHPTTKENILSTQLLEKIAQSGLSHNEVFLVNTGDHWLLCLFYKLAEKIKCLIFNTYYDLNENTKQEIIEAAKIAGISESDEVNFIEMNLQNNVPNGCGLFCYHTIQLLSNAGQNDPATTLREFAENFLTLSVEEQALFNTQTRRQIYEYSLQLast
1 -125.0005haf_A mol:protein length:338 Deubiquitinase SseL  ali model follow..  99  16VSDEALTLLFSAVENGDQNCIDLLCNLALRNDDLGHRVEKFLFDLFSGKRTGSSDIDKKINQACLVLHQIANNDITKDNTEWKKLHAPSRLLYMAGSATTDLSKKIGIAHKIMGDQFAQTDQEQVGVENLWCGARMLSSDELAAATQGLVQESPLLSVNYPIGLIHPTTKENILSTQLLEKIAQSGLSHNEVFLVNTGDHWLLCLFYKLAEKIKCLIFNTYYDLNENTKQEIIEAAKIAGISESDEVNFIEMNLQNNVPNGCGLFCYHTIQLLSNAGQNDPATTLREFAENFLTLSVEEQALFNTQTRRQIYEYSLQ 332
2 -78.6005ubw_A mol:protein length:187 Deubiquitinase SseL  ali model follow..  99  3....................................................................................................................................GSRMLSSDELAAATQGLVQESPLLSVNYPIGLIHPTTKENILSTQLLEKIAQSGLSHNEVFLVNTGDHWLLCLFYKLAEKIKCLIFNTYYDLNENTKQEIIEAAKIAGISESDEVNFIEMNLQNNVPNGCGLFCYHTIQLLSNAGQNDPATTLREFAENFLTLSVEEQALFNTQTRRQIYEYSLQ 187
3 -40.1001xt9_A mol:protein length:212 Sentrin-specific protease 8  ali model follow..  12  14...........................................................................................................................RQSDVSLLDPPSWLNDHIIGFAFEYFANSSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDGTHWSLLVY--LQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAAQQNSYDCGMYVICNTEALCQNTESLLQLLTPAYITKKRGEWKDLITTLAKK........... 212
4 -40.0005ham_A mol:protein length:274 RickCE  ali model follow..  3....................................................EIKDYWYTENEITHLLTAQLDEKKFSVQPAITFRNTALTEEMLKDYTAKGEEKNKILAEVQETIKIANL-----IPDKEERALMLGDAKKREEILKLSDAEREKLKNDLLRGGEAQQQINEDILNRATKDIKDNGKEAAVIPIEMGYHWTVLVAKYDKKDNQLTFNDSLGNSINYDGQKLPKLIDKTLGNLPNKPIIIDEQTQQTDQSACGVFTVDNGIKIAKGQAILSTESKGEKGLRLREHHAQILTDAMFKQDAQ....... 260
5 -39.6002bkq_A mol:protein length:212 SENTRIN-SPECIFIC PROTEASE 8  ali model follow..  11  14...........................................................................................................................RQSDVSLLDPPSWLNDHIIGFAFEYFANSSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDGSHWSLLVY--LQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAAQQNSYDCGMYVICNTEALCQNFFRQQT---ESLLQLLTPAYITKK-------RGEWKDLIAT 208
6 -38.9002io0_A mol:protein length:232 Sentrin-specific protease 2  ali model follow..  10  43.............................................................................................................................GDIQTLKNYHWLNDEVINFYMNLLVERNKKALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVI--DLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLE-PQQLNGSDSGMFTCKYADYISRDK---PITFTQHQMPLFRKKMVWEILHQQL............ 231
7 -38.9003zo5_A mol:protein length:238 SENTRIN-SPECIFIC PROTEASE 2  ali model follow..  10  49.............................................................................................................................GDIQTLKNYHWLNDEVINFYMNLLVERNKK-LHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVI--DLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLE-PQQLNGSDSGMFTCKYADYISRDK---PITFTQHQMPLFRKKMVWEILHQQL............ 237
8 -38.7001euv_A mol:protein length:221 ULP1 PROTEASE  ali model follow..  10  38.............................................................................................................................RDFKTLAPRRWLNDTIIEFFMKYIEKSTPNT-VAFNSFFYTNLSERGYQGVRRWMKRKKTDKLDKIFTPINLNQHWALGII--DLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDPQQPNGYDCGIYVCMNTLYGSADA---PLDFDYKDAIRMRRFIAHLILTDALK........... 221
9 -38.7002xph_A mol:protein length:238 SENTRIN-SPECIFIC PROTEASE 1  ali model follow..  11  49.............................................................................................................................KDIQTLNHLNWLNDEIINFYMNMLMERSKESVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVV--DFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNG-PQQMNGSDCGMFACKYADCITKDR---PINFTQQHMPYFRKRMVWEILHRKL............ 237
10 -34.9005jp1_A mol:protein length:220 Xanthomonas outer protein D  ali model follow..  10  33.............................................................................................................................PELPPVRATSWLLDGHLRAYTDDLARRAHLLHFADSQVVTMLSSADPDQQARAQRLLAGDDIPPIVFLPINPNAHWSLLVVRRNKDAVAAYHYDSMAQKDPQQRYLADMAAYH--LGLDYQQTHEMPIAIQSDGYSCGDHVLTGIEVLAHRAGGRDLTDIEPDRGLIRDRLAQ................... 219
11 -34.9002oiv_A mol:protein length:186 Xanthomonas outer protein D  ali model follow..  11  1....................................................................................................................................ATSWLLDGHLRAYTDDLARRAHLLHFADSQVVTMLSSADPDQQARAQRLLAGDDIPPIVFLPINPNAHWSLLVVRRNKDAVAAYHYDSMAQKDPQQRYLADMAAYH--LGLDYQQTHEMPIAIQSDGYSCGDHVLTGIEVLAHRAGGRDLTDIEPDRGLIRDRLAQ................... 180
12 -34.9006dg4_A mol:protein length:263 Ulp1-like SUMO protease  ali model follow..  50..............................................................................................................................EEKLLPATAWLNDNVIIGAIFYIADYVNTKKTAFTSFFWPRLLSHGPGGCGRLVRKANFLDIDTILIPICESSHWTLAVI--RPGRRTVSHLDSMAAGR--GSERVKAKLLELVKFVLEDQFVEAE-PRQTNGWDCGVFTITNAICLALGVD-PAQAYTEAQLPLQRQRIAAVLLNGGFKGDFTL...... 250
13 -33.6005hag_A mol:protein length:273 Deubiquitinase and deneddylase Dub1  ali model follow..  12  36.....................................................................................................................................PAWDSDIIFKCLCYFHTLYPGLIPFNFKQKIISILEDKKWYHPTPKTLSDTMQTMKQLAIKGSVGAHWLLVIV--DIQARRLVYFDSLYNPPENMKKELQSFAQQLDQVYPAYDSKAKEVIQRGSGSSCGAWCCQFLHWYLKDPLTDALNDLPV-DSVERHENLASFVQACEAAVQDL...... 265
14 -33.3006fdk_A mol:protein length:266 Deubiquitinase and deneddylase Dub1  ali model follow..  11  64...............................................................................................................................SILEDKKAVLRGEPIKGPLPISCSKENYRRHLQRTTLLPVFM---WYHPTPKTLSDTMQTMKQLAIKGSVGAHWLLVIV--DIQARRLVYFDSLYNYVMPPENMKKELQSFAQQLDQVYKIAAKEVIQRGSGSSCGAWCCQFLHWYLKD----PLTDALNDLPVDSVE------------RHENLASFVQ 243
15 -32.7006fdq_A mol:protein length:266 Deubiquitinase and deneddylase Dub1  ali model follow..  11  64................................................................................................................................SILEDKKAVLRGEPIKGPLPICCSKENYRRHLQRTTLLPVF---WYHPTPKTLSDTMQTMKQLAIKGSVGAHWLLVIV--DIQARRLVYFDSLYNPPENMKKELQSFAQQLDQVYPAYDSKAKEVIQRGSGSSCGAWCCQFLHWYLKDPLTDALNDLPV-DSVERHENLASFVQACEAAVQDLPE.... 254
16 -31.3005lnb_B mol:protein length:310 Ubiquitin-like-specific protease 2  ali model follow..  38.............................................................................................................................QDFKCLFNKDWVNDSILDFFTKFYIESSIEKSHLMSSFFYTKLISNYYSNVKKWVNNTDLFSKKYVVIPINISYHWFSCII-INNPLVNILTFDSLRQTHSREIDPIKEFLISYALDKYSIQLDKTQ-PQQPNMSDCGVHVILNIRKFFENPVETIDVWKNSKIKSKHFTAKMINKYFDKNERKNLRHTLKL 274
17 -29.9001avp_A mol:protein length:204 ADENOVIRAL PROTEINASE  ali model follow..  16  2.......................................................................................................................................GSSEQELKAIVKDLG------------------CGPYFLGTYDKRFPGFVSPHKLACAIVNTGVHWMAFAW--NPRSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTP-HNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLY... 175
18 -27.0004wx4_A mol:protein length:205 Protease  ali model follow..  16  4........................................................................................................................................SSEQELAAIVRDLG------------------CGPYFLGTHDKRFPGFLAGNKLACAIVNTGVHWLAFGW--NPRSRTCYMFDPFGFSDRRLKQIYSFEYEAMLRRSALSLEQSTQTVQGPDSAACGLFCCMFLHAFVHWPDRP-GNPTMNLLTGVPNGMLQSPQVLPTLRRNQEKLY... 176
19 -24.6003eay_A mol:protein length:323 Sentrin-specific protease 7  ali model follow..  10  38.............................................................................................................................EDLECLEEGEFLNDVIIDFYLKYLILEKVERSHIFSSFFYKCLTRRRHKRVRTWTRHINIFNKDYIFVPVNESSHWYLAVIKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQFSKTPKQDNSSDCGVYLLQYVESFFKDPIVNFELPIHL-EKWFPRHVIKTK-------REDIRELILK 312
20 -18.2005w3t_A mol:protein length:352 PopP2 protein  ali model follow..  57........................................................................................................................................VDRAIMPLLIVAENARNPGLNLVPMAEDEEVRTQPPMAGSRHIAEFVASARPGRYRAVIDDGSHTRAADIRKDASGTSVIVVDPLRKEKDESAYVDYADNVNMEFGEHAKCAFIPVDIQKS-FFDCRILSLSLALKMHDKDD....................................... 201
21 -16.3006be0_A mol:protein length:302 AvrA  ali model follow..  11  67........................................................................................................................................TDLEMMPFLVAQANKKYPELNLKF-------MSVHELVSSIKETRMEGVESARFLVNMGSSGIHISVVDFRVMDGKTSVILFEPAACSAFGPALALRTKAALEREQLPDCYFAMVELDIQRSSSECGIFSLALAKKLQLEFM....................................... 202
22 -9.6105dgg_A mol:protein length:190 Uncharacterized protein  ali model follow..  10  6........................................................................................................................................MQDHDMTL---LMPKSQGRIVVMAVLNRYDSHSANAIIETLASDVFNPEV--HYIMIPVGPG-HWRGVYLSKPQGGTDLELFDPYGPEGAAVLDDYLDLLNQCGVPKELVNIRHTGPKHQGDAYSCGDFTCAYSHKKMKEFGAPEGSYNPILIDTLDNL...................... 165
23 -9.0405klp_A mol:protein length:342 Orf34  ali model follow..  10  120....................................................................................................................................................................................................TLKHHVMADVRLHQGGATIIITEPIVGARYQQLQRHNLTLEDLSESPLSQVAIIETQAAAT-SDDCVMYSLNYAIKAHKNAA....................................... 205

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.