current user: public

If you have questions about the server, please let us know.

Query: CPX_91702_91677 Complex of EZRI_HUMAN with M1_I34A1 [Undefined organism], from CSGID

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .
# E-value Template Links and tools%idFirst MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL,MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFKLast
1 0.000e+00UniRef50_UPI000B90C194 COPII coat assembly protein sec16-like isoform X1 n=2 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B90C194  ali  18  90..KLVPLKVQMLDDSVILHVPNGCLGADLFKECCRHLNLLEMDYFGLEYFNKTDKVVWLDLEKPIARQVAAPKKTL-FHFTVKFYLADPSQ-LQDEFTKYLYALQIKKDLANGRLPCSENTAALMASYMLQAEVGDYTSPDHDDGYISAFRFVPNQTR--------AMESKIQEYHKNHVGQTPADADFNLLDVARRLEMYGVQLHAARDYENVQLHLAVSHQGVLVFHNNSRIN---TFSWAKIRKLSFKRKRFLVKLHPEPRSTVEFMMTSRNDCKRFWKCCVEHHTFFRLTQPKHRRPRRRLLSRGSTFRYSGRTQKQVVEDARQRPPSLARVSTRSLGAPRTTTPLTINLTESIVPDHHSAPDLTYGQSYANGQGDNAVSSPTSVSPTTPSSTPVTPVHDNSRIAIHKGQSNSSITYEYTVNEDNPQMQSSSEVNGDSEPVHILPTESAPTEAAPQEEPKVQPEPQPEKEVQSPVINGEHNGHEGLSTNYSTDTSDISIPSGSLHIDVDYEMRRQVILDLPDEIERLEDPFVEEEGPKRERHE.................................................................................................................................................................................................................................................................................................... 637
2 0.000e+00UniRef50_UPI000BA806CD band 4.1-like protein 4A n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA806CD  ali  21  8.PKTRHCKILLLDETLIQEIQGTTRGQDLLDVVFKHLNLLETAYFGLRFVDSSGHTHWLEPTKKVVKQL-KGISPCTLSFNVKFYASDPC-KLTEEITRYQFFLQVKQDILQGRLPVSFELAPELFAYSVQSELGDYDYRRHHSGYVSEFRFLSNQ--------TQELEAKVLELHKGLVGQEPATAELNFLERVKWLDMYGVDLHPVMGENSIGYFLGLTPSGVIVLRNKSKVG---NYFWPRITKVYFKGKYFMLRVRDKNESTYGFELPSKKACKHLWKCCVEHHAFFRLTQVREVSNSRKVFGLNSRFRF--------------------RHHHSRKSSDNDSEVSKSSRGSKTSKSSRNSISSRKHCSQYKDACSGSESEGQRKHKKHRKHKSGSTYELVDSEAQWKLVQQQQQENNYLRPQNAVVRELSSRKSGYHNSGMETESEATFQHKKKHRRHRSRSKSPEIKRGLPEELKKHIEYSLIDSETMTEEERKNIKYTKVETDSRLFKIRYSPTTGQVRCRIARVPSKNSSEKLINQLSIGNEDSP.............................................................................................................................................................................................................................................................................................. 530
3 0.000e+00UniRef50_UPI000BE1C67B band 4.1-like protein 4A isoform X1 n=8 Tax=Varroa TaxID=62624 RepID=UPI000BE1C67B  ali  16  9..KTFHCKVLLLDNTLIQELKNVSRGQDLLDAVHKHLNLLETAYFGLRYIDATGQTHWMDATKKIYKQM-KGVENYTFYFGVKYYAADPCKLL-EEITRYQFFLQVKRDILHGRVPLTYDLAAQLFAFAVQSELGDFDPRRHNSGYISEFRFVPDQ--------TEALEEKVVQLHKTLIGQVPAQAELNFLDRVKWLDMYGVDLHPVLGEDHVEYYIGLTPAGIVVLKNKTKVG---NYFWPRIGKVYYKGCFFMLQVKDKSENTYGFELPNKAACKHLWKCCVDHHSFFRLAQSNPSAATSKLFGFGSKLRNSLRTPRES-RDVSRPQPTFTRVPSRRYQ-----MQRLDNPDGADATSNFEAESRRSSVATTTQSTPYSMYRSVSVPSVGGAAGGTTRAWDEPRPRGLFSHSGSANPSPRSVRSIAMSARSYRDSSVDSMDCFRHRKRHRSRHERDRSEQHGRSDAESEVSRTSRNSRTSRASSACRHSSYHSRSEVSGSECESVLRHSGHRHRQPNHQSNGNTSHRGSALELVDSQPQWLESQKRRQQHHQNSSISSPQSAVVRSLTSSGGADGSESSSKPRCSGYVQSGVETESEAVFSAGSSSRKRHRKHRSKSPGRRENLIPHEVRRLIELEPQLAGPNGAPVDDIKYTKVETDSRLF-RIRYNENSQRRAKVAVVK........................................................................................................................................................... 695
4 0.000e+00UniRef50_UPI00097518C3 uncharacterized protein LOC105332945 isoform X1 n=9 Tax=Crassostrea TaxID=6564 RepID=UPI00097518C3  ali  17  38.......RILCLDDTLHLSFKGSSKASNLLDRVFAHLNLVEKDYFGLRFVDQSDQTHWLDPQKPLSSQLKSCSQPYTFYFGVKFYPPDPC-KLKEEITRYQFFLQIKRDILQGRLPITFDEAAELFAFAVQAELRDYDPRYCSEGYVSEFRFVPNQ--------TQELEEQIARFHQHLGGMSPGQAEYKFLDKVKWLDMYGVDLHSVLGEGNTEYFLGLTPTGIVVYKNKSKVG---NYFWPRITKVTFKGKIFIIKVRDKDEHTYAFEVATKTRTKHLWKCCVEHHTFFRINQLADTLAISSKHSRGS--RRSGRNDRQNNNDIRQ-QPMVTRIPSRRQPTRSKSDSKLNGGKAGSYYSVINDAAVTRVVAPEPVQGSRHRSLPDLQRNQSPRSTRSAPWERDADTGLYTSGRESPVSLHSDVQKFPRRVGQTSDTESGHRPKNKGSDNESDVSFSRRRRRDGDSGSESDVSPMRGRRPKSSVEPWYENQWNETMQGMFPAHSESYMNSVPSIHSAPAGEVKRRRRRRTKSPGTAKRPPEELKQHIVYDLVDTEGMAPEDLQDIPYMKVETKAEPFKIKYSPHVNIRQRYRSPKRKGFGDQDPSQSQLPQNGEPPPPYTPSESARRTPELGHRNYMSDTNAYNNRSDLETQSNKSGSTARYRPEQIFYYGDAVSITSFDTSRSWDTSRSYNTFY............................................................................................................................................... 723
5 0.000e+00UniRef50_T1KWY1 Uncharacterized protein n=1 Tax=Tetranychus urticae TaxID=32264 RepID=T1KWY1_TETUR  ali  22  20....FKCTIKLLDDELECDFTKEHKGQHLLDYCYKSLNLLEKDYFGLRYVDNKQQRNWLDPTRCIVKQI-KGLSPVVFCFRVKFYPADPIR-LKEEVTRYFVFMQLRRDLLHGRLQCSSNELPLLMAYIIQSELGDYDPEEHGENYVSSFKLVPNQSTKLSQTTS--LEKTVAEIHKDMRGLTPGDAELNFIKKASSLETYGIDPHPVKDHKGKQLYLGINHIGVTTFQGSRKVQ---SFKWNEIQKLTYEGRMFIVHTNDKKKHLVGFKCPNTSACHFLWRCAVEQRYFFTMNSSSDIPTTGGGLFKTCKLRYTGRVEKEIINDMKRKEATIQRSYSTTSAPPHIRTIGRSSTAPITTSEHDREQESPDRGSNFPYWNYSTFSEPEENHVTSSPHTLDPFDEEDWDTSMTSTLPTEFDLRPDITPTDEESRSM..................................................................................................................................................................................................................................................................................................................................................................................................................... 456
6 0.000e+00UniRef50_UPI000973286E moesin-like n=3 Tax=Protacanthopterygii TaxID=41705 RepID=UPI000973286E  ali  74  1MPKTINIRVTTMDAELQFSINPNTTGQQLYEEVVGMVGLREVWYFGLLYTDTKGFHTWLKFNKKVTAQDIKKESPIQFRFRAKFYPEDVAEELIQDITQKLFFMQVKEAILTDEVYCPPESAVLLASYAVQAKFGDFDKETHRNGYLAQEHLLPKRVLDQHKLSKEQWEQRVQTWHEEHRAISKEDAMLEYLKIAQDLEMYGVNFFEIKNRKGTELWLGVDALGLNIYEKEDRLTPKIGFPWSEIRNVSFSDKKFSIKPIDKKAPVSTVQC........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 271
7 0.000e+00UniRef50_A0A0B6ZV39 Uncharacterized protein (Fragment) n=1 Tax=Arion vulgaris TaxID=1028688 RepID=A0A0B6ZV39_9EUPU  ali  20  2...............YEVPIDKRSVGQLLYERVCDYVDLLERDYFGLLYKDDNNVKYWLDLSKKITKQ--KRRGKMNFEFALKFYPPDPTQ-LTESITRYLVCLQIRRDIISGKLPCSQATHAMLGSYAVQADIGDYDPLDHGTDYIRDMPFAPDQA--------DDLLYKIAALHKQHKGQTPEQAELHYLEYSKKIALYGIDLHRAKDSDYVDILLGVGATGISVYRDNLRIN---RFVWPKILKISYRRNKFLLRIRPAEFETFEFRLPDNKKAKRLWKISVEHHAFLRLRSSDDAKKRSGLPRFGSKYRYSGRTLYQTRLNASRPSKHFERTHSRQSLNSVLNNNRTRSQDNLNHHREPTNRQERIQIPIAPINDDRTPFQSPLPRQESPKFISREIIRNITVQEEDEEEYEDKDMDLPEVPQDSPQEERRFVSNHQSYGGVATPFASVNLHLRKPDSDSESDRSPRGSRGSMRSMQSVNLEEEP.............................................................................................................................................................................................................................................................................................................................................................. 487
8 0.000e+00UniRef50_A0A1A7ZRE6 FERM domain containing 3 n=17 Tax=Euteleosteomorpha TaxID=1489388 RepID=A0A1A7ZRE6_NOTFU  ali  24  18....VLCTIRLLDDEISCSIQRDTKGQFLLDHVCNHYNLLEKDYFGIRYVDPEKQRHWLEPNKPVVKQMKSAQQPYMMCFRVKFYPHEPM-KIKEELTRYLLYLQLKRDIYHGRLLCPFAEAAYLGACIVQAELGDFDPEEHPSDYIRDFKLFPKQSLK--------LERKIMEIHKNLRGQCAALAELNMLQKAHALETYGVDPHPCKDFTGATAFLGFTATGFVVFQGNKRIHLL---KWSDVNKLKFEGKTFYIHCNRMKKLVLTFHTSTPAACKHLWKCGVENQAFYKCSSQIKTVSSSNIFFKGSRFRYSGKVSKEVIE----ASSKIQREPPEVHRAQFGHSRSFNSLSHKNLIMNMEPLVPA...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 383
9 0.000e+00UniRef50_UPI000B8F5556 band 4.1-like protein 4 n=1 Tax=Folsomia candida TaxID=158441 RepID=UPI000B8F5556  ali  20  9..RNYHCKVILLDQELVLVAQSTSNGQELLDNTFKHLNLIETAYFGLRFIDNTGQTNWLDPGKKIIKQLE-DTEPYTFYFGVKFYAADPCKLL-EEITRYQFYLQIKSDVLQGRLPVPFDLAAELCAYAVQSELGDYDPRRHCTGYISEFRFVSNQ--------SPDLEASITELHKSFGGQVPAVAEINYLEKVKWLEMYGVDLHIVMGGDQHDHWIGLTPSGIIVLRNKTKVG---NYFWPRISKLNNKGKYFMIRVRNKSEQTYGFETPSARACKHLWKCAVEHHAFFRLVQPTSLNSGNKINSLNSRFRDSGRSE---SSVRRRAQPQFVRTPSRRYTRRAVEG--SHDVAGSENREDAVVDVQHSNGI-----NKTISVPQPVSTTSPLYRTNSMAQMTRADSPRSVRSAPWPAPHTTTTKSAYSVPSPRSVRSAGVGGNMHGDRERERQREYSKDRKRSASAESNSSVDXXXXXXXXXXXXXKNSDNESEISRSSHHSKRRHKSSSRKENSGSESEN............................................................................................................................................................................................................................................................................................................................ 513
10 0.000e+00UniRef50_A0A194PLJ1 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=10 Tax=Obtectomera TaxID=104431 RepID=A0A194PLJ1_PAPXU  ali  19  63..KMLAVRVHMLDDTVSFQIQSKALGRVLFDQVCRQLHLLEADYFGLEYQDCSGTKYWLDVEKAMCRQVGLSLLEPTLRFCVKFYTPDPAR-LEEEFTRYLFCLQVKRDLAAGEIQCNENTAALMASYIVQAECGDFVPEDYPDHYLSGYKFFPGQDPDS--------ERRIMENHKKHIGQSPAEADLNLLETARRCELYGIKMHPAKDHEGVPLNLAVAHMGIVVFQNFTKIN---TFSWAKIRKISFKRKKFLIKLHPEYRDVVEFFFEGRNECKNLWKKCVENHGFFRCTSPRPPRHKPRVMSRGSSFRYSGKTQKQIVEFVRDKRQTFQSESPSSARCRRSGSFRAWRPGPPRAALNASVSAHPLLPLPPGSDAISLEWDKQPHYLEASLMMKGYSAEEARAAAQRARSPTRSPPRTPPRRRSPPPLAATAFATTRDKAAPELVTHAEVNHHPTEDSPLPHRTTTPLISPESSWSQTGRESVRARAPTPPPRGQRPPPGQSRASSPRTHTPTRTYTHTHTHTHTATRPADTAPGPSRDRYSASPHSSRSGSLLLADEDAEPPRRIWRRSASCRNLRDFSFDEAGRAKRRADTRSLLAGLHTGSPRRIDSPIT----RYDDARTLAFILAERGSIESQRELIGRTYSSSFPGAISEPRLDLPTFIRSGSQDDISHDSYELIERS....................................................................................................................................................... 767
11 0.000e+00UniRef50_Q9W0R3 Tyrosine-protein phosphatase n=67 Tax=Diptera TaxID=7147 RepID=Q9W0R3_DROME  ali  20  32..RQQCVTVLFLDDTHTFRIEKRAKGSELLDQVFQYLELSERDYFGLLFQKPGDVVRWVDAQKQFKKQCSSVSLDPLLEFRVKFFVSDPSR-LQEEFTRYQFYLQIKRNILLGKLPCSSNTQCLLASYTVQSELGDFNALEHQPGYLSGMQLLCDQ--------TTEAERKVGELHKLHRGQLPADAEYNYLEHAKRLELYGIDLHRATDSNGKELQLGVSAVGLLVFQHSLRVN---TFSWSKMVKVSFKRKDFFIQLRREYDTLLGFGMSSHKHAKALWKSCVEHHSFFRLKR-PHRLSRFLNISLGSKFYYSGRTELQAVQESKQRGRIFVRSPSKRLLGAAGGVGTSGSSGGTPMQQHSGSESANSHNNGKPAGAGTILTITKTSRPHDNKVTSKEADSMPRKAWEQQSDEYDIQLDVGFIEQCTRRFESASPSPMPPAYSSGQHS..................................................................................................................................................................................................................................................................................................................................................................................................... 479
12 0.000e+00UniRef50_A0A2M4A2A3 Putative ferm domain protein ehm2 (Fragment) n=9 Tax=Neoptera TaxID=33340 RepID=A0A2M4A2A3_9DIPT  ali  16  4........................PGQALLDVVYARLNLIETAYFGIRYIDQDNQTHWLDPAARLSRQLKGGKVTFDLYFGVKFYACDPC-KLVEEITRYQLYLQVKQDILQGRLPVSFELAAELGAYVVQAELGDYDPRKHPLGYVSEFRLLNNQ--------TKEIECRIHELHIQLAGMSPSQAEFNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPGGIVVLRNK---TTVAHYYWPRIAKVYYKGRYFMLRVCDKNNSTYGFETPKKSACKHLWKCCVEHHSFFRLVRVAPMQANG---TLGSKYSTSGRSERQTSQQQQRAPPSFTRTPSRRQPRRTMTEMQQLPPDDRMFDAPKYI-QQEIKSISIPQPAQSIPPPDSPRSTRSAPWMRSQQRPKSVRSVSTRMSAPANGHSGNNSNNGNNSRLRSSSVESHSSNESRSGRHRRRHRSRRVSDNESEMSRGSGRSGRSHNSHRKHRRHRSKNRRNRSDTESRDRSYSGHRRSTDSIELVDSGEQWLEVQRK--QHSDAVPKAAVIKSSQVMKGTHPDSGIIQHHHHRSRRHRKHRSPSDKIELTKHLQFDLVDTAGMTEDQLREIPYTVVETTHAAKKP............................................................................................................................................................................................................................. 624
13 0.000e+00UniRef50_Q9Y4F1-2 Isoform 2 of FERM, ARHGEF and pleckstrin domain-containing protein 1 n=22 Tax=Amniota TaxID=32524 RepID=Q9Y4F1-2  ali  19  38..KLVSIKIQMLDDTQEFEVPQRAPGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF-PPDHTQ-LQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEAL-DREHLAKNKYIPQQ---------DALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINA---FNWAKVRKLSFKRKRFLIKLRPDYQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSSPGGQSCRRGKEPKVSAGEPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVSTTERT................................................................................................................................................................................................................................................................................................................................. 554
14 0.000e+00UniRef50_UPI000A2A70B5 band 4.1-like protein 5 isoform X1 n=2 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A70B5  ali  21  27...TLEFKILLLDESLTFYIHKKSKGQVLLDLIFKNLDLVEKDYFGLQFMDTHQVSHWLDPTKKIKKQV-KIGPPFTLHFRVKFYAADP-QDLGEELTRYHFFLQLKQDIAKNKLQVPQKMAIELVAYSLQSQLGDYESDLHGEDYMEELKFYPNQN--------KELEKEILKKHKSLIGLSPAECEVNFLRLIKKLDFYGINLHKVQDIKKMEFQLGLSPRGIAVIRENEQV---AFYFWPKISKXTFKKKHFILEVHEDQKETYHYLLPNAQAAKHLWKCAIEHHTFFRLVKSARPKRTSSFLRFGSRFRYSGRTEYQTQRDARRKSMKFKRASSERFSKRTT............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 363
15 0.000e+00UniRef50_A0A095AL49 Band 4.1-like protein 2 n=1 Tax=Schistosoma haematobium TaxID=6185 RepID=A0A095AL49_SCHHA  ali  19  282......VCVIMLDGELVFQLSRDDIGQVLFDQVCQNLDLYEADYFGLTFVSNKRTWFWLDLQTKIGKQLRDNEQRL-FYFQVKFYPPEPS-LLQEELTRYQLTLQIRQDIYTGKLPCSWVTQALLGSFMVQAELGDFDPDKHGLDYLNEFEFVP--------SPTPQLLKKIVELHKTHTGMKPNEADIKYLETAKRLELYGVDLHPAKDTENVDIYIGVGFHGVVIYRDRLRIG---RFAWPKVLRISYKKNNFYLKIRPDYEAIVGFRLLNPHLANRLWKAAVEHHAFFRLKETPAPKRPLSTPSLSSQFRYTGRTFFQ------YRTTNIDRPHPRFNRSMLKRRTASMPTGLNAAMNMHTLNRAHPRDMTVGKIQNNDQLQGLRRFGSVQMGSGVNGNSNATQLYGTVPRHHPYSESVVSEVQDVQSQMS-KQYSDGVSNILSYGSVNESYDNEAPYNDYVNYRHSGKGKPDEMLSVTGGSQSSDYPIIQHGQNDRKGRHPSEISNSINERRPNSPITKTHRRKKHHDESSTNTVQQKDNYTYDPNTRISNSSSHKPPVGGVPVFGGVMLPNNHHNQEVDRLKRSDQLRPLNSPHFKKKQQYHSEENDEQTVTLTEDKADHNQYKSSSKHRKQ---LQTDHYSAVSNHNRPRHSGRSHRR............................................................................................................................................................................... 928
16 0.000e+00UniRef50_H2M737 Uncharacterized protein n=1 Tax=Oryzias latipes TaxID=8090 RepID=H2M737_ORYLA  ali  20  26..KTVPFKVTLLDSSFESEIEKHSKGQTLVDMVCEHLNLLEKDYYGLTFADSDTQKNWLDPSKEIKKQM--RHSLWHFAFAVKFYPPDPSQ-LTEDITRYYLCLQLRDDILSGRLPCSFVTHALLGSYTVQAELGDYDQEDHGSDYVSDFRLAPNQTR--------ELEERVMELHRNYRGMTPAEAELNFLENAKKLSMYGVDLHHAKDSEGIEIMLGVCANGLLIYRDRLRIN---RFAWPKILKISYKRSNFYIKIRPGEFGIFFFSLPLHKVPLACWTPFSPDKSFMTWRIILLEVAIRKWFTVVIKPQAEGHTVRSILAAV---------AVYDQNKPSLSGGLNLHFKMQLALEQDEDDRDQDQSQEEQEKDLDGDISPSRKKEFKERGHIQKDLRLKTAKMGGPKSAPLHSDASTISHVSNSRPGGQMWSSISKGDLRASLNVRRSEFLDKSQDVLLKHQASINELKRALREPNSKLINREKRLSGTTPTGTPSEGWGLLTVEKTSHTQRVFPPLPLFLFRKTSDFLQDRPPSAEQMKERTASKTRKKRRPQSFNLAMPTESGNRKTESDSSVEESDSDNSSERPCKGGTCSSPKDPSVRVCKDYKPEDLPAGDKKVSNQAVEQLEERK-HEPIQVSV-DKSKTPRIP........................................................................................................................................................................................ 678
17 0.000e+00UniRef50_B0W9Z2 Tyrosine-protein phosphatase non-receptor type 4 n=3 Tax=Culex TaxID=53527 RepID=B0W9Z2_CULQU  ali  28  39......VTVLFLDDTHTFQLEKKAKGHELLEQVFRHLELSERDYFGLQFQSSKGKPRWLDPNKPFRKQWNSGEACATLSFRVKFYVTDPSR-LHEEYTRYQFYLQIKRDIFRGKLPVGLNTACLLASYTVQSELGDYNPLEHTHGYLADMQLLPEQN--------EDTEHRISELHKLHRGQLPADAEYNYLEHAKRLDMYGIDFHRATDSAGKELSLGVSSIGLLVYQNGIRIN---TFSWSKMVKVSFKRKDFFIQLRREYDTLLGFSMGAHRNAKSLWKACVEHHSFFRLQRPHRSPRFLPL-TLGSRFHYSGRTELQAVQESRQRGKIFIRSPSKRMMLSASQPQS......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 417
18 0.000e+00UniRef50_UPI0007B4109F band 4.1-like protein 4A isoform X4 n=1 Tax=Monodelphis domestica TaxID=13616 RepID=UPI0007B4109F  ali  18  7VPEDFYCEVLLLDETQQQGVKKSTKGSVVLDYIFHHINLVEIDYFGLRYCDRNHQTYWLDPAKTLAKELIHAGPPYTFYFGIKFYAEDPC-ELKEEITRYQFFLQVKQDVLQGRLPCPGHVAAQLGAYALQAELGDYDPHKHPPGYVSEYRFVPDQ--------KEELEDAVERIHKTLMGLVPSEAEIKYLATVKSLEMYGVDLHPVYGEGRSDYFLGLTPVGVVVYKDRRLVGK---YFWPRITKVHFKETQFELRVLGKDETSFFFETSSKSVCKHLWKGCVEHHTFFRMPEEESGSLARKLSKLGSSHKHRSRI---ALQMGRDRSVPLPRPDQKVERSRSKTYPKRPSGSNSINRVTEGAENGGTTKIIAPLPVQSFKKSEGENSPETPTSKASAPWEENGAQGGLYNCSSDRKRSPKFPSARRRSPSGSSDPEPGQPARRRKARNSGDDSDLRRRSRSRCNTSSGSESEHSKREHQKKRNRFRQENGVTDSAPQWEAALQHPKEKPEANSNSRRSRHRSRSTQER.................................................................................................................................................................................................................................................................................................................... 540
19 0.000e+00UniRef50_A7SRN5 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7SRN5_NEMVE  ali  17  24.....TVKVCMLDDSVVFDIEPKVKGDILYKQVYEYLNLDEREYFGLSYYDKSDNLFWLDQLKPIKKQVKEIGK-VLFRFCVKFYTADPA-MLQEEYTRYLFALQVKKDLVNGGLKCSESTAALLASYVVQGELGDFDTLSCRPGYLADFQFFPEQTVDS--------EARISDFHKQHRSLSPTDCDYNLLDVARRLEMYGVILYPAKDKDNVDLELAAANMGIIVFQSGSKIN---TLSWAKIRKLSFKRKRFLIKLHPEYKDVVEFQMASRNACKSFWKVAISTHAFFRQSSQSPPRHRPRVFSRGSSYRFSGRTQKQIIDSMQRSQPSFQRTQSLKTPARNNLPHTSQSSASGFPRPYNAYSESENRIVEPMPPQEQVPEQQEKPEQEVPVPAIELPPDNEQEEQGDIPIEESEPNGPVIKVQSAENPDEDIPLKD--LDDEPDMMKDESSSAESVHDLEWQEELDRPEEEHQGEDENSTSYRYPTPKIVYSAEESKENRKSDIIIPPGVDHIAVQPQPRPPTPIEVDGIDSPSPPPPPPEEDDISEELVDEVQEFPVSPAETL--------PSPPPELLRDSPDPESLQGKSEHTNGIHQNGFHLEQSIETSYQVKVQNGGVVRHG-KGSQSSQVSTDDDPDTQTEN---RDNVFEEQASPKFRSDNEYSPPSSPKMMFKSDQMLSKAGSSAAYNIAK........................................................................................................................................ 703
20 0.000e+00UniRef50_E0VQN4 FERM domain-containing protein, putative n=6 Tax=Neoptera TaxID=33340 RepID=E0VQN4_PEDHC  ali  20  16......CTIRLLDDTLECEFQSDHKGLNLLNYVCQQLNIIEKDYFGLRFVDIAKQRHWLDLKKPILKQV-REMNPVLFSFRVKFYPPNPAN-LSEETTRYFLFLQLKRDLLHGRLYCSQNEAALLAAYIVQAELGDYDPEICIGNYVSNIKLLLKQTLP--------IEKQILEIHQTLKGQSSSAVELLFLKKACQLETYGVDPHVVKDHKGNTLYVGINHLGVLTFQGSKK---TRQFNWSEIQKINYEGKMFIIHVFYEKKHTVGFRCSTTSGCRYLWRCAVEKMLFFTLKKAADAPTGGGFFSWGTKFKYFGRTEKEILQDTLFRKIKPDVSLNGNLMRKSCSVPATPCTPAGSDLSEMRCRSLPKADHYMFYSKLHPDYPPIFGDCPKNSLPCLQIVSTSQDHDLGKSRVQDECDDYYFRDSFDRSSCDSQSHTNKTTTITSSQKCSRNHSPLHSGSGTTHGTGSKILSPKRDVTHNPLLQLSDNHQDIQNS...................................................................................................................................................................................................................................................................................................................................................... 505
21 0.000e+00UniRef50_UPI000BA0C087 uncharacterized protein LOC111068443 isoform X1 n=1 Tax=Drosophila obscura TaxID=7282 RepID=UPI000BA0C087  ali  19  64..KKLTVRIQMLDDSVTFQVQAKALGRVLFEQVCRQLNLLEADYFGLEYQESTHTKYWLDLEKPMNRQVGLSLVDPVLRFCIKFYTPDPGQ-LEEEYTRYLFCLQIKRDLATGSLQCNDNTAALMASYIVQASCGDFVPEDYPDHYLSSYRFVPHQDAT--------MQRKIMENHKKHVGQSPAEADLNLLETARRCELYGMKMHPGKDVEGVPLNLAVAHMGITVFQNITRIN---TFSWAKIRKISFKRKRFLVKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCTTQNTPRRKTRVLSRGSSFRYSGKTQKQIIEFVREKRQNFQRSQSFRQ-----GPLNASSRSQSHTYVNSSISANPLLPIDTAAWDYRNQCSDSMTPSLTKKAADTLDRRRDNPIDHMRSQVTAAQVEIYQTKNYAAESPTSQEEAASCSAAERQHHSAVAMDQMNSNRSLSPQGPQSWTSPSHSSSHHQPQPPPRNAPDQARAHDHNIGLSHLSHLYSSSTPRRVSVGSQAFVPASPQLISISTHSTHNANPNANPSISINNNNNSNTMPHSTLAGVHSVDLSSSMDL................................................................................................................................................................................................................................................................. 639
22 0.000e+00UniRef50_UPI0005C3673D serine/arginine repetitive matrix protein 1-like isoform X3 n=2 Tax=Crassostrea gigas TaxID=29159 RepID=UPI0005C3673D  ali  17  38.......RILCLDDTLHLSFKGSSKASNLLDRVFAHLNLVEKDYFGLRFVDQSDQTHWLDPQKPLSSQLKSCSQPYTFYFGVKFYPPDPC-KLKEEITRYQFFLQIKRDILQGRLPITFDEAAELFAFAVQAELRDYDPRYCSEGYVSEFRFVPNQ--------TQELEEQIARFHQHLGGMSPGQAEYKFLDKVKWLDMYGVDLHSVLGEGNTEYFLGLTPTGIVVYKNKSKVG---NYFWPRITKVTFKGKIFIIKVRDKDEHTYAFEVATKTRTKHLWKCCVEHHTFFRINQLADTLAISSKHSRGS--RRSGRNDRQNNNDIRQ-QPMVTRIPSRRQPTRSKSDSKLNGGKAGSYYSVINDAAVTRVVAPEPVQGSRHRSLPDLQRNQSPRSTRSAPWERDADTGLYTSGRESPVSLHSDVQKFPRRVGQTSDTESGHRPKNKGSDNESDVSFSRRRRRDGDSGSESDVSPMRGRRPKSSVEPWYENQWNETMQGMFPAHSESYMNSVPSIHSAPAGEVKRRRRRRTKSPGTAKRPPEELKQHIVYDLVDTEGMAPEDLQDIPYMKVETKAEPFKIKYSPHVNIRQRYRSPKRKGFGDQDPSQSQLPQNGEPPPPYTPSESARRTPELGHRNYMSDTNAYNNRSDLETQSNKSGSTYRSARYRNQINSNKES................................................................................................................................................................... 700
23 0.000e+00UniRef50_UPI000C7797E3 band 4.1-like protein 5 isoform X1 n=2 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C7797E3  ali  18  51....LPCHVRLLDGTLYIQLLSGALGCELLECVYKHLDIVETDYFGLQYTDETGLSRWIDMTKSIKKQTSKKGFPWIFWFAVKFYSSDPLN-LREEITRYQLFLQLKQDVLTGRLEPPHNISIQLAALALQSELGDFNPGVHTAAFVSEFRFVPVQ--------TEEMEEEILSAFSQIIGRSPAEAESEYLRVARELDMYGVEIHSVLGKDGSQYSLGLTPTGILVYEGLQKIG---LFFWPKITKLDFQKKKLSLRVVKEQEHIFIFRLTSERSCKHLWKSAVEHHAFFRLRTPRSTKIKQTFFRMGSRFRYSGKTEFQSVGVEPRRKLQFERRPSTRYARRQSHLIKEKESINQASKKSYEIDTSDTRFINNKHSSCHELRVLPINSRNTQKIGIPAVTSPVPAV--------SSPIPLNVITQSQGMGLPSTLPLSPAGYHTRSIVDIISEFNEKNQNLSDQSKVPNAPDISIPRDIDYLKWVSETKCPSKLTPTESCSSGKSGSSSNSGSEKEKHRASSPDSGCDVSVMVAYTSEPKVRRVDSSSQSVPTPAPRQSLRKHKTGKEKPKSMLVTEIEHPEKVSILTKEALAEIPD................................................................................................................................................................................................................................................ 636
24 0.000e+00UniRef50_E5SI88 Putative FERM central domain protein n=26 Tax=Trichinella TaxID=6333 RepID=E5SI88_TRISP  ali  18  26..KVMCLRVHMLDETITFRISHRSLGSVLYEEVFRHLNVLEYDYFGLEYVDSDGCRCWLEKQKPISKQISSAKSDQCFDLIVKFYTANPV-DLEEEYTRYLFALQIKRDLASGELVCNENTAAVMASYIVQSECGDFCAEDYPDHYLSSVRFVPNQ--------SAEFERKVMENHKKLVGMMPTESDIALLETARRCEFYGIKLHPAKDAEGTVIGLTVMHNGIKVY---LQLCCMSTFSWAKIRKLCFKRKHFYIKLHPDYKDTVEFSFETRHECKMFWKKCVEHHSFFRCTEANQSRSRTKLFTKGSSFRYEGRTQKQLIEYLRKKREPFTRPSGNRVCPKRITVPLLPYDSLLSDNAESSLSFPTNDSFSSTANQQSQLAEEGPSGGGNFAYSSLSGSRVGVARSNGGSSLSRKRANTLPKHGKSEPAFHERIINQSNASSTCSESFYKIDYDAVVYDNLLDHNSLTDVSKRLSKADGSDSAPEQQENVSQGSYSESDLNANEKLSSTDVEHDVSLEESSPAKVPSTVESAARRQKPTAPPKPKCLSKICCSPPDMSALKLDPGSDQRYSVIKHKV--FDGDIPYTLHVRQLKEETNPNPPTRVKSVHFGDDVLL--LSDDKSDVNYNSNRGNPTFQTFCTPDKHFNSHQQDRQR.................................................................................................................................................................................... 683
25 0.000e+00UniRef50_A0A1D2NCW3 Band 4.1-like protein 4A n=2 Tax=Entomobryomorpha TaxID=730330 RepID=A0A1D2NCW3_ORCCI  ali  19  16....................QSTSAGQELLDNVFKHLNLIETAYFGLRYIDNTGQTNWLDPSKKIVKQLEG-TEPFTLYFGVKFYAADPCKLL-EEITRYQFYLQIKQDILQGRLPVSFDLAAELGAYAVQSELGDHDPRRHSSGYISEFRFIANQ--------SPELELRVGDIHKSMAGQVPAEAELNYLEKVKWLDMYGVDLHPVLGEDNVDYFLGLTPAGIIVLRNKTKVG---NYFWPRISKLTHKGKYFMIRVKNKEEQTYGFETPSKAACKHLWRCSVEHHAFFRLVQPTTTTNSAKMNSLNARFRDSGRSE---TSVRRRAQPQFVRTPSRRYTRRVVEGA---QDAPEVDESGGTDTGQANVSKVVSVPQSVVSNTTSSMYRTNS-MAQMTRCDSPRSIRSAPWPVPNSTGSTKKGTYSVPSPRSVRSAGVGGSSASNRERDWSREHKERKRSASAESNSSVDXXXXXXXXXXXXXKCSDEESEISRSSGRSHHSKRRHKNSSRRGDSGSDSENCXXXXXXXXXXXXXSSSSRYEMVDSEVQ................................................................................................................................................................................................................................................................................................ 530
26 0.000e+00UniRef50_A0A084W5F6 AGAP001632-PA-like protein n=11 Tax=Anopheles TaxID=44484 RepID=A0A084W5F6_ANOSI  ali  17  11........................PGQALLDVVFARLNLIETAYFGIRYIDQDNQTHWLDPAARLSRQLKAGKVAYDLYFGVKFYACDPC-KLVEEITRYQLYLQVKQDILQGRLPVSFELAAELGAYVVQAELGNYDPRKHPPGYVSEFRLLNNQ--------TKEIESRIHELHIQLEGMSPSQAEFNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPGGIVVLRNK---TTVAHYYWPRIAKVYYKGRYFMLRVCDKNNSTYGFETPKKSACKHLWKCCVEHHSFFRLVRVAPMQATTG--TLGSK--YSGRSDRQPMKDGQRIQPTFTRTPSRRQPRRVMHDPQQEDAPKYIQQEIKSVSIPQPAQSIPAALNGSANGGVKAAGPMPPDSPRSTRSAPWMRSQQRNSSPKSVRSASTRMSAPANNTRMRSSSVESHSSNESRSGRRRRHRSRRVSDNESEMSRGSGRSGRSHNSHRKHRRHRSKNRRNRSDTESRDRSYSGHRRSTDSIELVDSGEQWLEVQRK--QHSDAVPKAAVIKSSQVMKGAHPDSGIVQHHQHRSRRHRKHRSPSEKIELTKHLQFDLVDTTGMTEDQLREIPYTVVETNHAAKKPHKTSHHSTTSLEYPKGDGSLGE....................................................................................................................................................................................................... 631
27 0.000e+00UniRef50_A0A194PQ68 FERM domain-containing protein 5 n=14 Tax=Holometabola TaxID=33392 RepID=A0A194PQ68_PAPXU  ali  25  14......CTVRLLEDTLECEFHPGYKGKYLLEHVCQQLNLAEIDYFGLRYVDSAGQRHWLHIAKLILKQV-KDSSPMLFSFRVKFYPPNPL-LLKEDVTRFQIYLQLKRDLLHGRLYCTANEAAMLGALIIQIELGDYDPSIHIGNYVAEMRLLLRQ--------TDAIEARIQELHREVKGLTTQEAERTFLKIACQLDTYGVDPHPVKDHRGNQLYLGINHGGILTFQGGRKTN---HFKWSEVNKINFEGRMFIVHLNYEKKHTVGFKCPSGAACRHVWCCAIEQMLFFTLPSSSDVYSGGGLFSWGTKFKYVGRTEREILERDLAPRDHSEEGSSGGGRRKASSVPATPSTPMTGDFGYSSLPRSTHSAP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 385
28 0.000e+00UniRef50_E2C8J2 Coiled-coil domain-containing protein 132 n=1 Tax=Harpegnathos saltator TaxID=610380 RepID=E2C8J2_HARSA  ali  15  18.PRLLHCKVILLDEELLQDVLSSNLGQELLDRVFKHLNLLETSYFGLRYLDQGNQTQWLDQSKKLGKQLKIHKGDPTLYFGVKFYAADPC-KLIEEITRYQFFLQVKQDILQGRLPVSFDLAAELGAYVVQSELGDYDPRRHSPGYVTEFRFLANQ--------TTELENRIVEIHKTLIGQLPSAAELNYLDKVKWLEMYGVDLHPVLGEDNVEYFLGLTPSGIILLRNKTKVG---NYYWPRINKIYYKGRYFMLRVSEKNERTHGFETPSKGACRHLWKCCLEHQAFFRLMATGPPP-----LSPYSRFHYSPQSTLEKHAAIRRNPPPFQRTPSRRAQRRVVEGQEMVGSFVETPVTVISNPCSNPSSGNVMCNTQRQVNTSSPRSTRSAPWTQSQPRGLYTSSSPRSVRSAGAAPALLSRLQRRSSSVESQSSGDSHSRGGXXXXXXXXXXXXXXXXXDCESELSRGSDTRSGHRKHRRKHR---NSRSSSRHELVDSEPQWREVQKRKGEGVQKAIVSHTEPRRRHRSRHRSPSQKQPLPDELRKHLEFGLVDTSGMSEQQRREISYTVVQSQSVQQSSLQTNNSRLDDIDSSSLPRTVGSIGKRDRRLAPHNRDGS........................................................................................................................................................................................................................ 628
29 0.000e+00UniRef50_N6TVQ5 Uncharacterized protein (Fragment) n=12 Tax=Bilateria TaxID=33213 RepID=N6TVQ5_DENPD  ali  45  15..KSFPVKVCTLDAELEFNLEWRATGRDLFELVCRTIGLRETWYFGLQYEDSKGFISWLN--------IQKSHQTASFMFLAKFYPEEVAEELVQEVTQHLFFLQVKQAILSMDIYCPPEASVLLASYAVQAKFGDFDEDTYKPGMLASEDLLPQRVIDQYQMTLEMWEERIRVWYADHRGMSRDEAEMEYLKIAQDLDMYGVNYFNIQNKKETELWLGVTALGLNIYEKENKLQPKTTFTWSEIRHISFDDKKFIIKPVDKNSPNFVFFSHKVRMNKLILDLCMGNHDLFMRRRKPDSMELQQMKAAAKEEKQRRQVQRNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAEKSRVAEEESTLLSQKAAEAEQEITRLRLTAMRKDEEKVTLERKTRDAELLTARLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLL---DFLSRSTLSGSSPSVTTLYSAPLSPTTMHSELSLLESETSPSPDFNLNINSYDLIAHADAEQLSLEIEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKASEYDQLHEEQVKLGENKYSTLKKSKSGSTKSRVAFFEEL............................................................................................................................................................................................................................................................. 619
30 0.000e+00UniRef50_A0A2R9C985 FERM, ARH/RhoGEF and pleckstrin domain protein 2 n=4 Tax=Theria TaxID=722675 RepID=A0A2R9C985_PANPA  ali  20  42..KHLHLRVKLLDNTMEFDIEPKCDGQVLLTQVWKRLNLVECDYFGLEFQNTQSYWIWLEPMKPIIRQIRRPKN-VVLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYD-ETLDREHLKANAYLPGQ---------QHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEVYGIRFHMASDREGTKIQLAVSHMGVLVFQG-------------------------------PYQDTLEFLLGSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDKRIPYERRHSKTHMSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLPEFKDSSSSLTDPQVSYIKSPAAERSSGAVAGGPDTPSAQPLGPPALQPGPGLSTKSPQPSPSSRKSPLSLSPAFQVPLGPAEQGSSP............................................................................................................................................................................................................................................................................................................................................................................ 475
31 0.000e+00UniRef50_A0A210QRN4 Band 4.1-like protein 4A n=7 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QRN4_MIZYE  ali  18  41......CKVLFLDDTILLPFKGSSKGSVLLDEVYGHLNLVEKDYFGLRYLDTSDQTHWLDNQKSLSSQLKGCSIPYLLYFGVKFYPVDPC-KLKEEITRYQFYLQVKRDIVQGRLPVTFEEAAELFAYAVQSELGDYGQRL-VPGYVSEFRFVPNQ--------TEELEDTISALHKRLSGLRPYQAEAKFLDKVKWLDMYGVDLHPVMGESNTEYFLGLTPMGIVVYKNKTKVG---NYFWPRINKVTFKGKIFIIKVKDKDEHTYAFELMSKLACKHLWKCCVEHHAFFRLRQASDSYARSDYSYRSRSRRASGRHERLSQTENDRRQPNVNRVASKRHQRRTSSDSRL-SAHGEGMPHMAGITVNRIAIPPPDKSTRHNRSLPDLQKGSPKSTRSAPWETDVEAGLYTSGRDSPTSMYSDATRSYHRRVGPPSDTESGYRRKHMYFPNRKGSDNESDVSFSRRRRRDGDSGSESDVSPTRPNHRRPKSSADDWFESQWKEAMEGGGSSVHSAPTEEFAAKRRRRRRSKSPANKKPPEELQQH--FNYDLVDTEGMTEAE-----LQDIPFVQVETKAEPFRVKYSPKTRQRYRSPK................................................................................................................................................................................................................................................ 617
32 0.000e+00UniRef50_A0A2T7NNE8 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NNE8_POMCA  ali  20  82.SRPVICRVLLLDGEVETSIHKKALGSVLYERVCDHLDLLEKEFFGLTYRDPDGTLYWLDVNKTVSHQ--KRRGKWEFEFGVRFFPPDPT-VMKESLSRYLVCLQIRKDIASGKLPCTFATQAVLGSFIVQADLGDWEPEEHGEGYIRDIPFAPDQSV--------ELLEKIAELHKDRKGMTPEEAELQYLEYAKKIALYGIHLHQAKDSDYVDIQIGIGASGISVYRENLRIN---RFVWPKVLKISYRRNKFLLRIRPGEESWIVFKLPSNKLAKRLWKQAVEHHAFLRLREASEAR-RGILPRFGSKYRYSGRTLYEARVNTADRQQPFERTASKQYLN----NNPSRSMDELPTKRPNQLPPHRDPNLSITSADESFDTYTIDSPTERAENSRIIHSRINEEDESRDLHLPDRNTFLGEDNHVTREETVIRQEGDRVVTEIKVEHRFVRREVQKEDDITERLPSPPEEDP............................................................................................................................................................................................................................................................................................................................................................................ 546
33 0.000e+00UniRef50_UPI000B37FA19 FERM, RhoGEF and pleckstrin domain-containing protein 1-like n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=UPI000B37FA19  ali  17  39..RQVSIRVQMLDDTQEFQISQRAPGKVLFDLVCVHLNLTEGDYFGLEYTDHRKMTVWLDLLKPALKQIRRPKNT-ILRFVVKFFPPDHTQ-LMEELTRYLFALQIKRDLACGRLICNDTSAALMVSHIIQSEIGDFD-ETQSWQHLLHNKYLPDQ---------DAIRDKIIDCHRQHNGQTPAESDYQLLEIARRLEMYGVRLYPAKDREGTKLSLTVAHTGVLVFQGYTKINA---FNWSKIRKLSFKRKRFLIKLRADHHDTLEFAMASRDCCKVFWKICVEYHAFFRLFEEPKPKPKPILFTRGSSFRFSGRTQKQIIDHMKDSEVPFERKHSKVLSSSSMSPRSSSFRSQVPRESATSVPLSDQ----PDSARLEARANGTEERPAIAPPTNGFPPDSTLNSDTGRQNHNGAGQHLLNPGPTCRANKGSSSSIPYIDCSDIDSECDAGKSGRAPRGHGANDSNDDDSYRHAGGAGSRDVSLFGVVNGFYHTNQQGVMQQGLPGDRHAVDQTQETFNASQGRASDEVLSNGGSFQSRLPLHSTLLDEIFQGRDKRGAGIVRPLGTGTRSQCSSPVIGSFHPRTNSLSHGEMTNG--HSQPRSASRWDDGGHYFSKRPGHAAVEAPGFPPSS-HPPNHYGSYSPVVSNRTPPPHFTK-----PYNLNNNTRDRSDTDPFILSQLTSTPV.................................................................................................................................................. 711
34 0.000e+00UniRef50_UPI00046B9BFF FERM domain-containing protein 5 isoform X1 n=3 Tax=Aphidinae TaxID=133076 RepID=UPI00046B9BFF  ali  22  13...PIKCTIRLLDDNQLLEFQINEKGSSLISRICEQLDLIEKDYFGLRYVDSKRQRHWLEPSKSIFKQIRDMADNILFSFRVKFYPPNPFR-LKEDITRYQIYLQLKRDLLHGRLYCNTSEAALLGAYILQAELGDFNPEEHIDNYVNELKILLKQTL--------QLEEKMMDIHKNLKGKTAAEMETIFLKKACILDTYGVDPHAVKDQRGNQLYLGINHTGILTFQGSKKMN---HFSWSQVQKINFEGKMFIIHIRIKKKQTIGFKCPRGSSCRHVWKCAVEQMLFFTFPSSSDVPNVGGFFSWGTKFKYSGRVEREILEDMTRESPSVTRVGSLRRKSSSEPPTPSNLVINQVAGFNSLPRSLTNTSEEYNTSIDSSNQIDNSSVLETLLEDQEIMTSKIEQEVHHEE.......................................................................................................................................................................................................................................................................................................................................................................................................................................... 425
35 0.000e+00UniRef50_A0A2A4J485 Uncharacterized protein n=6 Tax=Noctuidae TaxID=7100 RepID=A0A2A4J485_HELVI  ali  25  12......CTVRLLEDTLECEFHPSYKGKFLLEHVCQQLNLTETDYFGLRYVDAGGQRHWLHMAKLILKQV-KDASPILFSFRVKFYPPNPL-LLKEDVTRFQIYLQLKRDLLHGRLYCTANEAAMLGALIIQIELGDYDPNIHVGNYVTEMRLLLRQ--------TDTIEARIQELHREVQGMSTQEAERAFVKIACQLDTYGVDPHPVKDHRGNQLYLGINHSGILTFQGSRK---THHFKWSEVHKINFEGRMFIVHLNYEKKHTVGFKCPNGPACRHVWCCAIEQMLFFTLPSSSDVYSGGGLFSWGTKFKYFGRTEREILERDLAPRDSQKEGSSTGGKRKASSVPATPSTPMTGDFGYSSLPRSTHSAPLEES.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 387
36 0.000e+00UniRef50_A0A2G8L5W6 Putative FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8L5W6_STIJA  ali  19  5..............SLTCFGQHNASGGELFVECCRHINLYELDYFGIEYYSKGNKMVWVEPEKPLTKQVDSPKK-VLFHFSVKFYLADPGQ-LHDEFTKYLFGLQVKKDLANGRLPCSENTAALMASYILQAEVGDYNPVEHEDGYITNFRFVPNQ--------QPSMESKIQEYHKNHIGQTPADADFNLLDVARRLEMYGVRLYPARDYENVQLNLAVCHQGVLVFQSNARIN---TFSWAKIRKVSFKRKRFLIKLHPEPRSTVEFLMGVRNDCKRFWKACVEHHTFFRLSKPGKPRIRNRLMSRGSTFRFSGKTQKQVVETLRTVPPRPSMSLNASRTSSRSLGAPRTTTPLAIDMTETIVSDHQSTPNLTYNYQEGARQNGTPQSESASSPPSSTPVTPKHDNSRITIHKGQSSSSITYEYTVTEDHQRQVSPTETNK-----GGSGDHDVSSAAEESQEAVKQPTANGEAQPAVDAMSSPVLSPSKTITATQESSTPVQDTAQEDENHVKKVKRHPPDKAYFIAKEILTTERTYLKDLEVIVVWFRRAAANEVTQPDMLENLFEH............................................................................................................................................................................................................................................................................ 548
37 0.000e+00UniRef50_Q7Z6J6 FERM domain-containing protein 5 n=401 Tax=Vertebrata TaxID=1261581 RepID=FRMD5_HUMAN  ali  22  15..REYSCTVRLLDDEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQL-RSQPPFTMCFRVKFYPADPA-ALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKH--------SEKLERKIAEIHKTLSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFI---KWNEVTKLKFEGKTFYLYVSQKEEKKITYFAPTPEACKHLWKCGIENQAFYKLEKSSQTVSSSNLFFKGSRFRYSGRVAKEVME----SSAKIKREPPEIHRAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSTSHGDTFLPHVRSSRTDSNERV........................................................................................................................................................................................................................................................................................................................................................................................................................................ 416
38 0.000e+00UniRef50_UPI000D09A17A band 4.1-like protein 5 isoform X1 n=3 Tax=Oncorhynchus tshawytscha TaxID=74940 RepID=UPI000D09A17A  ali  17  362.....................KRSKGQELFDQIRYHLDLVEADYFGLQFMDPEQVSHWLDVSKPIKKQI-RDGPPYRLFFRVKFYSSEP-NNLHEEFTRYLFVLQLRQDILSGKLKCPYDVSVDLGAYCLQSELGDCDPLEHSPELVSEFRFTPKQ--------SETMEADIFNKWVDLRGTDPSQAETSFLNKCKWLELYGVDMHFVKGRDGAEYALGLTPTGILVFEGSTKIG---LFFWPKITRLDFKKSRLTLVVTREQEHTFVFQLDSSKTCKHLWKCAVESHAFFRLRQPTAGKASSSDFRLGSRFRFSGKTEYQATHGGRRRASTFERRPSKRYPSRHSLGGKALSPAKPPHISAHTSPEPSLHPYQRNIPIAHEPWHPALTPPIYLQHSGHTSPHSFPRRGPVGEQQFSVEENETPYSGSIHHRHRRHTHYDSQETYCHTHKNKHRAPPCPVDELEVCLLNPLETDSNTSPWPSLHVNMDNKAEEKQLSEKSLQPSSPCSPPD--------HLKCNIYKAQMEAVYRDAPLTPRGKTCSLEINDRYQSSCQDSRDS----------ATSSLTTEKTSLRPDHNSTTDRHAKSNPNTNRRKRLVRQFSFNHEDEDNLPEALAAISSRSTGKCGSNNSLDNQTQPSIYPQETNTQMDMPILELRSPCRER................................................................................................................................................................... 996
39 0.000e+00UniRef50_A0A146Y457 FERM, RhoGEF and pleckstrin domain-containing protein 1 n=3 Tax=Clupeocephala TaxID=186625 RepID=A0A146Y457_FUNHE  ali  17  37MPRHVTIRVRMLDDTKLFDVSQKASGKVLFDLVCSHMNLIEGDYFGLEFQNQQKMMVWLDHIKPIIKQLRRPKHT-ILRFSVKFFPPDQSQLL-EEMTRYLFALQIKQDLSCGRLICSDTNAALMVSHIIQSEIGDFDDS-HCRSHLLNNNYIPDQMP---------LIDKIMAFHSKHIGQSPAESDFQLLDVARKLDMYGIRMHPAKDLEGTVLSLAVAHMGVVAFQTHTKSNKINTFSWSKIRKLSFKRKRFLVKLRPDLNDTLEFLMASRDCCKIFWKICVEYHAFFRLFEEPKPKKKKVLFTRGSSFRFSGRTQKQLIDYVRESEIPFERKHSRRYNSRVQHNSRLSPLPSPRHHEVPSVSGVPEDRLS-SSPRHHWKESVLVSAEDPAASRTSKISPAHQSNGHEDRQGSVSKTEESRGSTRRTSPEHPSQSAMGCVDSELSMGRDRESRANHSYGEEGVMGRGSGSQQEHFPGKTLYRESPSSSRTSLLMNVETYRSLTRSGPKFDFGPAYSTVGEIRGHNREKQSSSPLPGQRAVGPGSTVTTPAHKPTHRAPSLSHAEQNGHTSPLFNEARCSPHPSRSPRLHNLQKVHHISRTDPQEGASPPGPESRPVMSRAERMAALERRMTANGLSAPGRSRAGKKRSGPVGVKHLGAVQMSEGSTTSGTESSESEGE.............................................................................................................................................................. 737
40 0.000e+00UniRef50_UPI0007DBEB24 band 4.1-like protein 4A isoform X4 n=2 Tax=Euteleostomi TaxID=117571 RepID=UPI0007DBEB24  ali  17  7VPEEFYCEVLLLDETQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAKELINTGPPYTLYFGIKFYAEDPC-KLKEEITVYQFFLQVKQDVLQGRLPCPVNIAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQ--------KEELEEAIERIHKTLMGQIPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGK---YFWPRITKVHFKETQFELRVKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPENESNSLSRKLSKFGSKHRYSGRTALQMSRDLSRPDQNVTRSRSKTYPKRIAQTPAESNSISRITANMENGENEGTTKIIAPSPVKSGLYNSPSDRTKSPKFPYTRRRNPSCGSDNDSVQPVRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESENSNREHRKKRNRIRQENDMVDSAPQWEAVLRRQKEKNQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKELVDPSGLSEEQLK----EIPYTKIETQGDPIRIRHSHS-------------PRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQGSGDVHQRRNGSKDSLME................................................................................................................................................................................................................. 652
41 0.000e+00UniRef50_A0A151M8G9 FERM domain-containing protein 3 n=1 Tax=Alligator mississippiensis TaxID=8496 RepID=A0A151M8G9_ALLMI  ali  18  16...QMKCTVRMLDDEVSCHIQRETKGQFLIDHICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSISKQM-KSHPPYTMCFRVKFYPHEPL-KIKEELTRYLLYLQLKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISDFKIFPKQ--------SQKLERKIAEMHKNFRGQSPAVAEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGFTATGFVVFQGNKRIHLL---KWCDVYKLKFEGKTFYVFAQREKKTMLSFHTSTPAACKHLWKCGVENQAFYKCSSQIKTVSSSKIFFKGSRFRYCGKVAKEVVE----ASSKIQREPPEVHRTSIPQSHSSHSLNKQLIINMEPLQPLLPSPSEEEELPKEDEISVPVIASSPVKDAGESIDFTIEEEEKIKEEPLTISELVYNPSASLLPTPVDENEIDMLFDTPLRAENDKDDTDSFEELEVDENAFLVAEEEELKEARRALRCSYDFLMGNIQVNAFVKSFSRLLLLGRPCREPALQPAPWAGCARQMEDLFDKTSERLQAEIIHETDTPHTQDLKVGRTKTVCSSTGNTPSSKSSAEEQEKSQVEELKMLERESASESDSPSKIKEKKNSQVLIDKKLSETKSKRHWEKSSIAWSSYSHGLKSSSHCIQRPVSAGVGKKR-----VSDLSQSIQLSEGFIRYRQTK..................................................................................................................................................... 712
42 0.000e+00UniRef50_UPI000D734023 FERM, ARHGEF and pleckstrin domain-containing protein 2-like isoform X1 n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=UPI000  ali  18  14..KVISLRVNFLNDTVHFQVPVKAVGLLLWDAVVSHLQLLESDYFGLEYTNHYEDESWLDNNKQILKQLPSADTP--LRFGVKFYMPDPS-MLEEEITRYFFALQVRRDLLLGELHCSENTAALLASYIVQGEIGDFLVDEYRDSYLSSFKFVPQR------QQTVEMLQKVMEYHRQHVGESPSEADSNLLDTARKVEMYGIKFHPAKDHEGVSLNLAVAHMGVLVFQGMTKIN---TFSWAKVRKLSFKRKKFLIKLHPEYKDTVEFFFDTRDRCKYFWKKCIEHHSFFRCTIKKMPRNKTRVVSRGSSFRYSGRTQKELQEYVREKRPIIERSVSGRISSRSTSVTPKISAKPSVHNSSDLHNSTASSGSHILETSSSGLPPIPPTRLETAEIHSDSSMSGSRSLGSPRLEHGLSADSEGGEFINQPVDTAAVDARLPHSDSPDHLHTNNVSATSTPRLSTSGLQAKDRKFSAPVFRSDEEKPDWGDHRLSRTAEVENIPEIVEEEKNDENINSPSRKS............................................................................................................................................................................................................................................................................................................................. 549
43 0.000e+00UniRef50_UPI0007BA7A40 FERM, RhoGEF and pleckstrin domain-containing protein 1-like isoform X1 n=20 Tax=Poecilia TaxID=8080 RepID=UPI0007BA7A40  ali  18  39..RQVSIRVQMLDDTQEFQISQRAPGKVLFDLVCVHLNLTEGDYFGLEYTDHRKMTVWLDLLKPALKQIRRPKNT-ILRFVVKFFPPDHTQ-LMEELTRYLFALQIKRDLACGRLICNDTSAALMVSHIIQSEIGDFD-ETQSWQHLLHNKYLPDQ---------DAIRDKVIDCHRQHVGQTPAESDYQLLEIARRLEMYGVRLYPAKDREGTKLSLTVAHTGVLVFQGYTKINA---FNWSKIRKLSFKRKRFLIKLRADHHDTLEFAMASRDCCKVFWKICVEYHAFFRLFEEPKPKPKPILFTRGSSFRFSGRTQKQIIDHLKDSEVPFERKHSKVLSSSSMSPHSSSFRSQVPKESTTSVLL-----ADQPDSANTNGTEEPPTNGFPDGALNSDPSRQNHNGAGQHLLNPGPTCRANKGSSSSIPYIDCSDIDSECDVGKSGRAPMGHSSANDSNEDEGRDGGLFGVVNGFYHTNHQGLMQQGVMGNRNAEEVLSNGGSFHSRLPLHSTLLDEIFQ--GRDKRGAGVVRPLGTGTRSQCSSPVISSFHPRTSSLSAEMTNGHGQPRAGSRWDDGGHYFSKRPGAVPVEAPAVSPSSQYGSYSPILSNRTPPHPAKPYNLNIMRNRSDTDPTSTPIRRDPYRSGA--ETPSSAPTERKAAIANNLAVPGQARSNAAAQRLFGQKPNNSTSSGTDTSDTESDTGSSAYSQPLLYGNPAAVSS................................................................................................................. 768
44 0.000e+00UniRef50_A0A0R1E6N7 Uncharacterized protein, isoform E n=13 Tax=Acalyptratae TaxID=43741 RepID=A0A0R1E6N7_DROYA  ali  16  8.SRIMSVRINLLDETFIHEIKDDLPGQALLDVVFARLNLIETSYFGIRYIDDENQTHWLDPASRISRQLKPKSDPYDLYFGVKFYAADPCKLL-EEITRYQLFLQVKQDVLQGRLPVAFELAAELGAFVVQSELGDYDQRRHSKGYVSEFRLLPNQ--------SNELETRVSELHQQLKGMSPSSAELNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNK---TTVAHYYWPRIAKVYYKGRYFMLRISDKNNSTYGFETPRKSACKHLWRCCVEHHAFFRQVRVAPLPSSQSLFQLGSRFRHSRQTEKDALSAGR-SPPAFTRTPSKRQPRRVIDDFNSHSHSXXXXXXXXXXXXXXXXASGASGAGTLGGGSHMGNRPLPQPGMGTISNNYDSPYRSTYSIPTSLGIRPCHQQQNNNSSSYNNNSGGNQTPDSPRSTRSAPWPRSQQRSLFGHNPSSPRSVRSASTAGGGLXXXXXXXXXXXXTSHHPHHQSSTAGATSSSSHHHRPQRASSSSASHQQQRYRSSSVESHSSNDSRSTRKHKHRHRRTSDNESELXXXXXXXXXXXXXHHRKHRRSHRHRRDSAGGSDHD------STRGRSYSGHRSSSMRSGSAELIDSTSQWREVQRRQAEASLGQSSVQQAAVSKSSMVARSLNDSHSDTHSHHKSRRHRKNKSP................................................................................................................................................... 693
45 0.000e+00UniRef50_UPI000A2B3E50 FERM, RhoGEF and pleckstrin domain-containing protein 2 isoform X1 n=11 Tax=Sus scrofa TaxID=9823 RepID=UPI000A2B3E50  ali  20  42....LQVRVELLDGTVEFAVEPKCTGQTLLTQVWKRLNLIECDYFGLEFQTLQSRWVWLEPVKPIVRQVRRPKSA-ALRLAVKFFPPDPGQ-LQEEHTRYLFALQLKRDLLEERLTCTDATAALLASHLLQSEIGDYD-ETLDREHLRAHEYLPGQ---------ERALERVLQLHRQHVGQTPAESDFQVLEIARKLEMYGLRFHAAADREGAGISLAVSHMGVLVFQTSPKRTKINTFNWSRVRKLSFKRKRFLIKLHPEYQDTLEFLFSSRDECKRFWKICVEHHTFFRLCDQPKPRAKAVLFTRGSSFRYSGRTQRQLADLVKAKRVPYERRHSKMRAPLRTPTADAPRPSISFTEGLRTPASPPSSDASPPAPPSLLGFQDGFPREPRAPDARWPAAERSGRAGDASRAQPPRLPALQPCQGPSEESPQPPPSTQESPLGPAEQGSTPLLSPAPRVTRMDHKGAP................................................................................................................................................................................................................................................................................................................................................................................. 530
46 0.000e+00UniRef50_A0A2P8YJ41 Uncharacterized protein n=1 Tax=Blattella germanica TaxID=6973 RepID=A0A2P8YJ41_BLAGE  ali  16  34....VQCKVILLDGT-DLSID--------LSQVFYSLDLIEKDYFGLQYTDANNVQHWLDPTKAIKKQV-KIGPPYTLRLKVKFYSSEP-NSLREELTRYQFFLQLKQDIVVGKLECPYQTAVELSALALQSELGDYEEGYHTPAVVSEFRFVPNQ--------TEEMEFAVLDEYKKCRGLTPAQAEMNYLNKVKWLEMYGVDNHIVLGKDGCEYSLGLTPTGILVFEGIQKIG---LFFW----------------------------LHNEKACKHLWKCAVEHHAFFRLRAPVKPSARQNFFRMGSRFRYSGKTEFQTTQQNRRRTVQFERRPSQRYARRQSHVLRERQTNVAASNTNAETSSNNDVAPPVTSSPETSSSSSRQTVRPVEEITSKPNTPSTVPSSANSTCSPAASTISSGVGTLKRSKPVVTTEDHLDTLLKSLVKEPSNNPNTDESLNDAMSTTSSTNKTEDLEAAVGPSPLLVTTVPNNQNTKLSTGARPLPPDQLKCNILKAKVEEELKKTEERSTEKNLLNGRKQQPKSLPLDTLSATFVSVGGDKLTSLSGMVNASESEEVSQIEADDSTTSQKRCTTPVTVTHFSWSDRGKLERVILPSSSSETKNVNADEAQSKKSVPPPLSLVTTSTSSHTVPC....................................................................................................................................................................................... 655
47 0.000e+00UniRef50_F6XXM3 FERM domain containing 7 n=25 Tax=Euteleostomi TaxID=117571 RepID=F6XXM3_MONDO  ali  20  1...MLHLRVQFLDDSQIFMVDQKSSGKALFNSCC-HLNLAEKEYFGLEFRSQSGNNVWLELLKPITKQV-KNPKEILFKFMVKFFPVDPGH-LRDELTRYLFALQIKKDLAQGRLPCSDNCTALLVSHILQSELGDFHEETDRK-HLEQNHYLPNQSG---------LDSKILHFHQRHIGKSPAESDIQLLDVARKLEMYGIRPHPASDGEGTQIHLAVAHMGVLVLRGTTKIN---TFNWAKIRKLSFKRKHFLIKLHTNYKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLFCSKGSSFRYSGRTQRQLLEYGRLKSLPFERKHPSRYRSSPDLLSDVAKQVEDLHLVYSSGCYHSVNGVHASEPTLDSRRRNSTVEVTFAAEFERSKPEADPTLLHQSQSTSVFPFIYTKPTFDTDPEPDDFYRHRSPLNS.......................................................................................................................................................................................................................................................................................................................................................................................................... 440
48 0.000e+00UniRef50_A8JPC8 Uncharacterized protein, isoform B n=93 Tax=Schizophora TaxID=43738 RepID=A8JPC8_DROME  ali  18  8.SRIMSVRINLLDETFIHEIKDDLPGQALLDVVFARLNLIETSYFGIRYIDEENQTHWLDPASRISRQLKPKSDPYDLYFGVKFYAADPCKLL-EEITRYQLFLQVKQDVLQGRLPVAFELAAELGAFVVQSELGDYDQRRHSKGYVSEFRLLPNQ--------SNELETRVSELHQQLKGMSPSSAELNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNK---TTVAHYYWPRIAKVYYKGRYFMLRISDKNLSTYGFETPRKSACKHLWRCCVEHHAFFRQVRVAPLPSSQSLFQLGSRFRHSRQTEKDALSAGR-SPPAFTRTPSKRQPRRVIDDFFXXXXXXXXXXXXXXXXXXXXXSGAGTLGGGSHMGNRPLPQPGMGTISNNYDSPYRSTYSIPTSLGIRPCHQQQNNNSSSYNNNSGGNLQTPDSPRST---RSAPWPRSQQRSLFGHNPSSPRSVRSASTAGGGLXXXXXXXXXXXXTSHHPHHQSSSAGATSSTSHHHRQQRASSSSASHQQQRYRSSSVESHSSNDSRSTRKHKHRHRRTSDNESEL............................................................................................................................................................................................................................................................................... 566
49 0.000e+00UniRef50_K7IXH2 Uncharacterized protein n=5 Tax=Chalcidoidea TaxID=7422 RepID=K7IXH2_NASVI  ali  17  18.PRLLHCKVILLDEELLQDVLSSNLGQELLDRVFRHLNLLETAYFGLRYLDHENQTQWLDPSKKIGKQLKPKKGDLTLYFCVKFYAADPC-KLIEEITRYQFFLQVKQDILQGRLPVSFDLAAELGAYVVQSELGDYDPRRHSYGYVSEFRFLANQ--------TSELEARIVELHKTLVGQLPSAAELNYLDKVKWLEMYGVDLHPVLGEDCVEYFLGLTPSGIILLRNKTKVG---NYYWPRINKIYHKGKYFMLRVSEKNDRTHGFETPSRGACRHLFRCCIDHQAFFRLMATGPPP-----LSPYSRFRYSPPMQQQSSSVRRMAQPSFQRMPSRRAQRRVVEGQEM----VAGFIEGSNNHQVVQGSIGQSTNCLAHGGSVASRNNPSPRSTRSAPWTQSQPRGLYTSSSPRSVRSCGTAPALLNRLNRRSSSVESQSSGDSHSRGHRRRSHSRSHRKHNRHSESQLSRGSTQKSGHRKXXXXXXXXXXXXXXEMVDSAPQWREAQRRKGEIIQRAVISTTEPRRRHRSKHRSPSSKHPLPDELRKHLEFSLVDTSSMSEQQRREI............................................................................................................................................................................................................................................................................ 588
50 0.000e+00UniRef50_UPI00099F5DCE LOW QUALITY PROTEIN: FERM, RhoGEF and pleckstrin domain-containing protein 1-like n=10 Tax=Gnathostomata TaxID=35060 RepID=UPI  ali  20  41MPRHVTIKVRMLDDTEEFDISQRASGKVLFDLVCTHLNLVEGDYFGLEYQDHK-MMVWLDLLKPIVKQLRRPKQ-VVLRFVVKFFPPDHAQLL-EELTRYLFALQIKHDLACGRLTCNDSSAALLVSHIIQSEIGDF-EESQSRQHLLNNSYIPDQM---------ALMDKIMEFHSNNGGQTPAESDYQLLEVVCRLELYGVRLHPAKDREGSKLSLAVAHTGVLVFQGHTKINA---FNWSNVRKLSFKRKRFLIKLRPNYQDTLEFLMGSRDCCKVFWKICVEYHAFFSLFEEPKARPKPVLFTRGSSFRFSGRTQKQVIDYVKDSEIPFERKHSRVQHSRSRPSPLSSPHPQVPKESVSGAPGDRAEVDSPPHRHWKESVNAEDPSALRIRGSPSIQRNVGHGEDRPGPGAEPGPARQPHPDHLNTGVVSNSPHLSASSVNSQAIVNGQKPVELCGHSPDVRQPSPLTSP............................................................................................................................................................................................................................................................................................................................................................................. 510
51 0.000e+00UniRef50_A0A232F3W5 Uncharacterized protein n=3 Tax=Chalcidoidea TaxID=7422 RepID=A0A232F3W5_9HYME  ali  42  15..KSFPVKVCTLDAELEFNLEVRATGRDLFDLVCRTIGLRETWYFGLQYEDSKGFISWLKLDKKVQDQGISQQSTTPFMFLAKFYPEDVAEELVQEVTQHLFYLQVKQAILSMDIYCPPEASVLLASYAVQAKYGDYDEASYQPGMLASEDLLPQRVIDQYQMTPEMWEDRIKIWYADHKTMSRDEAEMEYLKVAQDLDMYGVNYFPISNKKETNLWLGVTALGLNIYEKENKLTPKTTFAWSEIRHISFDDKKFIIKPVDKSSPNFVFFSQKVRMNKLILDLCIGNHDLFMRRRKPDSMEVQQMKAQAKEEKSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADLLAEKSRVAEEEAMLLSXXXXXXXXXKVHLEQKTRDAVRLTEMLVQESEKRALEEKKLKDELLRARIAEKEAKEKLLEFLSRNHYTSAMARCTVDNGIDISFQPVPNLFPSTQVLPSDLQADLQTLQLDSEPLSSEVNCYDLIVDEIEKERIDYLEKSKHLQEQLRDLRTEIAVLKVGEKQCELDQLHEEQVRLGENKYSTLKKVKSGSTKARVAFFEEL............................................................................................................................................................................................................................................................. 685
52 0.000e+00UniRef50_H9J251 Uncharacterized protein n=29 Tax=Neoptera TaxID=33340 RepID=H9J251_BOMMO  ali  24  12......CTVRLLEDTLECEFHPSFKGKSLLEHVCQQLNLTESDYFGLRYVDASGQRHWLHMAKLILKQV-KDASPILFSFRVKFYPPNPL-LLKEDVTRFQIYLQLKRDLLHGRLYCTANEAAMLGALIIQIELGDYDSTIHIGNYVSEMRLLLRQ--------TDAIEGRIQELHREVKGMSTEEAERTFLKIACQLDTYGVDPHPVKDHRGNQLYLGINHSGILTFQGSRKTN---HFKWSEVHKINFEGRMFIVHLNYEKKHTVGFKCPSGAACRHVWCCAIEQMLFFTLSSSSEVYSGGGLFSWGTKFKYVGRTEREILERDLAPREPQEEGSSAGGKRKASSVPATPSTPMTGDFGYSSLPRSTHSAP-LEESGDGAAHLALACCERAPADKPAVCPSEYGMRDSFEHSSSESGVTSQTGPSQ........................................................................................................................................................................................................................................................................................................................................................................................................................... 437
53 0.000e+00UniRef50_J9JZI4 Asparagine synthetase n=9 Tax=Aphidinae TaxID=133076 RepID=J9JZI4_ACYPI  ali  22  13...PIKCTIRLLDDNQLLEFQINEKGSSLISRICEQLDLIEKDYFGLRYVDSKRQRHWLEPSKSIFKQIRDMADNILFSFRVKFYPPNPFR-LKEDITRYQIYLQLKRDLLHGRLYCNTSEAALLGAYILQAELGDFNPEEHIDNYVNELKILLKQTL--------QLEEKMMDIHKNLKGKTAAEMETIFLKKACILDTYGVDPHAVKDQRGNQLYLGINHTGILTFQGSKKMN---HFSWSQVQKINFEGKMFIIHIINEKKQTIGFKCPRGSSCRHVWKCAVEQMLFFTFPSSSDVPNVGGFFSWGTKFKYSGRVEREILEDMTRESPSVTRVGSLRRKSSSEPPTPSNLVINQVAGFNSLPRSLTNTSEEYNTSIDSSNQIDNSSVLETLLEDQEIMTSKIEQEVHHEE.......................................................................................................................................................................................................................................................................................................................................................................................................................................... 420
54 0.000e+00UniRef50_UPI000C790289 band 4.1-like protein 4 n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C790289  ali  23  12.SKSFHVKIILLDQELIQEVQGRTSGQDLLDNIYKHLNLIETAYFGLRYQDNNNQTHWLDPNKKVSQQI-KGVSPITLYLGVKFYAADPC-KLAEEITRYQFYLQVKLDILQGRLPVQEELSTELAALALQSELGDYDGSRHSRGYSSEFRFLATQ--------SEDMEQRIEDIHRRLVGLQPAQAENRYLEKVKWLDMYGVDLHHVIGDDNIEYFLGLTPSGIIVLRNRNKVGNYFCYL-----------CTFSV-LSANEESTYGFETPSRQACKHLWKCCVEHHAFFRLVQVSPAFTTSGVLGLGSRLRSSGRSEKDVSQENRRNPPNFTRVPSQRYSRRNKPEDQDSRSSS................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 346
55 0.000e+00UniRef50_UPI0008FA829C band 4.1-like protein 3 n=1 Tax=Cyprinus carpio TaxID=7962 RepID=UPI0008FA829C  ali  30  38....................QKREKGQVLFDKVCEHLNLLEKDYFGITFRDVENQKNWLDPAKDMKKQI--RGVAWNFSFNVKFYPPEPA-LLSEDITRYFLCLQLRDDIISGRLPCSFATHTVLGSYTVQSELGDYDPDEYGSDYISEFRFAPHQ--------TKEMEEKIMDLHKNYKGMTPAEAEMHFLENVKKLSMYGVDLHHAKDSEGVEIMLGVCSSGLLIYRDRLRIN---RFAWPKVLKISYKRNNFYIKIRPQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRSVEVP.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 304
56 0.000e+00UniRef50_UPI0003C1210D LOW QUALITY PROTEIN: FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Pantholops hodgsonii TaxID=59538 RepID=UP  ali  21  517....LNVRVT--NKTVELDVEPKCDGQVLLTQVWQRLNLIECDYFGLEFQNVQSCWIWLEPMKPIIRQVQRPKSA-VLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCTDTTAALLASHLLQAEVGDYD-EVLDREHLRTHEYVPQQ---------ERALHRILAFHRELAGQTPAESDFQVLEIARKLDMYGIRFHSASDREGAKIKLAVSHTGVLVFQSSTRIN---TFNWSRLRKLSFKRKRFLLKLHPEYQDTLEFVLGSRDECKSFWKICVEHHTFFRLSDQPKPKAKAVLFSRGSSFRYSGRTQKQLADYVKMKRAPYERRHSKAQMSLRALKVDLPRQSISFSEGVKTPVTPLPTTASVPPGPRDFQVGGSSSETGPQAPGVRRPAAERSSVAMAQLPRLPALQPHQGVRPSLSPPITRSLPGLSVESPQPSPSTQRSPPGLSPQGPATQGPSP................................................................................................................................................................................................................................................................................................................................................................................. 984
57 0.000e+00UniRef50_UPI000A2A5A98 FERM, RhoGEF and pleckstrin domain-containing protein 1-like n=1 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A5A98  ali  17  25......IKVCMLDDSVVFDIQAKEKGDVLYKQVYEYLNLEECEYFGLLYYDNNDNMYWLDQHKPINKQV-RDVNKILLRFSVKFYAPDPS-MLQEEYTRYMFALQVKRDLLSGRLKCSESTAALLASYIVQGEIGDFDSLTCRQGYLSDFQFFPDQ--------SQDTESRIAEFHKQHRGLSPSDCDYNLLDVARRLEMYGIILYPARDKDNVELDLAAANMGILVFQSGSKIN---TLSWAKIRKLSFKRKRFLIKLHPEYKDVVEFQMSSRNACKSFWKVAISTHAFFRQSSQSPPKHRPRVFSRGSSYRFSGRTQKQIIEENGRQQPAFNRTQSLKTPSKNNAPRTSQSSRPYGAYGSADTRVLEAAPPVQPIRRPDTPDSEEPPQXLPMQNGDHDESLEELPRDVNG---------PVIKVQSXENPDEDIPLKDLDHEPDMMKDESSSTSSVAGQDLEWQEEVXSEKPPMLNDLNIRYMEPNVEQSNDAVEFTPQPRPPTPIEVDGLESPSPPPPPPEVVLXNDIQATQEEFPAPPMETLPSPPPELLRDSP-EPERMDDSPQPPPLVHTNGFHGDKTTPEPVHIVDSSAIKVQNGELSRHGKGSASDDDRDGRDNVFEDQASPKFRSDTEASPPASPSYLVTLQSEQTLSKSTS.................................................................................................................................................................................. 665
58 0.000e+00UniRef50_T2M572 Band 4.1-like protein 4A n=1 Tax=Hydra vulgaris TaxID=6087 RepID=T2M572_HYDVU  ali  24  10...SFECRILLLDNTQRHTLTNKSFGDELLTKVFVALDLYEREYFGLKYRDRNGQSHWLDPTKLVKKQIQFSIPVYTFYFNIKFYAADPT-KLREEITRYQFFLQIKKDIFQGRIVCDLKTIAELSSYAVQSELGDYEPSIHTGNFISQFRFLPNQ--------TKEFEDQVFEMYRKLRGVTPADAELKFLDRVKWLEMYGVDLHSVKGQDNMEYLLGLSPTGIVLFRSKNKIG---SFIWPKITKLKYKGYCFLLRARNEEEKEYTFLCNDKESAKSLWRCCAEHHTFFRLEKVNDVPASAHLFKKGSKFRFSGRTQQQ-LEKEVDTRPRIQ......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 335
59 0.000e+00UniRef50_A0A1X7RBN3 FERM domain (Protein4.1-ezrin-radixin-moesin) family n=1 Tax=Caenorhabditis elegans TaxID=6239 RepID=A0A1X7RBN3_CAEEL  ali  20  35..RLVCIKVRMLDDTVVFHLGHKAIGQTLLDEVCRHLNLLECDYFGLSFIDINGNHCWLDREKTILRQITNGSTDAKFYFVVKFYTPNPI-DLEEEYTRYLFTMQIKRDLALGELHCSDNTASLLSAYLVQSECGDFSSEDYPDAYLSHTRFVPNQTL--------EFQKKVMDNHRNFIGMTPGESDLAMLEVARRCDFYGVKLHAAKDIDGNDAALSVMHLGIKVFR---QLQLDTTFSWARIRKLSFKRKKLLVKLHPDSKETVEFSFETRDECKNFWKKCVEHHAFFRCVQAEEPKKETRFFSKGSSFRYHGRTQKQLIDYVRKRREPFTRPLRSAASTRKGTYSSTYGLVTDRPTKHRNGSVYEPNQTDPYNKHQNTHSSMPHIAHISSQPADHSFSDIQEP................................................................................................................................................................................................................................................................................................................................................................................................................................................ 437
60 0.000e+00UniRef50_B7QIL1 FERM, RhoGEF and pleckstrin domain-containing protein, putative (Fragment) (Fragment) n=30 Tax=Arthropoda TaxID=6656 RepID=B7QIL1_IXO  ali  22  1......................KAVGRVLFEQVCRVINLLEVDYFGLEYADSTGTKYWLDYEKPMCRQMGLSMVAPVMDFCVKFYTPDPAQ-LEEEFTRYLFSLQIKRDLSLGILQCSDPTAALLASYIVQASCGDYVPEDYPDHYLSTYKFVPHQN--------KELEIKIMDNHKKHVGQSPAESDLNLLETARRCELYGIRMTAAKDNDGLPLNLSVAHMGVIVFQNTTKIN---TFSWAKIRKLSFKRRKFLIKLHPEYKETVEFFFESRNECKNFWKKCIENHAFFRCTEKKTPRQKTRLFSRGSSFRYSGRTQKQIVEYVREKRQPFQRTTAALAKPEDMSDSPPSSSGSSLPRSGSEGSGSSDRAEGSEEEGSRPRAGPEPRPGGRGPCSSRSPSGTERSGGSSEGDVETLGEDEPSDRTATFSEEEETALSGETSARSHGTFSNCLSGPPIWPPWVLLDPSLPETGTPSEYVSSLGPDSPSFRSDTRTNVSGRKYPCEK............................................................................................................................................................................................................................................................................................................................................ 490
61 0.000e+00UniRef50_A0A1W0X945 FERM, RhoGEF and pleckstrin domain-containing protein 1 n=2 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0X945_HYPDU  ali  22  40..KQMQCRVDFLDDQFVFRLPPKTLGQTLFDQVCEHLGLLETDYFGLEYGDTDGNKYWLDLEKPIGRQLAYKAPSLHVHFGVKFYTPDPVQ-LEEEITRYLFVLQIRKDLASGLMPCQDSTAALLAAYVVQAEEGDYSADNYRDTYLLKYKFLPQQDVT--------FLSEVRNSHLQLVGQSPAEADLNFLETARRCEMYGIKLHAANDHENVALNLAVAHMGIVVFQNTQKINI---FSWAKIRKLSFKRKRFLIKLHSEYKDTVEFFFDSRNACKNFWKKCIEHHGFFRCPVQTLPRSKTKIFPAGSSFRFSGRTQKQVLEFARDKRPSFHRTGSSRIRSSQSCGASLAATPLLPMARARDSRYNTTGGTRSRRSQQGENGALARSRSEPMEVTEQVMNPDRSSDSGSRTLERGHRVDASQEMPLSSNEHVPGDYQQQTSIMRTERYEEYRT................................................................................................................................................................................................................................................................................................................................................................................................ 495
62 0.000e+00UniRef50_A0A0A9XWI4 FERM domain-containing protein 3 n=3 Tax=Cimicomorpha TaxID=33354 RepID=A0A0A9XWI4_LYGHE  ali  20  13...SYQCTVRLLDDALECQFSASDKGSNLLDHICEQLNLVEKDYFGLRYVDNARQRHWVDLSKPVMRQI-KDMDPILFNFRVKFYPPDPF-KLKEDITRYHIFLQLKRDLVHGRLYCTQHESSYLAALIIQAEFGDYDPEVHSDNYVAAIKLLLKQ--------TQQIEEKIMEIHQELKGMEPSTAENTFLKKAVTLDTYGIDPHPVKDHKGNQLYLGINYQGILTFQGIFKLH---HFRWPEVNKLKFEGKMFIIHIYREKKHTVGFKCPTVSACRHVWRCAIEQMLFFTVPSSSSIPSVGSIFSFGGKFRYTGRVEKEVLEDNRDDQPSIVRSNSLRVKASSVPDTPMTPLTSDIDSCIIQPTSNESQRFVGDDYLGNENMCDSSSNVISSSDIRGSLSDYFFHESLGHSYSESHLMRVSQRLPRIPKPMPLLPSTIKPVHSTTSVPISSRTPEPLPTSVEPTSLPSSK............................................................................................................................................................................................................................................................................................................................................................................... 476
63 0.000e+00UniRef50_A0A2P2I9D2 C. briggsae CBR-PTP-1 protein n=1 Tax=Hirondellea gigas TaxID=1518452 RepID=A0A2P2I9D2_9CRUS  ali  21  115....IRVEVILLDDSHVFEIQKRAKGQSLLDLVFGHLELLERDYFGLQYRDTHGDKRWLDPLKMVKKQLRLHSRTPVLYFRVKFWVSEPGR-LTEEYTRYHVVLQLRRLLTDGILPAPPTTAALLASYALQSDFGDYNAIEHGTHYLHEAELMPPMPLN--------MRLKLIELHKLHKGQTPADAEFQFLDHAKRIELYGVDIHSAKDSSERDLSLGVTSTGLVVIRNGVKMN---TFSWAKIVKISFKRRHFMIQLRREYESVLVFTLPSYRGCKCLWKSCVEHHTFFRLH-TPRPPPKRQLLALGSKFWYSGRTQHQTLEDTLRAAKTFVRSPSKQASLATLGTTNGAGTNNTGTCSSGTTSKRSMTVGGLRPRSDSVGYRVNSLPATPLAWADNEEEKSAGPSAINGNGESAGLNGSFGSSKDDLPSSGGFYPSTSLSGRPSTPANIPSTTTLSIHPSSTPPSTSKASVSFSSKPSSKISSKETSRDLSKDSPSLPQS................................................................................................................................................................................................................................................................................................................................................ 624
64 0.000e+00UniRef50_F1PNX3 Erythrocyte membrane protein band 4.1 like 4A n=176 Tax=Gnathostomata TaxID=35060 RepID=F1PNX3_CANLF  ali  17  15....................SKSTKGSVVLDHVFRHVNLVEIDYFGLRYCDRSHQTYWLDPARTLAKELINTGPPYTLYFGIKFYAEDPC-KLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGAYAIQAELGDYDPYKHTTGYVSEYRFVPDQ--------KEELEEAIERIHKTLMGQTPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGK---YFWPRITKVHFKETQFELRVKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPESESSSLSRRLSKFGSGYKHRRRTASQRSRELPRPDQNVARSRSKTYPKRAAQTPAGPQGASPGPADAEDGGSGGAARILAPSPVKSFKKAKNENSPDAQRSKSQVPWDENGPQSGLYNSPGDRVKSPKFPSARRRNPSCGSDDSVQPTRRRKAQNSGEDSDLKQRRR----------SRSRCNTSSGSESESSHREHRKKRHRIRQENDMVDSAPQWEAVLRRQKEKTQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKELVDPSGLSEEQLKEIRSYRQYRRSQCSDGERSVLSEMNSKTELVPPLPVTRSSDAQGSGTVHQTRNGSKDSLMEEKSQTSTSNLAGKHTAKTVKTVQASRLRTE................................................................................................................................................................................... 664
65 0.000e+00UniRef50_UPI000C6C70B1 uncharacterized protein LOC111595731 n=1 Tax=Drosophila hydei TaxID=7224 RepID=UPI000C6C70B1  ali  23  65..KKLTVRIQMLDDSITFQVQAKALGRVLFEQVCRQLNLLEADYFGLEYQESTHTKYWLDLEKPMNRQVGLSLIDPVLRFCIKFYTPDPAQ-LEEEYTRYLFCLQIKRDLATGSLQCNDNTAALMASYIVQASCGDYVPEDYPDHYLSSYRFVPHQDAT--------MQRKIMENHKKHFGQSPAEADLNLLETARRCELYGMKMHPAKDVEGVPLNLAVAHMGITVFQNITRIN---TFSWAKIRKISFKRKRFLVKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCTTQSTPRRKTRVLSRGSSFRYSGKTQKQIIEFVREKRQNFQRSQSFRQ-----GPLNASSRSQSHTYVNSSISANPLLPIDTAAWDYRNQCSDSMTPSLTKKAADTLDRRRDNPTDHMRSQVTAAQVEIYQTKNYAAESPTSAEEAACSVERQHHSAAGMDQMNSNRS.......................................................................................................................................................................................................................................................................................................................................................................................... 517
66 0.000e+00UniRef50_A8JQT5 Chondrocyte-derived ezrin-like domain containing protein, isoform G n=30 Tax=Drosophila TaxID=2081351 RepID=A8JQT5_DROME  ali  20  67..KKLTVRIQMLDDSITFQVQAKALGRVLFEQVCRQLNLLEADYFGLEYQESTHTKYWLDLEKPMNRQVGLSLIDPVLRFCIKFYTPDPAQ-LEEEYTRYLFCLQIKRDLATGSLQCNDNTAALMASYIVQASCGDFVPEDYPDHYLSSYRFVPNQDAT--------MQRKIMENHKKHVGQSPAEADLNLLETARRCELYGMKMHPAKDVEGVPLNLAVAHMGITVFQNITRIN---TFSWAKIRKISFKRKRFLVKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCTAQNTPRRKTRVLSRGSSFRYSGKTQKQIIEFVREKRQNFQRSQSFRQGPLNASSRSQSHTYVNSSISANPLLPIDTAAWDYRNQCSDSMTPSLTKKAADTLDRRRDNPIGHMRSQVTAAQVEIYQTKNYAADSPTSQEEAECSAAGAERQHHSAVAMDKLNSNRSLSPQGPQSWTSPSHSSHHQQRGPDPARVHPGDH........................................................................................................................................................................................................................................................................................................................................................... 555
67 0.000e+00UniRef50_A0A0F8CVH6 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Larimichthys crocea TaxID=215358 RepID=A0A0F8CVH6_LARCR  ali  20  48..RALQIRVQGLDDSQEFDVDPKAFGQALLSDVFLRGNLIESDYFGLEYQNMQMNWVWLEPTKPIAKQVRRPANTL-FRLSVKFFPPDPGQLLQEEYTRYLFSLQMKRDLMEGRLFCTENTGALLASHLVQSEIGDYD-DVADRDFLRTNKLLPYQ---------EKVQEKIMELHRRHLGHTPAESDFQILEIARKLEMYGVRFHPAADREGTKINLAVSHMGLQVFQGNTKIN---TFNWSKIRKLSFKRKRFLIKLHPEHQDTLEFMMASRDQCKIFWKICVEYHSFFRLFDQPQPKSKAILFTRGSSFRYSGRTQKQLVEYVRENGAK--RTPYQRRNSKIRMSARSIATDVPKQTLSFNDSLRAPGSPSSATVSFYPAHISSIHPRTEHQPQLQPLSALSQSPAPHQQHQLQHLQSPLQATRPPSPPMEEPLKAASPSHYAFQGAPSNQAAGHCSPLFVCVESGTSQSQP............................................................................................................................................................................................................................................................................................................................................................................ 550
68 0.000e+00UniRef50_A0A2J7QHA6 Uncharacterized protein n=5 Tax=Blattodea TaxID=85823 RepID=A0A2J7QHA6_9NEOP  ali  25  1............................................................MDKRIAKFV--KNEPWKFNFEVKFYPPDPAQ-LQEDITRYQLCLQIRNDILMGKLPCSFVTHALLGSYLVQSEIGDYDADEHGRNYLKDFRFAPNQ--------TPGLEEKVMDLHRTHKGQTPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDRLRIN---RFAWPKILKISYKRHNFYIKIRPQYESTIGFKLANHRAAKKLWKVSVEHHTFFRLMTPEPTQKTGLFPRFGSKFRYSGRTHYET------KKSLIERPAPRFERSLSGRGLTSRSMDALAPRQTEEDFNKRHTMSHPPEHIPDMEH....................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 309
69 0.000e+00UniRef50_W5KSI8 FERM, ARH/RhoGEF and pleckstrin domain protein 1 n=94 Tax=Euteleostomi TaxID=117571 RepID=W5KSI8_ASTMX  ali  24  1..........MLDESEEFDISQRASGKVLFDLVCAHLNLIEGDYFGLEYQDQRKMTVWLDLLKPIMKQLRRPKHT-VLRFVVKFFPPDHAQ-LMEELTRYLFALQIRQDLATGRLTCTDSSAALLVSHIIQSEIGDYEEAQCRQHLLNNN-YIPDQM---------ALMDKIMEFHQKHVGQTPAESDYQLLEVARRLEMYGIRLHPAKDREGTKLSLSVAHTGVLVFQGHTKINA---FNWSKVRKLSFKRKRFLIKLRPDYQDTLEFVMASRDCCKVFWKICVEYHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVIDYVKDKKLPFNRKHSRVQFNSSLSPLPSPLHSQVPNQESALVSSEDSAALRMRGSPSTAGQRGGRSDGGSAATDDSR....................................................................................................................................................................................................................................................................................................................................................................................................................................................... 384
70 0.000e+00UniRef50_B4NG31 Uncharacterized protein n=7 Tax=Drosophila TaxID=2081351 RepID=B4NG31_DROWI  ali  15  8.SRIMSVRINLLDETFIHEIKDDLPGQALLDVVFARLNLIETSYFGIRYIDEENQTHWLDPASRISRQLKPKSDPYDLYFGVKFYAADPCKLL-EEITRYQLFLQVKQDVLQGRLPVAFELAAELGAFVVQSELGDYDQRRHSKGYVSEFRLLPNQ--------SSELESRVSELHQQLKGMSPSSAELNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNK---TTVAHYYWPRIAKVYYKGRYFMLRISDKNLSTYGFETPRKSACKHLWRCCVEHHAFFRQVRVAPLPNSQSLFQLGSRFRHS-RTDKQTEKDALRPSPAFTRVPSKRQPRRVIDDFFNSNRANGGVGGVTNSIL--NRPLPQPQLQVQSPNYDSPYRSTYSIPTSLGVRPCHSQQQNNNSSSYNNNGGGSSLQTPDSPRSTRSAPWPRSQQRSLFGHNPSSPRSVRSVSTAXXXXXXXXXXXXXXXXXTSHHPXXXXXXXXXXXXXXRQQRASSSSASHQQQRYRSSSVESHSSNDSRSTRRHKQRHRRTSDNESELSRGSGRSGRSHHRKHRRSHRHRRDSAGGSDDSTRGRSYSGHRSSSMRSGSAELIDSTTQWREVQRRQAEASLGQSSVQQAAVSKSSMVARSLHSNDSHSDTHSHHKSRRHRKNKSPSESRSRM...................................................................................................................................................................... 673
71 0.000e+00UniRef50_B4QSL8 GD21572 n=2 Tax=melanogaster group TaxID=32346 RepID=B4QSL8_DROSI  ali  18  53.PRTLLC----FNSNFLVYFQDDLPGQALLDVVFARLNLIETSYFGIRYIDEENQTHWLDPASRISRQLKPKSDPYDLYFGVKFYAADPCKLL-EEITRYQLFLQVKQDVLQGRLPVAFELAAELGAFVVQSELGDYDQRRHSKGYVSEFRLLPNQ--------SNELETRVSELHQQLKGMSPSSAELNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNK---TTVAHYYWPRIAKVYYKGRYFMLRISDKNNSTYGFETPRKSACKHLWRCCVEHHAFFRQVRVAPLPSSQSLFQLGSRFRHSRQTEKDALSAGR-SPPAFTRTPSKRQPRRVIDDFFXXXXXXXXXXXXXXXXASGAGTLGGGSHMGNRPLPQPGMGTISKLYYQSTHPHEANGGPGAGGHAPKNGSIRSASTISSRECERNNGLVRMMSSMSMGDFISPTGSNLSPLENSALRVSHEHTDSGLGADQDYAYSSERSSDSTR........................................................................................................................................................................................................................................................................................................................................................ 538
72 0.000e+00UniRef50_H2V5I0 FERM, ARH/RhoGEF and pleckstrin domain protein 1 n=6 Tax=Euteleostomi TaxID=117571 RepID=H2V5I0_TAKRU  ali  26  1......................KASGKVLLDLVCSHMNLIEGDYFGLEFQNHQKIIVWLDHIKPIIKQLRRPKHT-ILRFAVKFFPPDHAQLL-EELTRYLFALQIKQDISSGRLTCNDTSAALMVSHIVQSEIGDFEESKC-RSHLLNNNYIPDQMP---------LIDKIMDFHSRHIGQTPAESDYQLLEVARRLEMYGIRLHPAKDREGTRLSLTVAHTGVLVFQGHTKIN---SFNWAKVRKLSFKRKRFLIKLRPDYQDTLEFLMASRDCCKVFWKICVEYHAFFRLYEEPKRKPKPVLFTRGSSFRFSGRTQKQVIDYVKESEIPFERS....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 306
73 0.000e+00UniRef50_A0A090LH12 Yurt gamma n=6 Tax=Strongyloidoidea TaxID=2082224 RepID=A0A090LH12_STRRB  ali  25  83..KEILCTISLLDGTVDFIINKKSDGKELYDLVYYSLDLEEKDYFGLCYKDHSGVQIWLDPLKKINKQVDENQSKFKFDFRVKFFSSDPSH-LREELTKYQFFLQLKNDIEKGKLECDKQTAIDLAAYCLQSECGDYDPYKHSPAFVSEFRFYPKQD--------EEMEIAILERYKRCRGQTPAQAEMNYLNRAKELQMYGVDRHIVQGKDGNNYKLGLTPTGMLVADGEQMIG---FFRWECMQKLDFKNKKISLVVEDDDGHTFVFNLTSHKACKHLWKCAIEYHTFYRLKFHKTSKPKTQLFRLGSTFKYRGRTEYENVHRSRRCTSTFERKPSQRQPPRQS............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 430
74 0.000e+00UniRef50_A0A182E9I5 Uncharacterized protein n=2 Tax=Onchocercidae TaxID=6296 RepID=A0A182E9I5_ONCOC  ali  17  27..KLMCIKVRMLDDSVVFHLGHKALGQALFDEVCRHLNLLECDYFSLEFTDCYGNRCWLDKDKPILRQITTTHSDARFYFIVKFYTPNPA-DLVEEYTRYLFALQIKRDLAMGELICNENTAALLASYIVQSDCGDFAAEDYPDDYLSSARFIPNQ--------SSTFQKKVMENHKKLIGMSPGESDLTLLETARRCDFYGVKLHAAKDVEGTEISLTIAHMGIRVFH---QFQCVSTFSWAKIRKLSFKRRKLLIKLHPEYKETIEFLFESRNECKNFWKKCVEHHTFFRCIEPMKRTREGRFFSKGSAFRYQGRTQKQLIDYIRKRREPFTRPIKSGLSSSTNGRLSRPAYFETNHPAYATVSERSVNLIGSG----TLPSRNVPIPPNKYGTTASIRNHRHRYSQNYPSNSSAVAVNGERMCLSDMESNDLCSLAGGGTMNSRYRQQQSDFRSLKSSNVKSVKTGAIAVPSNSGNITDTSDNDAITSVSLPNVGDDVQIACHEFELKCECPPKSASGDNFELHQPPRDYDNTSEGSYKLSDNELRSAHSDIQPVPVNPVYATTFTAKRVGNVKKVVSNTRSTPNTTDDEDPYSERRLDSGRRKIETERIQQKTLEHVYRQESSESNQVEID-DANSQRRFYVEKKHSSSAPASYAEYPLHQKLVPIEIDGPNVNLDEHKKLSSKKE..................................................................................................................................................... 712
75 0.000e+00UniRef50_B8JLE7 FERM domain-containing 3 (Fragment) n=13 Tax=Gnathostomata TaxID=35060 RepID=B8JLE7_DANRE  ali  24  18....LQCTVRLLDDEISCSIQRDTKGQFLVDHVCNHYSLLEKDYFGIRYVDPDKQRHWLDPSKPVVKQM-KCQQPYTMCFRVKFYPQEPI-KIKEELTRYLLYLQLKRDVYHGRLLCPFADAAYLGACIVQAELGDYDPEEHPADYISDFKLFPKQSLK--------LERKIMEIHQNLRGQCPSLAELNLLQRAHTLDTYGVDPHPCKDFTGSTAFLGFTARGFVVFQGNKRIHLL---KWADVSKFKFEGKTFYV---IGKKLVLTFHTSTPAACKHLWKCGVENQAFYKCSSQIKTVSSSSIFFKGSRFRYSGRVAKEVIE----ASSKIQRDPPVVHRCQFGQSRSFTSLSHKQLIMNMEPLLPA...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 366
76 0.000e+00UniRef50_A0A096N6X5 FERM, ARH/RhoGEF and pleckstrin domain protein 2 n=37 Tax=Euteleostomi TaxID=117571 RepID=A0A096N6X5_PAPAN  ali  21  42..KHLHLRVKLLDNTVEFDTEPKCDGQILLTQVWKRLNLVECDYFGLEFQNTQSYWIWLEPMKPIIRQIRRPKN-VVLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYD-EMLDREHLKANEYLPGQ---------QHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDREGTKIQLAVSHMGVLVFQGTTKIN---TFNWSKVRKLSFKRKRFLIKLHPEYQDTLEFLLGSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRY--------------------RRHSKTHMSIRALTADLPKQSISFPEGLRTPASPSSANTSYSLSPSTLVPPGLPEFKDSSSSLTEPQVSYIKSPAAERSSGAVAGGPDTPSAQPVGPPALQPGPGLSTKSPQPSPSSRNSPLSLSPAFQVPLGPAEQGSSP............................................................................................................................................................................................................................................................................................................................................................................ 485
77 0.000e+00UniRef50_UPI0004435D13 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Monodelphis domestica TaxID=13616 RepID=UPI0004435D13  ali  22  49..KDLPIKVRLLDNTTEIHVEPKCYGQILLTEVFKHLNLIESDYFGLEFQNVQSYWIWLEPTKPIIKQVQRPRSTL-LRLAVKFFPPDPGQ-LQEEYTRYLFALQIKRDLVEERMPCSDSTAALLTSHLLQMLVGDY-EEVTDREHLKTNKYVPHQDRIQ---------ERILENHQKHVGQTPAESDFQVLEIARKLEMYGIRFHLASDREGTKINLAVSHMGVLVFQGNTKIN---TFNWSKVRKLSFKRKRFLIKLHPEHQDTLEFLLGSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQRQLVDYVKDKKTPYERRHSK---ARIASRPLSKDGPKQSISYTEGSRLPGSPCSSDASFHPGPAADLPPCMDSSRAFVASKAPLAERSSGPSAEEAEQKAGPP................................................................................................................................................................................................................................................................................................................................................................................................................................. 458
78 0.000e+00UniRef50_A0A091IET4 Merlin (Fragment) n=13 Tax=Tetrapoda TaxID=32523 RepID=A0A091IET4_CALAN  ali  62  1....................QVKWKGKDLFDLVCRTLGLRETWFFGLQYT-IKDTVAWLKMDKKVLDHDVPTEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPNVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPDNRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQM...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 284
79 0.000e+00UniRef50_A0A1D5PPC8 Erythrocyte membrane protein band 4.1 like 4A n=11 Tax=Sarcopterygii TaxID=8287 RepID=A0A1D5PPC8_CHICK  ali  17  3.....................KSTKGSVVLGYVFRHLNLVEIDYFGLRYCDRNHQTYWLDPAKTLAKELINTGPPYTLYFGIKFYAEDPC-KLKEEITRYQFFLQVKQDILQGRLPCPVNTAAQLGAYVIQSELGDYDPYKHTAGYVSEYRFVPDQ--------KEELEDAIERIHKTLMGQVPAEAEANYLEVAKSLEMYGVDLHPVYGENKSEYFLGLTPIGVVVYKNKKQVGK---YFWPRITKVHFKETQFELRVKDCNETSFFFEARDKITCKHLWKSCVEHHTFFRMPENESNSLSRKFSKFGSKHRYSGRMSFQMT---RDPSIQLPRPDQCIERSRSKTYPKRTQQTGSSGINQITTDNEGTTKIIAPSPVKSFKKMKNENSPETQRSKVSAPWEENGQQSGLYNSPSDRNKSPKFPYSRRRNPSGGSENECGQPVRRRKTQNSGEDSDLKHRRR---------SRSRCNTSSGSESENSNREHRKKRNRLRQENDMVDSAPQWEAVLRRQKEKTQADPNY...................................................................................................................................................................................................................................................................................................................... 495
80 0.000e+00UniRef50_UPI000972313D microtubule-associated protein futsch isoform X3 n=1 Tax=Musca domestica TaxID=7370 RepID=UPI000972313D  ali  16  66..KKLTVRIQMLDDTVTFQVQAKALGRVLFEQVCRQLNLLESDYFGLEYQEKATQKYWLDLEKSLNRQVGLSLVDPMLRFCVKFYTPDPSQ-LEEEYTRYLFCLQIKRDLATGSLQCNENTAALMASYIVQASCGDYVAEDYPDHYLSSYRFVPNQD--------EAIQIKIMENHKKHVGQSPAEADLNLLETARRCELYGMKMHPAKDHDDMPLNLSVAHMGIAVFQNLTRIN---TFSWAKIRKISFKRKRFLVKLHPEYNNTVEFLFPGRNQCKNFWKKCVENHGFFRCTVQSTPRRKARVMSRGSSFRYSGRTQKQIIDFVREKRQNFQRSQSFRQ-----GPLNASSRSQSHTYVNSSISANPLLPIDTAAWDYRNQCTDSMTPSLTKRAADTLDRRQDNPTDRKHSQVTAAYQTKNYASESPTSAEQLHHSATGVPADHQMNVNRSASPPGPQSWTSPQHSNNTTQHLTHQPQRGHDQARVHQSDHNLGLSHLSHLYPRRVSVASQAFVPVSPPLQHSNNNNVNTITTNNSSNNINNNTNNYLRSITTNTVGLSVDLSSSMELDQEEEEEELELEDQEPDLHMVDQQHQVELLESDLPEEEVDSDLTQSTINRESMHTAVSAVGPASSAVVATIIAPPPP-HRLPESPSHMEPGAAAAVATHYSSTSYSMSK................................................................................................................................................................ 743
81 0.000e+00UniRef50_A0A1S4F3N8 Uncharacterized protein n=6 Tax=Culicoidea TaxID=41827 RepID=A0A1S4F3N8_AEDAE  ali  23  32......VTVLFLDETHTFQLEKKAKGSDLLELVFRHLELSERDYFGLQFQSSNGKRRWLDPNKPFRKQWNSGDISPVLIFRVKFYITDPSR-LCEEYTRYQFYLQIKRDIFQGKLPVALNTACLLASYTVQSELGDYNPLEHTHGYLSDLQLLPEQN--------EEAEHRISELHKLHRGQLPADAEYNYLEHAKRLDMYGIDSHRATDSAGKELSLGVSSIGLLVYQNGIRIN---TFSWSKMVKVSFKRKDFFIQLRREYDTLLGFNMGAHRNAKSLWKACVEHHSFFRLQRPHRSPRFLPL-TLGSKFHYSGRTELQAVQESRQRCKIFIRSPSKRQLAVSQPQSPLSSNGTANNKNQLSLLSLTKATRAYDKVTSKTPSIPRKAWEQQSDDPTFIEHCARTYDSQVPTMFDSPP.................................................................................................................................................................................................................................................................................................................................................................................................................................... 482
82 0.000e+00UniRef50_A0A158NWC3 Uncharacterized protein n=3 Tax=Hymenoptera TaxID=7399 RepID=A0A158NWC3_ATTCE  ali  20  18.PRLLHCKVILLDEELLQDILSSNLGQELLDRVFKHLNLLETSYFGLRYLDHGNQTQWLDQSKKLGKQLKIHKGDPTLYFGVKFYAADPC-KLIEEITRYQFFLQIKQDILQGRLPVSFDLAAELGAYVVQSELGDYDPRRHSPGYVTEFRFLANQ--------TTELENRIVEIHKTLIGQLPSAAELNYLDKVKWLEMYGVDLHPVLGEDSVEYFLGLTPSGIILLRNKTKVG---NYYWPRINKIYYKGRYFMLRVSEKNERTHGFETPSKGACRHLWKCCLEHQAFFRLMATGPPP-----LSPYSRFHYSPPSTLEKHAGIRRNPPPFQRTPSRRAQRRVVEGQEMVGSFVETPVTVISNPSNNPSSGNILCNTQRQINTSSPRSTRSAPWTQSQPRGLYTSSSPRS........................................................................................................................................................................................................................................................................................................................................................................................................................................... 420
83 0.000e+00UniRef50_A0A0N4U692 Uncharacterized protein n=1 Tax=Dracunculus medinensis TaxID=318479 RepID=A0A0N4U692_DRAME  ali  20  44..KLMCIKVRMLDDTVVFHLGHKANGQALFDEVCRHLNLLECDYFGLEFTDCFGNRCWLDKEKAILRQITSTRSNARFYFIVKFYTPNPA-DLEEEYTRYLFALQIKRDLASGELLCNENTAALLASYIVQSDCGDFSSEDYPDHYLSSAHFIPNQNT--------DFQQKVMENHSKIIGMSPGESDMAFLETARRCDFYGVKLHPAKDVEGTDVSLTVAHMGIRVFHL---LQCVSTFSWAKIRKLSFKRRKLLIKLHPEYKETIEFSFDGRNECKNFWKKCVEHHAFFRCIESRKKGKEGRFFSKGSSFRYHGRTQKQLIDYVRKRREPFTRPLKPSLSSRSDRFSRPPDINTGYSVVGDRLLNTSREPRPVFPSTSDGNSVASIQRVNGHQAMDGTGSIRIDYHPRIIHTHSQPNTARSQRNRPSDSYRNGTYSDGERMCTSDMESSTYRIVNNSSR.......................................................................................................................................................................................................................................................................................................................................................................................... 509
84 0.000e+00UniRef50_A0A2I4AU56 FERM domain-containing protein 5 n=10 Tax=Euteleostomi TaxID=117571 RepID=A0A2I4AU56_9TELE  ali  22  15..REYNCTVRLLDDTYTCTIQRDAKGQYLFDLICHHLNLLEKDYFGIRYVDPDKQRHWLEFTKSIAKQL-KSQPPFTMCLRVKFYPPDPA-SLKEEITRYLVFLQLKRDLYHGRLLCKTSDAAMLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKH--------SEKLERRIAEIHKTLIGQTPETSERNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNRRVH---FLKWNEVTKLKFEGKTFHVYANQKEDKKITYFAPTPEACKHLWKCGVENQAFYKLEKSSQTVSSSNLFFKGSRFRYSGRVAKEVMEQ----SAKIKREPPEIHRAGLVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSVSH........................................................................................................................................................................................................................................................................................................................................................................................................................................................... 397
85 0.000e+00UniRef50_A0A147AM47 FERM, RhoGEF and pleckstrin domain-containing protein 1 n=62 Tax=Euteleostomi TaxID=117571 RepID=A0A147AM47_FUNHE  ali  21  39..RQVSIRVQMLDDTQEFQISQRAPGKVLFDLVCVHLNLTEGDYFGLEYTDHRKMTVWLDLLKPALKQIRRPKNT-ILRFVVKFFPPDHTQ-LMEELTRYLFALQIKRDLACGRLICNDTSAALMVSHIIQSEIGDFD-ETQSWQHLLHNKYLPDQ---------DAIRDKIIDCHRQHNGQTPAESDYQLLEIARRLEMYGVRLYPAKDREGTKLSLTVAHTGVLVFQGYTKINA---FNWSKIRKLSFKRKRFLIKLRADHHDTLEFAMASRDCCKVFWKICVEYHAFFRLFEEPKPKPKPILFTRGSSFRFSGRTQKQIIDHMKDSEVPFERKHSKVLSSSSMSPRSSSFRSQVPRESATSVPLSQPDSARLEARANGTEERPAIAPPTNGFPPDSTLNSDTGRQNHNGAGQHLLNPESLEAKESPHESPRVVANGSGPGDGETGVAGMEDVGPIPEGQPLSPLTSP................................................................................................................................................................................................................................................................................................................................................................................. 501
86 0.000e+00UniRef50_UPI000A2BFCF8 band 4.1-like protein 4 n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=UPI000A2BFCF8  ali  16  9..KNYQCTIVLLDETDFVEIESATKGEELLDKVYKRLNLIETAYFGLRYLNKGGESRWIDPLIKVSKQ-FKGISSLTLYFGVKFYASDPCKLL-EEITRYQFVLQLKQDILQGRLPLTRDLAVELFALSLQAELGDYDPRKHHKLYVSEFRFCPDQDA--------ELEDRVEQIHKTLVGKVPSAVEMTFLEKVKWLDMYGVDLHRVQGDDHVEYFLGLTPSGVIVMKSKKRM---SNYFWPRISKVFFKGKYFMIRVRDKDEMTYGFLLPSRESCEYIWRCCVEHHAFFRLTQVKDSGNPMQIFRLGSKYRYSGRTEQQVRNETKQIRRPPPPIVRVPSRRFQKRLGEPDGADADVMEKEKDDMALVQVITSVPLYRSVSTPAGLSAAHQQQANDVNPWEDPNHRHKSHHRRSSSVDSQTSTDSRHRRRHHRSKRSSDNESEISKSSRGSRSSKNGTSHRKARHHSRESGSDSDSHHRSRRRKHSSSRRRENSYHLVNSESQWKQVQKQQREKERLQNAVVRDLSNRKSGYLNSGIDTESEAPAQRRKKHRSNPIISQEVKKHLQYRLVDPVNEEERRDIKETETNGFKIRYSPTSGKPRYKVSKVSSRTSLDTLSRRSTCDEDPPPPYSVNLSPNGKCPETNNGVSHLNIVPLSNNKSKRHSKEI-------NQNKLQKEMIHSQMKSEDSCHKMKKINSLNTTNRQKTST............................................................................................................................. 751
87 0.000e+00UniRef50_H3A4W4 Erythrocyte membrane protein band 4.1 like 2 n=4 Tax=Sarcopterygii TaxID=8287 RepID=H3A4W4_LATCH  ali  17  5..........................................................................PWQFAFNVKFYPPDPSQ-LTEDITRYFLCLQLRQDIATGRLPCSFVTHALLGSYTLQAELGDYDPEEQRTDYVSEFQFSPNQ--------SKELEEKVIELHKTHRGQTPAQADSHFLENAKKLSMYGVDLHHAKDSEGVDIMLGVCANGLLIYKDRLRIN---RFAWPKILKISYKRSNFYIKIRPQFESTIGFKLPNHRSAKRLWKVCVEHHTFFRLV-SPDQPPKAKFLTLGSKFRYSGRTQAQ----SRKASTLIDRPAPYFERTSSKRVSRSLDGAPVGSITDQSLLKVSPATEATSEGVPAVTPHLELPKDTQSNSLRIEGENIYVRHSNLMLEDLDRTQEDVLKHQASISELKRSFMESTPTPRPNEWEKRLVTPLSLQTQGSADEKLKSETEEQAEVVIEEAVIIEEVKKTLPAVEQVRKENTSSSENSSESEDEAEYHPQTKVATDELXXXXXXXXXXXXXXXXXXXXXASSERPAVSLMEVKQVPD--SVPLENKIEEVPTKVENVLEETNEKNGEEREQPKVNGDMPHIDVTATEIICCSEPPVVKTEMVTISDSAQKTEVATKEVPIV--HTETKTITYEAAQVDGSGDS................................................................................................................................................................... 619
88 0.000e+00UniRef50_A0A1A8EXK8 Erythrocyte membrane protein band 4.1 like 4B (Fragment) n=2 Tax=Cyprinodontiformes TaxID=28738 RepID=A0A1A8EXK8_9TELE  ali  24  70....ITCRVLLLDGSVSVDLPSKSKGQDLFDQIMYHIDLIEMDYFGLQFMDSDQVSHWLDMSKLIKKQIQ-DGPPYRLFFRVKFYSSEP-NNLHEEFTRYLFVLQLRQDILSGKLKCPYDTSVELAAFCLQSELGDCDPLEHSPELVSEFRFTPKQ--------SEAMEADIFSRWLELRGQSPSQAEISFLNKCKWLELYGVDMHFVKGRDGGEYALGLTPTGILVFEGSNKIG---LFFWPKITRLDFKKSRLTLMVVREQEHTFIFQLDSAKNCKHLWKCAVESHAFFRLRQPTTGKAHSDFTRLGSRFRFR............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 375
89 0.000e+00UniRef50_A0A0K0F8U4 Band 4.1-like protein 4A (inferred by orthology to a human protein) n=1 Tax=Strongyloides venezuelensis TaxID=75913 RepID=A0A0K0F  ali  24  30...TLSCTIYFLDDTRSFTIGKGSIGQEILDKVFEHLELVERDFFGLQFLSEHPRMRWLDPQKSIKKQMV--CPPFHLYFRVKFYVSDPS-KLAEEYTRYHFFLQVKRDLLEGRLLCPESSAALLASYAIQSEMGDYN--VNDNEYIDNFKIIPNQSC--------DLSKQIKELYKLHAGQTPAVAEYNFLDHAKRLDMYGVDLYEAHIEEGIQILVGVNSYGICLFQNGQKINA---YPWCSIMKLTFKKKVFNVELNEEEDKAFFFHIITSQSCKLLWKSCIEHHTFFRLIAPPIPPPKS-IFSLGSRYRYSGRTEFQTMEEMKRRERAFLRANSR.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 364
90 0.000e+00UniRef50_UPI000C71B961 band 4.1-like protein 4A n=1 Tax=Lucilia cuprina TaxID=7375 RepID=UPI000C71B961  ali  15  8.SRIMSVRINLLDETFIHEIKDDLPGQALLDVVFARLNLIETSYFGIRYIDEENQTHWLDPASRISRQLKPKADPYDLYFGVKFYAADPC-KLVEEITRYQLFLQVKQDVLQGRLPVAFELAAELGAFVVQSELGDYDQRRHSKGYVSEFRLLPNQ--------SSELETRVAELHQQLKGMSPAAAELNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNK---TTVAHYYWPRIAKVYYKGRYFMLRISDKNNSTYGFETPRKSACKHLWRCCVEHHAFFRLMRVPPTLPNSPIFQLGSRLKFSRKTVKEKSSKDSRSPPAFVRVPSKRQPRRIMDDF-LNGCKKSEQFGGSSAFLNAKNASNYESPYRSTYSIPTSLGINPYHQQSQHTMPHSQSNYNNSNGVGGSHIQTPDSPRSTRSAPWPRSQQRSLKPSSPRSVRSASTTGGGGANGVDGRGGSSNHHHHHSQHNTHSRSSQRDHVTSANGTTNSQQQQRYRSSSVESHSSNDSRSTRRHKHRHRRTSDNESELSRGSGRSARSHHRKHRRSRHRRDSAGSEHE----STRGRSYSGHRSSTARSASAVGSHSELIDSSSQWREAQRRQQ--EASLGQSSVQQASVSKSSMVARSLHSNDSHSDTHSHHKSRRHKKNKSPSDR.......................................................................................................................................................................... 671
91 0.000e+00UniRef50_UPI0009A0893A LOW QUALITY PROTEIN: FERM, RhoGEF and pleckstrin domain-containing protein 1-like n=1 Tax=Oncorhynchus kisutch TaxID=8019 RepI  ali  17  34MPRHVSIKIRMLDDTEEFDVSQRASGKVVFDLVCTHLNLVEGDYFSLEYQDHHKMMVWLDLLKPIVKQLRRPKHT-VLRFVVKFFPPDHTQLL-EELTRYLFALQVKHDLACGRLACNDSSAALLVSHIIQSEIGDF-EESQSRQHLLNNSYIPDQV---------ALIDRIMEFHSKNVGQTPAESDYQLLEVARRLELYGVRLHPAKDREGSKLSLAVAHTGVLVFQGHTKINA---FNWSKVRKLSFKRKRFLIKLRPDYQDTLEFLMGSRDCCKVFWKICVEYHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQKQVIDYVKDSEIPFERKHSRVQHSSSRLSPLPSPHRPQVPKEVSVSFESVSRAPGVDSPPRRHWKESVLVSAEDPSALRTRSSPSSQRNGAHSEERPGPGAEPGPARQPHPEHLNTGPASRGAKGSSSSIPYIDCSDIDSEYDVAKGRVTRSHPNESYGEEVAGPRRGSINEREMESPPSPKPPLNMSRALDESGNLSFFGGGPPRGPLHSTMMEDLGGRGIGDQRSSSPLTVRHMLGSKSTTSSPVMSTFHRTGSLSHADQNGYGSRLPRWDEPGHGGFNARGGPGGPRDENYGSYSPIVARSPHLQKLHNMRNRSDTDPFVLSPQQATSTPSH......................................................................................................................................................................................... 697
92 0.000e+00UniRef50_A0A1I8I209 Uncharacterized protein n=3 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8I209_9PLAT  ali  25  18..KTLTVKVVLLDDTVSFQVPARLPGQELFNAVVKKLKLLEVDYFDLEFLSRDGRQSWLEHEKTLPKQ-CPSTAELIFYFSVKFYPPDP-HLLEDEFTRFLFALQIKRDLLNGLLPCSENTLALLASYLVQAEIGDFLEDEYLDTYLTQLKVLPQ-------PYTDELLFKVMEYHKAHIGLTPEDAEYSLLDTARKVELYGIRLHPARDHEGLPLNLAVAHAGVLVFQGTARIN---TFSWAKIRKLSFKRKKFLVKLHPEFKDVVEFYFDSRDECKHFWKKCIEHHTFFRCQGVKQAKSRSKVVSKGSSFRYCGRTQKQLIEFVREKRPQFDRSPAARRAPHLQSGSGS........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 364
93 0.000e+00UniRef50_A0A226PJL7 Uncharacterized protein n=2 Tax=Odontophoridae TaxID=224313 RepID=A0A226PJL7_COLVI  ali  24  1...MLHLKVQFLDDSQIFVVDQKSCGKGLFNLTCSHLNLVEKEYFGLEFCSQAGNHVWLEPLKPITKQI-KNPKEVLFKFMVKFFPVDPGH-LREELTRYLFTLQIKKDLALARLPCSDKSAALLVSHLLQSELGDFHEET-DQQHLATHRYLPNQ---------EYLDNKIMHYHRRHRGKTPAEADAQLLDVARKLDMYGIRPHPASDGEGTQINLAVTHMGVLVLRGNTKIN---TFNWSKIRKLSFKRKHFLIKLHANCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKALLCSKGSSFRYSGRTQRQLLEHGRKKSLPFERYWEVCGRAGTRWGPSTHPYTRPCRKHYASHYDERQCRSSPD............................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 366
94 0.000e+00UniRef50_A0A1A8EIK5 FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (Chondrocyte-derived) n=4 Tax=Ovalentaria TaxID=1489908 RepID=A0A1A8EIK5_9T  ali  22  39..RQVSFRVQMLDDTQEFQISQRSPGKVLFDLVCVHLNLTEGDYFGLEYQDHRKMMVWLDLLKPTLKQIRRPKNT-ILRLVVKFFPPDHTQ-LMEELTRYLFALQIKRDLACGRLICNDTSAALMVSHIIQSEIGDFD-ETQSWQHLLHNKYLPDQ---------DAIRDLIIDCHRKHVGQTPAESDYQLLEIARRLEMYGVRLHPAKDREGTKLSLAVAHTGVLVFQGYTKINA---FNWSKIRKLSFKRKRFLIKLRSDHHDTLEFAMASRDCCKIFWKICVEYHAFFRLFEEPKPKPKPIIFTRGSSFRFSGRTQKQVFDHLKDKRVPFERKHSKILSNSSVTPQSTSWRSHEPKENIASALLADQDSVRLGQEVKSTGSEDVAPPTNGFHDNTVGSGSAQQNHASQQLLNPGPTCSANRGSSSSIPYIDCSDIDSECDVTKSSRAPRGHGANSTEDESYGCE.................................................................................................................................................................................................................................................................................................................................................................................... 498
95 0.000e+00UniRef50_A0A2J7QHB9 Uncharacterized protein n=7 Tax=Neoptera TaxID=33340 RepID=A0A2J7QHB9_9NEOP  ali  25  1............................................................MDKRIAKFV--KNEPWKFNFEVKFYPPDPAQ-LQEDITRYQLCLQIRNDILMGKLPCSFVTHALLGSYLVQSEIGDYDADEHGRNYLKDFRFAPNQ--------TPGLEEKVMDLHRTHKGQTPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDRLRIN---RFAWPKILKISYKRHNFYIKIRPQYESTIGFKLANHRAAKKLWKVSVEHHTFFRLMTPEPTQKTGLFPRFGSKFRYSGRTHYET------KKSLIERPAPRFERSLSGRGLTSRSMDALAPRQTEEDFNKRHTMSHPPEHIPDMEH....................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 309
96 0.000e+00UniRef50_A7SPH7 Predicted protein n=3 Tax=Eumetazoa TaxID=6072 RepID=A7SPH7_NEMVE  ali  29  14....FVVKISLLDDTLTCEFRRDAKGQTVFDTVCKALDLVEKDYFGLRYVDDSKQRHWLDLSKSVIKQMKSLKPPFKLFFRVKFYALDPG-LIHEEITRYQCFLQIKRDILHGRLLCSYNELAELGAYIVQAELGDYDPEDQEDNYVSEFRIVPKQ--------SEKLENKIADIHRSLSGQVPSVAEKNFLDKVKSLDMYGVDPHPCKDQDNVQLYLGLTPTGIAIIRDGKKV---SGFEWAQIIKCSYEGKVFYVQVHKDDKANYGFRLPDPLACKHLWKCAVEHHAFYR................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 291
97 0.000e+00UniRef50_UPI0004572371 FERM domain-containing protein 7 n=1 Tax=Callorhinchus milii TaxID=7868 RepID=UPI0004572371  ali  22  35..KMMHLKVHLLDDTCEFEVEQKAFGKMIFDSVCHHLRLVEEDYFGLEFEDHEGNIVWLDHLKPILKQI-RGDKTVMFKFVVKFFPRDPGQLL-DELTRYLFAQQIKQDLVTGRLPCSDNSAALLLSHIVQSEVGDFAEELDRM-HLQSNKYIPNQDVLNH---------KIMNFHQKHAGQTPAESDIRLLDTARKLEMYGIRLHPASDGEGTHINLAVLHMGILVFQGNTKIN---TFNWGKIRKLSFKKKHFLIKLHANCKDSLEFVMASRNACKAFWKTCVAYHAFFRLSEEPKSKPRPILCSKGSCFRYSGRTQKQLVEHMSKKRVPFERKH------RKAQSGTSTSVSASDLPMRKQVKELTRRFASSEWSEDASSKSRQRRERRVSAVDIVFTTELERSKPEAELTSQALTRSPSPSHFTSFSDSEADKSRIQARKNRQHLQTSAGDLENVSGTMLLKPEYSPT............................................................................................................................................................................................................................................................................................................................................................................... 490
98 0.000e+00UniRef50_UPI0008113E4D tyrosine-protein phosphatase non-receptor type 4-like n=1 Tax=Rhagoletis zephyria TaxID=28612 RepID=UPI0008113E4D  ali  26  68...TIKCVVYFLDDSQHFEVDRTAKGEELLDLVFRHLELIEREYFALQFTEMIHHHYWLDPSKKIRKQMRFTSSPYILHFRVKFYVSDVGR-LFEEYTRYHYYLQLRKDILSGRLSGDDSTLALLASYVLQSELGDYSEEDFASGYASRFRYIPNQ--------TEKFEAKVEKLHRRHQGQTPADVELNYLDEAKNLDLYGVDLHHAKDCENHDIQIGVSGNGLTVFKQSIRVN---TFSWAKIVKISFKRRFFFVQLKHEFDNAIGFNLCSYRACKALWKACVEQHTFFRLHTPPLTKKFFFFFSLGSKFRYSGKTEFQTIEENKKRLTRTER........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 403
99 0.000e+00UniRef50_UPI000B90B4DA FERM, RhoGEF and pleckstrin domain-containing protein 1-like isoform X3 n=2 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B9  ali  17  90..KLVPLKVQMLDDSVILHVPNGCLGADLFKECCRHLNLLEMDYFGLEYFNKTDKVVWLDLEKPIARQVAAPKKTL-FHFTVKFYLADPSQ-LQDEFTKYLYALQIKKDLANGRLPCSENTAALMASYMLQAEVGDYTSPDHDDGYISAFRFVPNQTR--------AMESKIQEYHKNHVGQTPADADFNLLDVARRLEMYGVQLHAARDYENVQLHLAVSHQGVLVFHNNSRIN---TFSWAKIRKLSFKRKRFLVKLHPEPRSTVEFMMTSRNDCKRFWKCCVEHHTFFRLTQPKHRRPRRRLLSRGSTFRYSGRTQKQVVEDARV--TYIQRPPSARVSTRSLGAPRTPDHHSAPDLTYGQSYANGQGDNAVSSPTSVSPTTPSSTPVTPVHDNSRIAIHKGQSNSSITYEYTVNEDNPQMQSSSEVNGDSEPVHILPTESAPTEAAPQEEPKVQPEPQPEKEVQSPVINGEHNGHEGLNSPVLSPTGGKAVPAFPLNEEPAPPAPVEEDSGVRKKRHPPDRAYFIAKEILTTERTYLKDLEVIVVWFRKSTTNETSLPDILESLF-----SSLDPIYEFHCKFLKEIETR-LTSWEGRTNLQQKGSFQRVGDIMLKNVQHLKLYQGYVE.............................................................................................................................................................................................................. 725
100 0.000e+00UniRef50_A0A1D1UT60 Uncharacterized protein n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1UT60_RAMVA  ali  20  41.SKTVNCRVEFLDNQHTFRVPPKALGQTLFDEVCGHLGLLESDYFGLEYHDAAGNKYWLDLEKPVGRQLIPSSNVLNFYFGVKFYTPDPVQ-LEEELTRYLYVLQIRKDLASGLMPCQDSTAALLAAYVVQAEEGDYSPDNYRDTYLLKYKFLPQQDVT--------FLSQVRDSHVQLVGQSPAEADMNFLETARRCEMYGIKLHAANDHEGVALNLAVAHMGIVVFQNLAKINI---FSWAKIRKLSFKRKRFLIKLHPEYKETAEFYFDSRNSCKNFWKKCIEHHGFFRCPIQTLPRSKTKIFPAGSSFRFSGRTQKQVLEFARDKRPSFHRSTTSRIRSSQSCGASLAATPLLPMARARDSRYNTTGGTRSRRSIQGDNGALARSKSEPMEVTEVTNQDRSSDSG------SRTLERGHRTDMDYQGTMAVYSDEHMPREHHQTMHHTTITQIDRYDEVRPNGHHIHEVAVTVEDLVKDIPIGRSNLHSPARSTLDRSATSSQRLGQNGSHTLPLHASKGLTSVSELEDLSRKINGWKQQSQESFLKSFESKS.......................................................................................................................................................................................................................................................................................... 594
101 0.000e+00UniRef50_UPI0006D923DB protein 4.1 n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=UPI0006D923DB  ali  18  214..RRMHCKVSLLDETYECDIEKNAKGQDLFKKVCEHLNLLEGDYFGLAIWDTPTTKTWLDPLKEIKKQV--HGVPWNFTFNVKFYPPDPSQ-LSEDITRYYLCLQLRDDIVTGRLPCSFATLALLGSYTVHSELGEYDPDLHGPEYVSDFKLAHNQ--------TKELEEKVAELHKTYRSLTPAQADTLFLENAKKLSMYGVDLHHAK----------------------VRISNTVGFFFQQ----------------EQYESTIGFKLPNYKAAKKLWKVCVEHHTFFRLT-SPEVTPKSRLLSLGSKFRYSGRTQAQTRQASARPAPQFERTASKRASRSLDGATRSTRPTSAPSISEPQLPEPSRPAALVEARKQTVAVLLPKEQQKEDVKVRVEPKHEEKPAEKMEPEPVEVVKVKKAKVEVPVPPQKRSKRIEGENIYIRHSNLMLEDLDKTQEEIMRHHASISELKKNFMESVPEPRPSEWDKRLSTHSP-FRTLNMNGQIPPGSEAGPPVVMTQTVTISNASNVVKSEIPTKEVPIVHTETKTITYEAVQGDSSSADT................................................................................................................................................................................................................................................................................ 743
102 0.000e+00UniRef50_T1KYL2 Uncharacterized protein n=2 Tax=Tetranychus urticae TaxID=32264 RepID=T1KYL2_TETUR  ali  30  59..KTTRCKVIFLDDVHHFTLDENSKGQALLDLVFEHLELIEKDYFGLQYTSNSEQMKWLDANKCLKKQLIGNSL-HTLYFRVKFYASDPS-KLQEEYTRYHFFLQLRRDILDGKFVVPPASAVLLASYSAQSELGDFNPDEHKPGYLSELRLLPNQ--------TPEIEKKISEIHQLHKGQTPADAEYNFLDHAKKLDMYGIELHWAKDQNGSDIQLGVTSSGIVVFQNCIKMN---TFCWAKIIKISFKRKRFFIQLRREFDNMIGFDLNNYRCCKTLWK--------------------------SSKFRYSGKTEYQTLEEGKRPEKTFQRTASRRYARQTVPTL.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 375
103 0.000e+00UniRef50_A0A0P8YDG8 Uncharacterized protein, isoform C n=1 Tax=Drosophila ananassae TaxID=7217 RepID=A0A0P8YDG8_DROAN  ali  16  8.SRIMSVRINLLDETFIHEIKDDLPGQALLDVVFARLNLIETSYFGIRYIDEENQTHWLDPASRISRQLKPKSDPYDLYFGVKFYAADPCKLL-EEITRYQLFLQVKQDVLQGRLPVAFELAAELGAFVVQSELGDYDQRRHSKGYVSEFRLLPNQ--------SSELETRVSELHQQLKGMSPSSAELNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNK---TTVAHYYWPRIAKVYYKGRYFMLRISDKNNSTYGFETPRKSACKHLWRCCVEHHAFFRQVRVAPLPSSQSLFQLGSRFRHSRQTEKDELAAGR-SPPAFTRTPSKRQPRRNGNGNGTISTNGNGSGAAGGPGGVHMGNRPLPQPGLGTISKHKHRHRRTSDNESERSHRHRRDSAGGSDHDSNRGRSYSGHRSSSMRSGSAELIDSTSQWREVQRRQAEASLGQSSVQQAAVSKSSMVARSLHSNDSHSDTHSHHKSRRHRKNKSPSESRSRMWNSELAKHLQFDLVDTEGMSEQQLREIPYTVVETNSKRSNSNL-KIHKSNSKSSVGAKSTGSGNTAGQARNRVDRIRGLYYQSSHPHDSNGVG---VGNGGHAPKNGSIRSASTISSRECERNNGLVRMMSSMSMGDFISPTGSNLSPLENS-ALRVSHEHTDSGLG..................................................................................................................................................................... 711
104 0.000e+00UniRef50_F7BC88 FERM, ARH/RhoGEF and pleckstrin domain protein 1 n=19 Tax=Euteleostomi TaxID=117571 RepID=F7BC88_ORNAN  ali  19  11.................FCLQQRAPGRVLLEAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVLV-KFVVKFFPPDHAQ-LQEELTRYLFALQVKQDLAQGRLTCNETSTALLISHIVQSEIGDYDETV-DREHLAKNKYIPQQ---------EAIEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINA---FNWAKVRKLSFKRKRFLIKLRPDYQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQKQVLDYVKEKKVQFERKHSKIRSIRSLSAQPLEQNSEVPKQSSSFTFGDGVDSPGGRNCRQGKELKVSVDEAEPRRSPSLKRSPKDGKRGDGAVMATMEEEEEVVKAESQQNPPQTQQPSTGSLTGSPHLSELSINSQGGHTAANTTLSPNLSPDAKQPSPLVSPLLNDQASTRTDDEEEVKRKRFPTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKDDSMPETLKNLIFSNFEPLHKFHTNFLKEIEQ.......................................................................................................................................................................................................................................................................... 558
105 0.000e+00UniRef50_A0A0S7HKL6 EZRI n=7 Tax=Bilateria TaxID=33213 RepID=A0A0S7HKL6_9TELE  ali  69  1MSKLVNVRVTTMDAELEFSFNKSTKGRQLLEQVARTIGLREIWYFGLQYVDNKGIVSWLVEDKKVTEQNIKNETPLQFRFRVQYYPEDVEEELIQDVTRKLFFLQVKDHILSDEIYCPPETAVLLASYAVQAKYGEYDKSVHRRGYLSSERLLPKRVLDQHKLSKEQWEDRVQVWHEEHKAMLKEDAMIEYLKIAQDLEMYSVTYFEIRNKKGTELWLGVDSLGINIYPKDDRLTPKIGFPWNEIGNLSFDNKRFVIKPIDKRSPHIMFHGTPARIHKGIMQLAQGNHRLYARRRMADNIEVQQM...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 305
106 0.000e+00UniRef50_A0A087ZS10 Uncharacterized protein n=6 Tax=Neoptera TaxID=33340 RepID=A0A087ZS10_APIME  ali  23  15.....RATIRLLDDAIHCDFQPQHKGRYILEYVCKQLNILETDYFGLRYVDHCRQRHWLDLAKTAIKQV-KDMDPILFSFRVKFYPPDPLR-LKEEITRYQVYQQLKRDLLHGRLYCSPGEAALLAACIVQSELGDYDPKLHEGNYISEHKLLLKQ--------TEAIEEKAMKLHQTLKGFTPQQAETHFLRLASQLDTYAVDPHPVKDQKGAQLYLGINHCGILTFQGSRK---THHFRWPEVQKINYEGKMFIVHLTSEKKHTVGFKCPTGSNCRHVWRCAIEQMLFFTLPRASDAPSGGSIFSWGTKFKYTGRTEKEVLEETRKEEPPIQRCQTTCLRRKASSVPATPSTPSQDLVEIRYSSLPRSCHS.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 378
107 0.000e+00UniRef50_A0A0C9R685 Epb41l4a protein n=105 Tax=Hymenoptera TaxID=7399 RepID=A0A0C9R685_9HYME  ali  19  18.PRILHCKVILLDEELLQDVLSSNLGQELLDRVFRHLNLLETAYFGLRYLDHENQTQWLDPSKKIAKQLKRKGDPHTLYFGVKFYAADPC-KLIEEITRYQFFLQVKQDIVQGRLPVSFDLAAELGAYVVQSELGDYDPRRHSLGYVTEFRFLANQ--------TAELEARIVELHKTLVGQLPSAAELNYLDKVKWLEMYGVDLHPVLGEDNVEYFLGLTPSGIILLRNKTKVG---NYYWPRINKIYYKGRYFMLRVSEKNERTHGFETPSRGACRHLWKCCQEHQSFFRLMATGPPP-----LSPYSRFRYSPPTEKHQGSIRRNPPPAFQRAPSRRAQRRVVEGQEMVGPFVETPAIDRNITINSSNCSASRHVNNSSPRSTRSAPWTQSQPRGLYTSSSPRSVRSAGTAPALLSRLQRRSSSVESQSSGDSHSRSGXXXXXXXXXXXXXXXXXDCESEMSRGSDSRSGHRKHRRKHRSSRNSRHELVDSEPQWREAQ................................................................................................................................................................................................................................................................................................................................................. 511
108 0.000e+00UniRef50_A0A226EKB6 Uncharacterized protein n=4 Tax=Hexapoda TaxID=6960 RepID=A0A226EKB6_FOLCA  ali  18  43...CILCKVIVLDGTLSIELPKKALGSELYEQVFYNLDLIEKDYFGLNFTDSNHVQHWLDATKPLKKQI-KIGPPYTFRLKVKFYSSEP-HNLREELTRYQFFLQLKQDILTEKLKPPPETLIELSALVLQSEVGDYDEEIHTPAFVSEFRF------TSAHQQTEDMEITILEEFKKLKGLTPAQAEMNYLNKAKWLEMYGVDSHIVMGKDTCEYKLGLTPTGILVFEGAQKIG---LFFWPKISRLDFKKKKLCLIVVREREHTFVFRLHNEKAAKHLWKCAVEHHSFFRLKAASKAPNARQNF-----FRMGGRTEVQTVQNKSRRTVQFERRPSQRYARRQSHILRERQRGGRGDLETSEPSKAVESGVKVDATRTAELKESSTFNRPTRIQQASSSSETRTSLSPPITPTSRSTPSPTSNAESTTSSPAEDPLDNLIKSIAKENGACHTVDIHSQPSSLELDINVVPNNHSKYVSLPRPIPPDKLKCNILKAKVEEDLKKSSLSSESNGTASIANGETFSTLPTPAKKRENTVQNAKQNKD-------SATFISVGGDKLSLSTQEVHSNNDRDTGLLDHNTSGGGGDDDSTPLIAPD............................................................................................................................................................................................................................................ 629
109 0.000e+00UniRef50_A0A1U8CIP5 FERM, RhoGEF and pleckstrin domain-containing protein 1 n=27 Tax=Amniota TaxID=32524 RepID=A0A1U8CIP5_MESAU  ali  24  38..KLMTIKIQMLDDTQEFEVPQRAPGKVLLDAVCNHLNLVEGDYFGLEFPDHKKIMVWLDLLKPIAKQIRRPKHVVVRFVVKFF-PPDHTQ-LQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEAS-DREHLAKNKYVPQQ---------DALEDKIVEFHHSHIGQTPAESDFQLLEVARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINA---FNWAKVRKLSFKRKRFLIKLRPDYQDTLEFLMAGRDFCKAFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVREKKVQFERKHSKIHSIRSLASQPTASNSEVPKQSPQSASLTFGEGSESP............................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 404
110 0.000e+00UniRef50_A0A1V4KYE8 FERM domain-containing protein 7 n=17 Tax=Euteleostomi TaxID=117571 RepID=A0A1V4KYE8_PATFA  ali  20  103.SRMLHLKVQFLDDSQIFVVDQKSCGKGLFNLACSHLNLVEKEYFGLEFCSQAGNHVWLEPLKPITKQV-KNPKEVLFKFMVKFFPVDPGH-LREELTRYLFTLQIKKDLALGRLPCSDKSAALLISHLLQSELGDFH-EEMDQQHLATHRYLPNQ---------EYLDNKIMHYHRRHSGKTPSESDVQLLDVARKLEMYGIRPHPASDGEGTQINLAVTHMGVLVLRGNTKIN---TFNWSKIRKLSFKRKHFLIKLHANCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKALLCSKGSSFRYSGRTQRQLLEHGRKKSLPFERKHYASHRSSPDLLTDVSKQVEELRLAYGSRGPYHANGVHTSEPTLDSRRCGSAVEVT---FATELERSKPEASPTFLPHSKSSSAFPLLYAELELERAWEPSDLFSARNPLTSFRPHHQFTGNNKSTSVGNMREEQPPKRSWSQSDM..................................................................................................................................................................................................................................................................................................................................................................... 579
111 0.000e+00UniRef50_UPI000719BDB5 FERM, RhoGEF and pleckstrin domain-containing protein 1-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719BDB5  ali  20  40..KYILARVVMLDDTELFKVPQKALGKVLYQQVCKNLNLLESDYFGLEFTDLLGNRCWLDLDKAFWKQVCG-LPTLRFNFAVKFYTPDPGQ-LEEEYTRYLFALQIKRDLVTGAMPCNDATAALLASYVVQAECGDFTSEDYPDHYLSHYKFVPHQC--------DDLERQIMDNHRRHVGLSPADADYMLLDIARKVELYGVKVHSARDHEGVPLNLAVAHLGLHVFQQFTKIN---TFSWAKVRKLSFKRRRFLVKLHPEYKDTVEFYFDDRDRCKNFWKKCVEHHAFFRCTVARIPRRRKTLLSKGSQFRYSGRTMKEMVDDVRDKRAPFARTLSGRTSRSLGHLGGGGGPAPRINAALIQTSGASHHLVAAAGSDVTTPRSERGGDFASASSREVTPALTPSTPPPRIEMLPPQRLPEARGLSPSPPPPRRESASSPEVAPPGTVTADVEEGAPPSPDESPRKQPNVPSRPE........................................................................................................................................................................................................................................................................................................................................................................... 510
112 0.000e+00UniRef50_UPI000441F529 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Lipotes vexillifer TaxID=118797 RepID=UPI000441F529  ali  21  47.....PIRVQLLDSSVEFDVEPKRDGQVLLTQVWKRLNLIECDYFGLEFQNVQSCWIWLEPMKPIVRQVRRPKNS-VLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCTDTTAALLASHLLQAEIGDYEEAL-VREHLQAHEYLPGQ---------ERALERILELHRGHAGQTPAESDFQVLEIARKLEMYGIRFHTASDREGAKINLAVSHMGILVFQSSTKIN---TFNWSRLRKLSFKRKRFLIKLHPEYQDTLEFVLGSRDACKNFWKTCVEYHTFFRLSDQPKPRARAVLFSRGSSFRYSGRTQKQLVDYVKDKGIPYERKHSKTRMSLRALNANLPRQHLVHRGHEDSRVPVFNKCLLLFGPRLLSSPHGPARFQGQQRLPDGAPGSQRQVASCREERSGRSPTPRAACIPALPRGAPTCGLQS............................................................................................................................................................................................................................................................................................................................................................................................................... 474
113 0.000e+00UniRef50_A0A1D1VE90 Uncharacterized protein n=3 Tax=Protostomia TaxID=33317 RepID=A0A1D1VE90_RAMVA  ali  25  31MKATTPATVHFLDGTHTFHIDKHAKGQYLIDLVLDHLDLVERDYFGLQFLEPEYIWRWLEPHKSLKKQL-KGGSPYVLYFRVKFYVSNPC-LLHDEFTRYTYFLQLKKDIQEGKLSVPQSMASLLASYVIQSELGDFDPDEHKPGYLSEYKFVPEQG--------PNFDVKVHELHKQHRGETPADAEYNFLDHCKRLDTYGISLYHAQDANGVDIQLGVTYSGFVVFQNATRL---SVFPWTKIIKISFKQKQFFIQIHEESKDLLGFYMLSVRTCKYLWKSCVEHHSFFRMNSTPLLSRKLSLLSWGSKLR--GRTEYKTLEEGTRRKPSISRSPSKRYRRTIAGSSRN........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 382
114 0.000e+00UniRef50_A0A131Y0Y9 Putative rho guanine nucleotide exchange factor cdep (Fragment) n=2 Tax=Ixodes ricinus TaxID=34613 RepID=A0A131Y0Y9_IXORI  ali  24  1......................KAVGRVLFEQVCRVINLLEVDYFGLEYADSTGTKYWLDYEKPMCRQMGLSMVAPVMDFCVKFYTPDPAQ-LEEEFTRYLFSLQIKRDLSLGILQCSDPTAALLASYIVQASCGDYVPEDYPDHYLSTYKFVPHQN--------KELEIKIMDNHKKHVGQSPAESDLNLLETARRCELYGIRMTAAKDNDGLPLNLSVAHMGVIVFQNTTKIN---TFSWAKIRKLSFKRRKFLIKLHPEYKETVEFFFESRNECKNFWKKCIENHAFFRCTEKKTPRQKTRLFSRGSSFRYSGRTQKQIVEYVREKRQPFQRSTSLRLPSRSSVGTRMPAAEASASATPAALSEPSSPRREAGRESTAPRAPAEPGGAATPSQDTDDNVSHDSYRLEEGDSSLAAAPPGSPIAIDLHSPPPPPSPSSTRERTPHR....................................................................................................................................................................................................................................................................................................................................................................................................... 430
115 0.000e+00UniRef50_UPI00094E858F FERM, RhoGEF and pleckstrin domain-containing protein 1 n=1 Tax=Hippocampus comes TaxID=109280 RepID=UPI00094E858F  ali  21  37MPRHVTIRVHMLDDTEEFDVSVKASGKVLFDLVCRHMNLIEGDYFGLEYQSHQKMMVWLDPIKPIIKQLRRPKHT-VLRFAVKYFPPDHAQLL-EELTRYLFALQIKQDLSSGHLTCNDTSAALMVSHIMQSEIGDFDEGQC-RSHLLNNKYIPDQMP---------LIDKIMEFHSMNVGQTPAESDFQLLEVARRLEMYGIRLHPAKDREGSRLSLAVAHTGVLVFQGHTKIN---SFNWSKIRKLSFKRKRFLIKLRADYQDTLEFLMANRDCCKVFWKICVEYHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQKQVIDFVRESELPFERKHSRVQHNS--RLSPLPSPHHQKVPKESGALGDRVDAPSQHQWKESALVSSQETPEAPVGPAHQNSGHEDRSPSGKEETRGSTRPTH................................................................................................................................................................................................................................................................................................................................................................................................................................. 451
116 0.000e+00UniRef50_A0A0B7BPB4 Uncharacterized protein (Fragment) n=4 Tax=Protostomia TaxID=33317 RepID=A0A0B7BPB4_9EUPU  ali  25  41....LVCTIMLLDGTVTVDVNKKADGATLIEQVFYHLDIIEKDYFGLQYTDHYNVNHWLDPTKQVRKQV-KIGPPYTFRFRVKFYSSEP-NNLHEELTRYQFFLQLKQDIYAGRLTCPDDTLHELCAMALQSELGDYDPEVHSPGTVSEFRFVSNQ--------TEELEIAIFEKYKMCTGQAPAQAELQFLHKAKWLEMYGVDMHSVLGKDQNTYSLGLTPTGILVFEGAQKIG---LFFWPKMTKLDFKGKRLILVAVEDDDHSFQFHCTTAKACKHLWKCAVEHHAFFRL.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 323
117 0.000e+00UniRef50_V9KV48 Band 4.1-like protein 2 (Fragment) n=8 Tax=Gnathostomata TaxID=35060 RepID=V9KV48_CALMI  ali  34  261MMKAVQCKVLMLDGEYTFEIEKRSKGQLLMDKVCEQINLLERDYFGLTFRDAADQKNWLDPAKEIKKQI--RSWPWQFAFNVKFYPPDPIQ-LTEDITRYYLCLQLRQDIISGRLPCSFVTHALLGSFTLQAELGDYDEDEHRADYVSEFQFAPNH--------TKELEEKVVELHKTHRGLTPAQADTQFLENAKKLSMYGVDLHHAKDSEGVDIMLGVCANGLLIYKDRLRIN---RFAWPKILKISYKRSNFYIKIRP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 508
118 0.000e+00UniRef50_K1Q988 Band 4.1-like protein 3 n=1 Tax=Crassostrea gigas TaxID=29159 RepID=K1Q988_CRAGI  ali  19  34..RSVICRILLLDGKLEIDVDKRAVGQILFDKVCEHLDLIEKDYYGLSFTGHTGLREWLNVEKKISKQM--KGLAWEFKFEVKFYPPDP-QTLHEDLTRYQLCLQIRNDIVNEKLPCSAVTYALLGSYTVQSELGDFDIDEFGPGYIRKMRFAPHQDR--------ELLKKIAELHRTHKGQTPEAAELHFLENAKKLAMYGVDLSNAKDGENVDIQLGVCWSGILVFREKLQINK---FVWPKILKMSYRRKKFYIKLREEFQSLIGFKFMSSRHAKRMWKICVENHAFFRNREPDSPGTQRGLLRLGSKFRYSGRTHFQTKQAMMRPSPFFDRVHSRRTKNKDLHDEMFKPRPEPRHIPEYNREEKMMKK--VPEPEIHNREPEDVFDDDEDEEEGPDNRKSRMERMHAVPTPLAAVMKKDAPVNNNLEHHHRRRRSFEEADDREGVEDDMVRTDRLYNLEYTHANTNSGNMWTVKDTNQKSSSHSSLTKPNRQRGRQRTGSENFKKVSFDEESLRSASSQFSRSDSELWPQKLSVPKGRYLKKRTSSQSSMDSPLNVQSTMTSTPRNPLQYNQKVRRNLKESDFNSSVDEGFSDTFERKNDSNISCANSSKSGSFDRSPELTDGNTEMDKHRSSESTQGQISFGGSLYRYSSSESDDDHRADVKIEEKKVNSTRQKGR.............................................................................................................................................................. 720
119 0.000e+00UniRef50_A0A1B6L3F3 Uncharacterized protein (Fragment) n=2 Tax=Hemiptera TaxID=7524 RepID=A0A1B6L3F3_9HEMI  ali  25  13...TFKCTVRLLEDTVECDFQPQHKGKYLVEHVCRQLNLIEKDYFGLRYVDSTRQRHWLDPAKLVLKQV-KDMDPILFSFRVKFYPPDPFR-LKEEITRYQIYLQLKRDLLHGRLYCTSSEAALLGAYIVQAELGDYDPEEHVENYVSEMKILLKQ--------TQLVEEKMMELHQTLKGQSPVTTESNFLRKACTLDTYGVDPHPVKDHRGNQLYLGINHLGILTFQGSRKTN---HFRWVEVHKINYEGKMFIIHPRTKKKTTVGFKCPTGAACRHVWRCAIEQMLFFTLPSSADAPSVSFFSWSSSKFRYSGRVEKEILEDPARDEPSITRS---SLRRKANSVPATPSTPIASDLGYSSLPRSNHSADS................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 382
120 0.000e+00UniRef50_A0A0P6BGG9 FERM, RhoGEF and pleckstrin domain-containing protein n=16 Tax=Daphnia magna TaxID=35525 RepID=A0A0P6BGG9_9CRUS  ali  22  22.SKILVVRVQMLDDTVTFQIQAKAMGTVLFEQVCQQVNLLEADYFGLEYTSSENVKYWLDLEKPMNRQLEMSLTDPLLRFAVKFYAPDPAQ-LEEEFTRYLFCMQIKQDLAQGTLQCNDKTAALIASYLVQAECGDYVAEDYPDHYLSSYRFVPHQD--------PELERRIMENHKKHIGQSPAEADLNLLETARRCELYGVKMHPAKDPEGVPLNLAVAHMGVLVFQNFAKIN---TFSWAKVRKLSFKRKKFLIKLHPEYKDVVEFCFECRDECKNFWKKCVEHHGFFRCPTAKEPRPKPGVLSRGSSFRYTGRTQKEIVEFVREKRQSFQRSQSFRHTSPHHTVGTSLSVHPLLPVGDNVIVANDTVSPGSSAAISDSRARSISTPERTETVDVHHSREPRSASGHRDVDVEREMEVESP............................................................................................................................................................................................................................................................................................................................................................................................................................... 488
121 0.000e+00UniRef50_Q3UH12 Uncharacterized protein (Fragment) n=19 Tax=Bilateria TaxID=33213 RepID=Q3UH12_MOUSE  ali  21  1........................................................................GVPWNFTFNVKFYPPDPAQ-LTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGMDYVSDFKLAPNQ--------TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRIN---RFPWPKVLKISYKRSSFFIKIRPHYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLT-STDTIPKSKFLALGSKFRYSGRTQAQT----RQASALIDRPAPHFERTASKRASRSLDGAESTDRSPRPTSAPAIAQSQVTEGPGAPIKKTPKEAVKVEEKRGEEPAEPAEPEPTEAWKDXXXXXXXXXXXXXXXXXXXXXFMESVPEPRPSEWDKRLSTHSPFRTLNINGQVPTGDGVKKTSILPSGRKGEENSKRPERSTERTLPQRENEEIAPKVSIPIPEEHK............................................................................................................................................................................................................................................................................................................................. 439
122 0.000e+00UniRef50_UPI0006D8FDDC FERM, RhoGEF and pleckstrin domain-containing protein 2 n=2 Tax=Bovinae TaxID=27592 RepID=UPI0006D8FDDC  ali  20  47.....HIRVQLLDDSVEFDIEPKCDGQTLLTQVWERLNLIECDYFGLESQNAQSCWIWLEPMKPIIRQVRRPKNA-VLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCTDTTAALLASHLLQAEVGDYDEAL-DREHLRAHEYVPRQ---------EHALHRILAFHRELAGQTPAESDFQVLEIARKLDMYGIRFHSASDREGAKIKLAVSHTGVLVFQSSTRIN---TFNWSRLRKLSFKRKRFLIKLHPEYQDTLEFVLGSRDECKNFWKICVEHHTFFRLLDQPKPKAKAVLFSRGSSFRYSGRTQKQLADYVKDKRVPYERRHSRTQMSLRALKVDLPRQSIAFSEGVRTPVTPSPTTASFCSAPASPPVPPGSRDFQVGSGSPQTGPPAPGAWRPAAERSSMATAQPLRLPALQPHQGAGFGWGAKSCGPRSPEGRSCPTSGPDS........................................................................................................................................................................................................................................................................................................................................................................................... 494
123 0.000e+00UniRef50_A0A0N4UE28 Uncharacterized protein n=1 Tax=Dracunculus medinensis TaxID=318479 RepID=A0A0N4UE28_DRAME  ali  25  7..RYITCQITFLDNTHSFQIERHSKGQILLDKVFDYLELVEKDYFGLQFTSTMNFQKWLDPTKSVRKQML--CPPFNLFFRVKFYVSDPV-KLVEEYTRYHIFLQIKKDLYEGRLVCPENICTILASYAVQSEFGDYCPEEHGDHYLNDFKFIPNQDNN--------FLSKVVDLHKIRKGQTPAQAEFNFLEVAKTTELYGIELFNAKDEDGNSVNIGCCNRGIIIFRSNQQQNI---FQWTTIMKLAFKKKLFSVYMKDEKEIVRVFNMQNPEVCKVLWKNCIEHHTFFRLVAPPALPQKS-FFNIGSRYRYSGKTEFQSIEEMKRR-ARVERSFQRFSKNPSRLTATNN....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 370
124 0.000e+00UniRef50_A0A2K5JAI9 Erythrocyte membrane protein band 4.1 n=2 Tax=Boreoeutheria TaxID=1437010 RepID=A0A2K5JAI9_COLAP  ali  33  1....MHCKVSLLDDTVECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQV--RGVPWNFTFNVKFYPPDPAQ-LTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQ--------TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRIN---RFPWPKVLKISYKRSSFFIKIRP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 244
125 0.000e+00UniRef50_UPI0003291994 FERM, ARHGEF and pleckstrin domain-containing protein 2 isoform X1 n=2 Tax=Dasypus novemcinctus TaxID=9361 RepID=UPI0003291994  ali  22  46..KHLPLRVQLLDGSVEFDIEPRCDGRELLAQVWRRLNVVEADYFGLEFQNVPSYWIWLEPLKPIIRQVRRPRNT-VLRLAVKFFPPDPGQ-LQEEHTRYLFVLQLKRDLLEERLTCHENTAALLAAHLLQAEIGDYD-ELLDREHLSASEYLPAQERS---------LEKILEFHRKHVGQTPAESDFQVLEIARKLEMYGLRFHVASDREGTKINLSVSHMGVLVLQGTARIN---TFNWSKVRKLSFKRKRFLIKVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRLSDQPKPKAKGVFFSRGSSFRYSGRTQKQLVNYVKDRKIPYERRHSKTRASIRALTTDLPKQSVSLSEGMRTWTCPPPASATASGPACPVAPDRPDVKDSSASPPDPQAPSARSP................................................................................................................................................................................................................................................................................................................................................................................................................................................ 443
126 0.000e+00UniRef50_UPI0007D8F60E uncharacterized protein LOC100678050 n=1 Tax=Nasonia vitripennis TaxID=7425 RepID=UPI0007D8F60E  ali  19  46..KMLAFRVQMLDDSITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQEPNGTKYWLDLEKPVCRQVGLSLVDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQDN--------ELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHENVPLNLAVAHMGIIVFQHYTKIN---TFSWAKIRKISFKRKKFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVTRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSSGSSSISAHPLLPLGDPGMYHERTPTDRTTTVHEFSKKRKRKHLNEKKTLQLHVYHIDFTLCSVVKISSTGRISPSNSSPPEFSTVPRPLPRYSWQRSASCRELYATSFDESGKARSPRQQGGETASSGLDGFQQQLPSQGELDRPVTRCDELTHASSKLPSLDRDSVPDKIYSSSYPGTSSLSTESGHEGSAHAGDLSHDDLSHDSYELLEREAEDESESYSSPRRDGAENEALSDQSDEGIEPEMFQMDSETESFVKQRSIRSTDKQLFKHVLADIKSSKGSK................................................................................................................................................................................................................... 699
127 0.000e+00UniRef50_A0A1V4JLJ0 Band 4.1-like protein 2 isoform A n=3 Tax=Amniota TaxID=32524 RepID=A0A1V4JLJ0_PATFA  ali  17  1.....................................................................MKRSLPWIFTFNVKFYPPDPSQ-LTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDHDPEEHRSDYISEFQFAPNQ--------TQEMEEKVAELHKTHRGLTPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIMLGVCANGLLIYKDRLRIN---RFAWPKILKISYKRSNFYIKVRPQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEQPP-KAKFLTLGSKFRYSGRTQAQT----RQASNLIDRPAPYFERTSSKRVSRSLDG------------------APMGISDQSLLRDFPATARQAAGDKILDLDAAGQAKLKEGGREEDGSPVKTPQLELTQDGKSNSLRVDGENIYVRHSNLMLEDLDKTQDDLLKHQASISELKRNFMESTPEPRPNEWEKRRITPLSLQTQGKKGDHIFQVKPLPGKEKQ------WTAIPWIAGAKPEETDQRHASRAEVPCTGVSDADKSSHETL-DIVEEKKQAEVGIEETLVVDETNKGKMQVATGAGETCKVEEHLSKKDSSSLPXXXXXXXXXXXXXXXXVGEYQPHHRATEEVIREEQEEEEDMKRKEHEEVEATPEGSKLNVPVE-HTQVKAED.................................................................................................................................................. 589
128 0.000e+00UniRef50_A0A182G429 Uncharacterized protein n=12 Tax=Stegomyia TaxID=53541 RepID=A0A182G429_AEDAL  ali  15  22........................PGQALLDVVFARLNLIETAYFGIRYIDQDNQTHWLDPASRLSRQLKGGTQPFDLYFGVKFYACDPC-KLVEEITRYQLYLQVKQDILQGRLPVSFELAAELGAYVVQAELGDYDPRKHPPGYVSEFRLLNNQ--------TKEIESRIHELHVQLKGMSPSQAEFNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPGGIVVLRNK---TTVAHYYWPRIAKVYFKGRYFMLRVCDKNNSTYGFETPKKSACKHLWKCCVEHHSFFRLVRTAPMQANSGLTSLSSKFRYSGRTERQQMKEVQRVPPAFTRTPSRRQPRRIVDDHPEEKMFDAPKYIQQSIPQPAQTIPAALNTSSSSKGHPQPPDSPRSTRSAPWMRSQQRGLFGINSSPKSVRSASTRMSAPVNTNRMRSSSVESHSSNESRSGRRRRHRSRRVSDNESEMSRGSGRSGRSHNSHRKHRRHRSKNRRNRSDTESRDRSYSSHRRSTESIELVDSGEQWLEVQRKQADNVHKAAVIKSSQVIKGSTPDSSIAHHHRSRRHRKHRSPSEKIWSS--ELTKHLQFDLVDTTGMTEDQLREIPYTVVETNHHAS---KKPSALKVHKTSHHDNQRIDRIREYPKENVNDHMS--AVNGSIRSASTISSS--RDYDRNSGLIRMMSSM...................................................................................................................................................... 694
129 0.000e+00UniRef50_UPI000B98ADC6 uncharacterized protein LOC111057027 n=2 Tax=Nilaparvata lugens TaxID=108931 RepID=UPI000B98ADC6  ali  20  60...MLAIRVQMLDDSVTFQIQAKAVGRVLFDQVCKQLHLLEADYFGLEYQDVAGTRYWVDLEKPVARQVGLSLVDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQVKRDLATGHIQCNDNTAALMASYIVQAECGDYVAEDYPPSYLSVYKFVPHQDL--------ELERRIMENHKKHVGQSPAEADLNLLETARRCELYGMKMHPAKDHEGVPLNLSVAHMGIVVFQNYTKIN---TFSWAKIRKISFKRKRFLIKLHPEGYVTIHLFFEGRNECKNFWKKCVENHGFFRCSIKKVPRQRTRVLSRGSSFRYSGKTQKQIVEFVREKRQTFQRSQSFRHSSSVHSLSAHPLLPLGDSSAERGVCLQCLCPADSPSPTVRRATRTSLAAIVTATADDISTTPSHSHATITVTQGQINTTPIYQHHRKPSSTSSSQQQLFFDYDDSDDRQSYCRHCGEELEXXXXXXXXXXXXXXMSPVARTRSSQTDIINNIDYGEESDDKPPPEHPITDASSAYRWQRSASCKELDRGETPHPLDIPQPLLDKPITRYDDTRRSCYSVSGSKTPSLDRSHVDAPETKV................................................................................................................................................................................................................................................................... 640
130 0.000e+00UniRef50_A0A067REH3 4.1-like protein n=2 Tax=Zootermopsis nevadensis TaxID=136037 RepID=A0A067REH3_ZOONE  ali  25  1............................................................MDKRIAKFV--KNEPWKFNFEVKFYPPDPAQ-LQEDITRYQLCLQIRNDILMGKLPCSFVTHALLGSYLVQSEIGDYDAEEHGRTYLKDFRFAPNQ--------TSELEEKVMDLHRTHKGQTPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIKLGVCASGLLVYRDRLRIN---RFAWPKILKISYKRHNFYIKIRPQYESTIGFKLANHRAAKKLWKVSVEHHTFFRLMTPEPTQKTGLFPRFGSKFRYSGRTHYET------KKSLIERPAPRFERSLSGRGLTSRSMDALAPRQTEEDFNKRHTMSHPPEHIPDMEH....................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 309
131 0.000e+00UniRef50_UPI0007AD0270 FERM, RhoGEF and pleckstrin domain-containing protein 1-like n=1 Tax=Sinocyclocheilus grahami TaxID=75366 RepID=UPI0007AD0270  ali  21  35MPRQVSIRVKMLDDTQEFAVSQRAPGKVLFDLVCAHLNLIEGDYFSLEFQDQHKMTVWLDLLKPILKQIRRPKNT-ILRFVVKFFPPDHTQLL-EELTRYLFALQIKHDLACGDLTCNESSAALLVSHIVQSEIGDF-EEVQCKQHLLNNKYIPEQ---------DALMDKIIEYHQKHVGQTPAESDYQLLEIARRLEMYGVRLHPAKDREGTKLSLAVAHSGVLVFQGHTKINA---FNWSKVRKLSFKRKRFLIKLRPDCQDTLEFMMGSRDCCKVFWKICVEYHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQRQVIDYVKDSEVPFERKHSKILSNSGLSPFPPRLCVEGQGEQRNASASGHQADSPVGRTQVTVENPALQHYTGSLTSQTNGCRNGTHDEADARLKPSPSKQQAEHLSTGLALHAAKGSSSSIPYIDCSDVDSEYDVVKGRVTRSHSHTHDNDEVEPNGRSAGKSNGYGNGQHNGQGASKSRFRES............................................................................................................................................................................................................................................................................................................................................... 533
132 0.000e+00UniRef50_UPI0008521FA0 uncharacterized protein LOC108776923 n=2 Tax=Attini TaxID=143999 RepID=UPI0008521FA0  ali  19  42..KMLAVRVQMLDDSITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYHEPNFTKYWLDLEKPVCRQVGLSLIDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQDH--------ELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHLAKDHENVPLNLAVAHMGIVVFQNYNKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVVRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSRALQGSEGGGYRGATPSSSLMGSSSISAHPLLPLGDPALATPAQSLSCGSMTLDSPTTVTSVSMGGTSHRREDTATSFRTAISTDVHSPTTPSQVPAQRQMLATSQQRTSSTGRISPSNSSPPEFPLPRPLPRYPWQRSASCRELYASSFEDSGKARPRDDKVTADLPLDPFQLASQGELDNPVTRESNRSYSAASSKLPSLDHDSVPDRVYSSSYPGTSSLSTESGHEESGPAGDLDSYELLEREHEFEYPESYSSPHDEPISDQSDEGIEHEMFQMDSETD---SFVKHRS-LKPSEKQQYRSAFTDL----KNSKIKSIDRYSAVSKVDSDFVITESRIQR........................................................................................................................................................ 727
133 0.000e+00UniRef50_A0A2K5JAP0 Erythrocyte membrane protein band 4.1 n=2 Tax=Euteleostomi TaxID=117571 RepID=A0A2K5JAP0_COLAP  ali  33  1....MHCKVSLLDDTVECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQV--RGVPWNFTFNVKFYPPDPAQ-LTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQ--------TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRIN---RFPWPKVLKISYKRSSFFIKIRP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 244
134 0.000e+00UniRef50_M3XKH4 Erythrocyte membrane protein band 4.1 like 2 n=3 Tax=Euteleostomi TaxID=117571 RepID=M3XKH4_LATCH  ali  26  237..KAVQCKVLLLDGT-------------------------ECAY---------ELENWLDPAKEIKRQI--RNFPWQFAFNVKFYPPDPSQ-LTEDITRYFLCLQLRQDIATGRLPCSFVTHALLGSYTLQAELGDYDPEEQRTDYVSEFQFSPNQ--------SKELEEKVIELHKTHRGQTPAQADSHFLENAKKLSMYGVDLHHAKDSEGVDIMLGVCANGLLIYKDRLRIN---RFAWPKILKISYKRSNFYIKIRPQFESTIGFKLPNHRSAKRLWKVCVEHHTFFRLV-SPDQPPKAKFLTLGSKFRYSGRTQAQ----SRKASTLIDRPAPYFERTSSKRVSRSLDGAPVGSITDQSLLKVSPATEATSP.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 562
135 0.000e+00UniRef50_UPI0005EEA323 FERM, RhoGEF and pleckstrin domain-containing protein 2-like n=2 Tax=Bilateria TaxID=33213 RepID=UPI0005EEA323  ali  26  91..KTMSLKVQMLDDSVTVDVVQNATGTDVFLECCRCLNLYEMDYFGLEYYTKGDHLVWLEQDKPVLKQMLAPKKTL-FHFSVKFYLSDPGQ-LHEEFTKYLFALQVKKDLANGRLPCSENTAALMASYILQAEVGDYNPMEHDDGYITAFRFVPNQSRP--------MELKIQEYHKNHIGQTMADADFNLLDVARRLEMYGVRLHAAKDYENVQLYLAVSHQGTLVFQNNTKIN---TFSWAKIRKLSFKRKRFLIKLHPEPRSTVEFLMETRNDCKHFWKACVEHHAFFRLTQIKYPRSRRRLLSRGSTFRYSGRTQKQVVEQARNSRSLVTLNASRMSTRSLGAPRTTTPL..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 438
136 0.000e+00UniRef50_UPI000B442158 FERM, RhoGEF and pleckstrin domain-containing protein 1-like isoform X2 n=1 Tax=Danio rerio TaxID=7955 RepID=UPI000B442158  ali  21  31MPRLMPIRVLLLDDEQIFDISYRSSGRVLFDMVCLHLNLVEGDYFGLQFHNHHRKMVWLDLLKPIRKQITRPKHT-VLRFIVKFFPPDQSVLL-EELTRYLFALQVRQDLGSGRLTCSDSSAALLVSHIIQSEIGDF-EETQCRQHLLNTNYMPDQM---------ALMDKIMEFHLKHKGQTPAESDYRLLELACRLEMYGIRLHPAKDREGNKVSLSVAHGGVLVFQGHNRIN---SFNWSAIRKLSFKRRRFLIKLRADSPDTLEFLMASRDCCKMFWKISVENHAFFRLFEEPRPKPKAVLFSRGSSFRFSGRTQKQVIDYVKEKKLPFDRKHSRVQCNSSLSPLGSAQHNQAAKQSWEGAFLVSSEDSAVLRPCGNSSPSTQRNGCSDQTYPVQEDSRSPAAKQQQ............................................................................................................................................................................................................................................................................................................................................................................................................................................ 440
137 0.000e+00UniRef50_F5HMU0 AGAP001287-PB n=11 Tax=Cellia TaxID=44534 RepID=F5HMU0_ANOGA  ali  20  48..KKLAVRIQMLDDSVTFQVQAKATGKVLFEQVCRQLNLLEADYFGLEYQEAPGTKYWLDLEKSLNRQVGLSLVEPVLRFCVKFYTPDPLQ-LEEEYTRYLFCLQVKRDLATGSLQCNDNTAALMASYIVQASCGDYAAEDYPDHYLSSYRFVPQQDHT--------MQRRIMENHKKHVGQSPAEADLNLLETARRCELYGMKMHPAKDHDGVPLNLAVAHMGIAVFQGITRIN---TFSWAKIRKISFKRKRFLIKLHPEHKDTVEFFFEGRNECKNFWKKCVENHGFFRCTAQNVQRRKARVLSRGSSFRYSGKTQKQIIEFVRDKRQTFQRSQSFRQGPLHSS---NRSQSRTSCNVNQSISAHPLLPIETAEWERRSQSNVLRTPSQTRRQVDMEVDRLPSSPTGHSRSQLTEAQVETYPMKSYTQQMGMEGSGHTPLQDSSQSASPGGTWSSP-----YHNSNSNSSHAREADRARARQDGHSSGLNHRLYATMSPKYTHRSHRFTTXXXXXXXXXXXXXXRRASAGPLGQPGDRSSSMGETTVSSTSRESVLLPLDTRTRRS.............................................................................................................................................................................................................................................................................. 605
138 0.000e+00UniRef50_A0A2J7QHB7 Uncharacterized protein n=2 Tax=Hexapoda TaxID=6960 RepID=A0A2J7QHB7_9NEOP  ali  18  1............................................................MDKRIAKFV--KNEPWKFNFEVKFYPPDPAQ-LQEDITRYQLCLQIRNDILMGKLPCSFVTHALLGSYLVQSEIGDYDADEHGRNYLKDFRFAPNQ--------TPGLEEKVMDLHRTHKGQTPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDRLRIN---RFAWPKILKISYKRHNFYIKIRPQYESTIGFKLANHRAAKKLWKVSVEHHTFFRLMTPEPTQKTGLFPRFGSKFRYSGRTHYET------KKSLIERPAPRFERSLSGRGLTSRSMDALAPRQTEEDFNKRHTMSHPPEHIPDMEHIDDKPKPVKELRKKEEKLKDKKPVGGVAVLPPGALNFGKSXXXXXXXXXXXXXXXXXGKDLLEEKENRNDLNNESATDLINDDSVINTSAEEKSPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEGNEEKAXXXXXXXXXXKIKAEGVDDGRSPYVTATAVTTRTATTHEDKEKNAKTSQVEETTMTTSATRQEQRVVTQEVRATSTVLANDSQPGSSGPQTESMVYSDPSTLGDPDLHSTTQVPVVATETRKVALESEDGNYSATGEIVSSQTISSKTR..................................................................................................................................................... 630
139 0.000e+00UniRef50_UPI0005ACF73D uncharacterized protein LOC105262935 n=1 Tax=Fopius arisanus TaxID=64838 RepID=UPI0005ACF73D  ali  19  40..KMLAVRVQMLDDTITFQVQAKAMGRVLFDQVCKQLHLLEADYFGLEYQEPNGTKYWLDLEKPVCRQVGLSLVDPLLRFCVKFYTPDPGQ-LEEEFTRYLFCLQIKRDLSQGYLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQD--------QELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHEGVPLNLAVAHMGIIVFQHYTKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVIRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSRALQGSEGAGYRGATPSSSLMGSSSISAHPLLPLGDPALGTPALSLSCGSMTLDSPTTVTSVSMGGTSHRRDDTAMSYRTLTSIDVHSPATPNQGQSHRHTMGAHQQQQRITSSTGRISPSNSSPPEFPPPRPQPLYPWQRSSSCRESSFEDSGRARKTDEKPEGGLDTIQLPSQGELDNPVTRYDETNRSYSAASSKLPSLDHDSVPERVYSSSYPGTSSLSTESGHEESGDDLSHDSYELLEREHEFEYPESYSSPRDEAVSDNSDEGIEQEMFQMDSETDSFVKHRSIKSTDKQLFKSVL-ADIKNAKLKSVERSSAASKTEASN........................................................................................................................................................................ 717
140 0.000e+00UniRef50_UPI0009E24CBC tyrosine-protein phosphatase non-receptor type 4-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E24CBC  ali  27  32.PNKIRCVVELLDDEFVIDIDKHSKGEVLLEAVFKHLDLLEKHFFGLQYVDSPDNLQWLNSEKQIRKQL-KRGPPYIFYFRVRFFASDPS-KLSEDITRYQFYLQIKRDLLTGRLPCLYDTAAELASYVLQGELGDFDPKIMVDSYVSEFRFIPDQ--------SEDFEERASEFHKHHSGQSPADAEFNFLEVAKNLDLYGVDLHFAKDHDGLDLHIGISPLGLTVYHNRCKIN---FFPWSKVVKVCFKRKRFFVQIRPDWNEWIGFHMPTYRACKTLWKTCVEYHTFYRTHFPKPSNSKSTLVRIGSKYRYR............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 339
141 0.000e+00UniRef50_A0A226EIQ6 FERM, RhoGEF and pleckstrin domain-containing protein 1 n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226EIQ6_FOLCA  ali  17 1040..KMVAIKVLLLDDSVTIQAQSKTLGRLVFTQICKQLNILESDYFGLEYLDNDGITHWLDLEKRLSRQVGLNLAEPFLKFSVKFYTPDPSQ-LEEEFTRYLFSLQIKRDLAKGVLVCNDNTAALMASFIVQAECGDFSEEDYDASYLSVYKFVPHQNY--------ELERKIRECHKKHISQSPAEADLHLLETARRTEMYGIRLHPARDEDGVHLSLSVCHMGVLVFQNNTKIN---TFSWAKIRKISFKRKRFILKLHPEYKELVEFIFDSRNECKAYWKRCVEHHAFFRCEKAPNPIHRSKLSSRGSSFRYSGRTQKQMVQFVREN--FIKRPPTSSQQNLSTFENQQQHGHQGGRNFQGDLFQRSSSFKKYDPKSPLTSAQPTRRSTGNIDFDSRNLTHDDGDELDDDDEEFSDYHIDSNQQLPPCPPSTQQSLSLRNQQKTQQQQSPTGSSITSSPIPQNNHPHPHSTQPMESTEGNNINLSDLEERDNSSHNSSSKLPIMFLSSSQNEFPVTSYKTTTKKDKMEKVLTKRKVRKRTKNKPKIDSQTLPKSNTKRSKKEFTTS--PLNNSEKGSYDLLELDKSPEAPTAEESGRK............................................................................................................................................................................................................................................... 1651
142 0.000e+00UniRef50_A0A1I8GCG6 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8GCG6_9PLAT  ali  74  1MGKPINVKVTTMDAELEFSIQSNTSGKQLFDQVVKTIGLREIWYFGLRYIDSKGFPTWLKLNKKVMQQDLPKEAQMVFEFRVKFYPEDACEELIQDVTQRMFYLQVKEAILNGDVFCPPETAVLLASTACQVKFGDYNPEVHTAGFLSREKTIPVHVLEKHSLTKGDWEEKIVNWYKEMRGRMKEDAMLEYLKVAQDLEMYGVNYFEIKNKKGTDLFLGVDALGLNIYAKDDKLTPKIGFPWSEIRNISFNDKKFVIKPNDRRAPDFVFFASRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAKEDRANKQFEK....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 322
143 0.000e+00UniRef50_UPI000C77C8CC tyrosine-protein phosphatase non-receptor type 4-like n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C77C8CC  ali  18  37..RQFPVHVTFLDDTVHFFLDKKAKGADLLNLVFQHLELTEREYFGLIFCEAPDVSRWLDPSKPLRKQMRVKGVEVHLQFRVKFYVTDPSR-LQEEYTRYHLYLQVKQDLVYGRLLGPLSTISLLTSYTAQSTLGDFDVDSCRSGYLAPFTNLRTHCKGSGMEDQLEIDRRIAELHRLHKGQSPAEAELNFLEHAKRLEMYGISLHPGKDSNSRDIQLGVTSIGLVVFQNNLKIN---TFSWSKIVKISFKRKQFFIQLRKELTETYGFNLSSYRSCKNLWKSAVEHHSFFRLH-SPKLSSKRFPFTLSSKFRYSGRTEYQTVTESASRSTPVRRPNRQTLPANLERRKLLLASPEHSSIGSSNHGTSNKSNTSLPPPSNLVTPS-PSHPPKPLSETSSRVSLAVRAYESFNTRVQSLGVRVPRRAWTEESDDDGGFLARTIPRLRPSAPSSESRSNHSRRSPVDL--SCPPAKFSFVDDSASEKGSERASSEPPSQTATLQIQXXXXXXXXXXXXXTASVTPPEDVEDASSQISGSSVGLVIITMLPDTLGRFGFNVKGGND.................................................................................................................................................................................................................................................................................... 610
144 0.000e+00UniRef50_A0A146UVC8 Band 4.1 5-like protein n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146UVC8_FUNHE  ali  26  43....ITCRVSLLDGTVSVDLPKKAKGEELFEQIMYHLDIVEKDYFGLRFMDSAQVPHWLDVTKSIKKQV-KIGPPYCLHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECPFDTAVELAAFSLQAELGDCDPLEHNLDLVSEFRFSPEQ--------TEDMELAVYNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGVXXXXXXXXQTKIGLFFWPKITRLDFKKSKLTLVVVEEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRAPVQNPPRSAFXXXXSRFRYSGKTEYQTTKSSKRRSTSFE......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 407
145 0.000e+00UniRef50_A0A2A6BJ79 Frm-2 n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=A0A2A6BJ79_PRIPA  ali  17  39..KQVCCKVLLLDGTLNVVVSKRALAEEVYDQVLYTLDIEEREYFGLQFTDHYHVHHWLDPLKRLTKQV-PIGPPFTFRLRVKFFTSEP-NNLREEITRYQFFLHIKQDVATGKLGCPRKTAIDLAAFALQSELGDFNPEVHTPLFVSEFRFHPEQD--------EAMEEEIVERYSQCKGQSPAQAEMNYLQGAKWLEMYGVDMHIVEGKDGNHYSLGLTPQGMLVFDGSQKIG---LFFWEKIQRLDFRSKKLTLVVEEEADHTFVFSLVSSKACKHLWKCAVEQHSFFRLKRSAPRQSRSQLFRLGSTFRYRGRTEYETVNKERRSASAFERRPSQRYGARQSHLTKRDQRAEVRQQIVASLHAPPERKNEGIIHTDSAKVAAAERLERLISSSPPSSSSLSTVPPPPPPTVLPSHPPQSRMPVPTRLNVTSTPPMVNLSTEPRRIDSPSHVTTIPSTSIIPTVTSPSSEKTIRMTVHTTPISPMYTDSSRLSQSRIPKYTNQSVLSTSTGGESTVSSEEGDNVSPSPPSSPSIAPTASTNPPKLFVSRIPPPSASITKMDESTLSASRIPKVNTR.................................................................................................................................................................................................................................................................... 621
146 0.000e+00UniRef50_UPI000C78F5C5 uncharacterized protein LOC111694839 isoform X1 n=2 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C78F5C5  ali  18  59.SKLLSVRVQLLDDSVTFQVQSKAAGRMLFEQVCKQLNLLETDYFGLEYTDAHGITFWLDRDKSMSQQVNLPSVDPLLRFVVKFYMPDPSQ-LEEEYTRYLAALQIKRDLATGHLHCNDNTAALMASYIVQAECGDYAGEDYPDHYLSTYNFVPGQD--------KELQRKIMENHKKHTGQSPGEADLNLLETARRCELYGIKMHLAKDHESVALNLSVAHMGVLVFQNYTKIN---TFSWAKIRKLSFKRKKFLIKLHPEYKDIVEFYFEERNQCKNFWKKCVEHHGFFRCSETPRNREKPKIISRGSSFRYSGRTQKQMQEHVREKRQSFQRHVGSLHGSMGNVGMSVSAQPLLPLGDNHVVGTSASVSCGSMNLFPDDHRSVYSMGRTVSRLRDFDDFSMDSPYSGRRPSSHTAFVPQPCSPGSMDSSPRRLVYGVQHLPNFHHDHLHHQEQDQLGINTLQPNSQRRERAREALLRRNLCDFNVSLESGATNSVSSRTGTTELRTDPTVVPNFSGRMDHQGKNQSQSNTSLHSNQSAKSEDPDSIDHLSSEDNLSHESDKEEE-AQINSFSENMKTVLSRSELSFDNSVSYSQPLSMPPTPNRVEVLDNDPGQSTRDDVNSNVKNKINNHSSTHSSRLSINSSGMSTSPVPDSVNLQKPVS.............................................................................................................................................................................. 731
147 0.000e+00UniRef50_A0A2C9K7Q0 Uncharacterized protein n=2 Tax=Euthyneura TaxID=216307 RepID=A0A2C9K7Q0_BIOGL  ali  22  25..RPMNCKVLLLNGEYEVAIDKRSSGQLLYERVCDYLDLLERDYFGLQYYDPENVKFWLDLSKKVTKQ--KKRGKMEFEFALKFYPPDPTQ-LTESLTRYLVCLQIRRDIISGKLPCSQATHAMLGSYAVQADIGDYDPIDHGTGYIRDMPFAPDQ--------TEDLLYKIAALHKQHKGQTPEQAEMHYLEYSKKIALYGVDLHKAKDSDYVDILLGVGSTGISVYRDNLRIN---RFVWPKILKISYRRNKFLLRIRPTYESWVAFRLPNNKMAKRIWKISVEHHAFLRLRSADDAKKRTGFPRFGSKYRYSGRTLYQTRLNASRPSKQFERTHSRQSLNSVLNNNRSRSLDNLNHRREPFLEQRTMEIQNLSFDTLREERMEIRN-RTVLSRVNEDSFHEDSRNASFIEEDRTPFQSPLPREESPKLITRQVIRQPVPEEDSDLDDRLPAPPKESPEEVRRILP................................................................................................................................................................................................................................................................................................................................................................................... 488
148 0.000e+00UniRef50_A8E6Q9 IP17263p n=4 Tax=Schizophora TaxID=43738 RepID=A8E6Q9_DROME  ali  26  8.SRIMSVRINLLDETFIHEIKDDLPGQALLDVVFARLNLIETSYFGIRYIDEENQTHWLDPASRISRQLKPKSDPYDLYFGVKFYAADPCKLL-EEITRYQLFLQVKQDVLQGRLPVAFELAAELGAFVVQSELGDYDQRRHSKGYVSEFRLLPNQ--------SNELETRVSELHQQLKGMSPSSAELNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNK---TTVAHYYWPRIAKVYYKGRYFMLRISDKNNSTYGFETPRKSACKHLWRCCVEHHAFFRQVRVAPLPSSQSLFQLGSRFRHR............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 316
149 0.000e+00UniRef50_UPI0009E60CB5 band 4.1-like protein 4 n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E60CB5  ali  17  12......CHVLLLDEEHPVEIRKKTKGEEVLVKVFQHLNVLEKDYFGLRYIDRNSQSRWLDPLKPVVKQLT-AGPPYLLYFCVKFYAADPCR-LHEELTRYLFFMQVKKDIYQGRLPCSTNILAEVSAYSIQSELGEYDPQEHTMGYISEFRFIPNQ--------SEELETKIYHRHRKLGTMVPSVAEFMYLDKVKWLEMYGVDLHPVKGEDFVEYFIALKPSGVAVYKNKTRVG---SYLWSKIEKVDFKEKKFYLTVKGKEEYTFKFYLANKTACKHLWKCCLEHHAFFRLDKASATSRRSGLFRMGSSYRYSGRTQREALEDGKRPDPEVKRKPSKRYERRNTQSGERAQSNVTVASATSTSQVQIKRFSQTDNPVTGPNGTGIKTEGDPSSKDGDATAVDGNQGPALPWEQSAQMQGGLYTPAPDSPRSLKSSGSGRAKRSPKFPRPHRRSAGQSSGSETDTPRRRSRRAYSSDDDXXXXXXXXXXXGHHSAESGSDRDSSYSREERRRHRSSKDQADISKMSDAAPYHWNDNRRDRGSGSEDRSHHHHRHRHRTSDGDARSDGSTSRHHHSKVISDDADSEMVPALDVIRSRVAVARVKE.......................................................................................................................................................................................................................................... 615
150 0.000e+00UniRef50_UPI000BE1560C band 4.1-like protein 5 n=2 Tax=Varroa TaxID=62624 RepID=UPI000BE1560C  ali  21  32....LLCKIILLDGTLAIEIPKKALGETLLEQTFYNIDLVEKDYFGLQFIDAFSIQHWLDPTKGVRKQ-HTVGPPYTFHMRVKFYSPEPT-LLREELTRYLFFLQLKQDVLHGRLPCPYDVMVELAGFALQSELGDYEVKTHTAEFISEFRFCPEQ--------SEQMELDILAAFGRLRGQTPAQAELSYLSKAKWLELYGVDMHTVLGKDGYSYSLGLTPTGILVFEGKTKIG---LFFWPKITRLEFKSKKLTLVVVHEQEHTFVFRLFNPKAAKHLWKCAIEHHTFFRLKAPPQQSAKQNLFRMGSRFRYSGKTEFQATARARPRRAQFERRPSQRFSRRQSQRAAKDASTANTNDISKDSAQSCKKADIVNKSICGGSDDSLDMNHTVAELADPEDMDLASSDSSTYSEDDIADSSSLLISP............................................................................................................................................................................................................................................................................................................................................................................................................................ 450
151 0.000e+00UniRef50_A0A0V1N5F5 Merlin n=7 Tax=Protostomia TaxID=33317 RepID=A0A0V1N5F5_9BILA  ali  40  27...CLSVRVTTMDADLEFSVPKKITGRELFELVCRTIGLRETWYFGLQFINKKGYFGWISFDLRITSQDIKKAENYHFYFLAKFFPEDVSEELIQIITQHLFFLQVKQSILNMDIYCPPEASVLLASYAVQAKYGDYCDVNIDICELALEELLPQRVLDQYQMTCEMWEDKIKTWWMNNRRMTKEEAELEYLRIAQDLDMYGMQYFPINNRKESNLWLGVGPLGLNVYEKNNKLIPKASFTWSEIRNIAYKEKKFLIRTLDKNSATVSFTSQNVAVNKVILDLCIGNHSLYLRRRQPDTLEVQQMKAQAKEERLRRQAKYSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXADLLAEKAQISEEEAFVLTKRAADAEAEIQRMRIAAIRNEEEKYSMERKAREAELIAARMVEESESRTREAQKLKNDLMRAYNAEQLAKSKLREVMTSPFSPMPLT------NNFEYPTGQDRVHLTCSPISDHCIFSGMASHTDPVGAERDIK---SLSAEIEKERVEYLKKXXXXXXXXXXXXXXXXXXXXXEQQTDLDRAYQESLQLGDDKYTTLRKSGAGSAKSRVALFDGL............................................................................................................................................................................................................................................................. 630
152 0.000e+00UniRef50_A0A154PTV5 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=3 Tax=Aculeata TaxID=7434 RepID=A0A154PTV5_9HYME  ali  18  35..KMLAVRVQMLDDTITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQEPNGTKYWLDLEKPVCRQVGLSLIDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQD--------QELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHEGVPLNLAVAHMGIVVFQNFTKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVMRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSGGRARGATPSSSLMGSSSISAHPLLPLGDPALETPALSLSCGSMTLDSPTTVTSVSMGGTIHRREDTATSFRTLTSIDVHSPATPSQVQAPRQMLVTSHQRISSAGRISPSNSSPPEFPPPRPMPRHPWQRSASCRELYASSFEDSGKARSKDEKPINAAGETVLLEPFRLPSQGELDNPVTRYDESNRSYSAASSKLPSLDHDSVPERVYSSSYP-GTSSLSTESGHEESGPAGDLDSYELLEREHEFEYPESYSNGDGEDEPISDRSDEGIEREMFQMDAETD-SFVKHRTIKSAEKQQFKSVLADLKATRTKSIDRYTTVTAELDATDYVTVESRIQRSSTQIERK................................................................................................................................................... 737
153 0.000e+00UniRef50_A0A085N8P4 Uncharacterized protein n=3 Tax=Trichuris TaxID=36086 RepID=A0A085N8P4_9BILA  ali  24  26..RPILCDVHFLDGTQVFEVEKHALGQELLERVYDHLELIEKDYFGLQFTDDPGAMRWLEPAKSIRKQMQ--CPPYILHFRVKFYVSDPSKLL-EEYTRYHFYLQLRKDIADGRLICSESSVIVLASYAVQAELGDHNTEEHREAYLETFHFAPNQ--------TPAIMRKVAELHRQHRGQTPADAEYNFLDHAKRLDFYGVDLYRAKDSSMSDVQLGVASFGVGIFQRAVK---TKTFIWSRIMKLSFKRKQFFIQLKSESEAVQCFTLSSTRSSKMLWKSCIEHHTFFRLISPPAPSAKA-LFTFGSQFRYSGRTEHQTLEEMKKRARTFCRLSSSFARSTIASSPYARSQELGAGSPASNCPLPSSCSVARKLKPTTSVDAAAAGAASHRTASS......................................................................................................................................................................................................................................................................................................................................................................................................................................................... 439
154 0.000e+00UniRef50_A0A0B6Z6U0 Uncharacterized protein (Fragment) n=10 Tax=Bilateria TaxID=33213 RepID=A0A0B6Z6U0_9EUPU  ali  27  31...PLKCKVLLLSGELEVSVGKQSVGQVLYENVCDYLDLLERDYFGLQYTESEHVKYWLDLNKKVTKQ--KKSGKMYFEFALKFYPPDPTQ-LAESVTRYLVCLQIRRDIISGKLPCSQATQVMLGSYAVQADIGDYDPIDHGTDYIRDMPFAPEQ--------TDDMLLKIAALHKQHKGQTPEQAELHYLEYSKKISLYGIDLHRAKDSDYVEIMLGVGATGISVYRDNLRIN---RFVWPKILKISYRRNKFLLRIRPKFESWIAFRLPTNKMAKRLWKISVEHHSFLRLRAADDAKKRTGFPRFGSKYRYSGRTLYQTRLNASMA.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 352
155 0.000e+00UniRef50_A0A1S3WMI6 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=10 Tax=Euteleostomi TaxID=117571 RepID=A0A1S3WMI6_ERIEU  ali  19  43..KCLTVHVRLLDDSMELDVEPKCDGQVLLAQLWGRLNLMECDYFGLEFQNAPSCWVWLDPAKPLARQVRRPKNT-VLRLAVKFFPPDPGQ-LQEEFTRYLFALQLRRDLREGRLSCTDTTAALLASHLLQAELGDY-EETLDREHLKAHQYLPSQ---------EHCLEKILEFHQKHMGQTPAESDFQVLEVARKLEMYGVRLHAASDREGARIHLAAFHTGVLVFQGTTKIN---TFNWSKVRKLSFRRKRFLVKLHPEYQDTLEFLLGSRDACKNFWKVCVEHHTFFRLCDQPKPKAKAVLFSRGSSFRYSGRTQKQLVKEGPMRRAPYERRHSRMRACIQETRQSVSFTEGLRTSASPPPADTTPGSLPTSPPRGHLSLQDNSGPQLEPPALDTMRPAAEGSHRPPCQAQTPGAPAGPPSPGTSSEDTQHPPCSRGSRLSLDHTLQDASPLPSP............................................................................................................................................................................................................................................................................................................................................................................................ 494
156 0.000e+00UniRef50_UPI0007E2AB6E microtubule-associated protein futsch-like n=1 Tax=Apis cerana TaxID=7461 RepID=UPI0007E2AB6E  ali  20  43..KMLAVRVQMLDDTITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQELNGTKYWLDLEKPVCRQVGLSLIDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQALLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQD--------QELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHEGASLNLAVAHMGIVVFQNFTKIN---TFSWAKIRKISFKRKRFLIKLHSEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVVRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSRALQGLEGGGYRGATPSSSLMGSSSISAHPLLPLGDPALETPALSLSCGSMTLDSPTTVTSVSMGGTIHRREDTATSFRTLTSIDVHSPATPSQVPAQRQMLVASSQQRISSAGRISPSNSSPPEFPPPRPMPRHPWQRSASCRELYASSFEDSGKARSSVAKDEERGPPTGDHHPVSDLPFRLPSQGELDNPVTRYDESNRSYSAASSKHDSAVVPDRVYSSSYPGTSSLSTESGHEEYELLEREHEFEYPESYSSPRDEEEEGSERSDEGIEHEMFQMDSETD-SFVKHRSIRSTERQQFKSVLADLKKDARTRSTDRYTKSDTDYVTVESRIQRSSTQIERKFE..................................................................................................................................................... 754
157 0.000e+00UniRef50_A0A0A1WT50 Tyrosine-protein phosphatase n=13 Tax=Acalyptratae TaxID=43741 RepID=A0A0A1WT50_ZEUCU  ali  21  29..RQQCVTVLLLDDTHTFRIEKRAKGSELLNQVFQFLELSERDYFGLLFQKPGDVVRWVDAHKQFKKQCNNFALEQTLEFRVKFYVSDPSR-LQEEYTRYQFYLQVKRNILLGRLPCSVNTQCLLASYTVQSELGDFNSAEHQTGYLSAMQLLVEQ--------TPDAERKISELHKLHRGQLPADAEYNYLEHAKRLDLYGIDLHRATDSNGKELQLGVSAVGLLVFQNGLRIN---TFSWSKMVKVSFKRKDFFIQLRREYDTLLGFSMTSHKHAKALWKSCVEHHSFFRLKRPHRLPRFLNI-SLGSKFYYSGRTELQAVQESKQRGIAFIRSPSKRLITAGPTVATSPGLINGTSGSDSNGSVSHNGKITSSALINHTSILTITKTSRPHDNKVTSKQTETMPRKAWEQQSDEYDIQLDTGIIARRFESPIPPAYSSVSHSPILNSNMGPP................................................................................................................................................................................................................................................................................................................................................................................................ 484
158 0.000e+00UniRef50_A0A2K5YVW6 Erythrocyte membrane protein band 4.1 like 4B n=3 Tax=Gnathostomata TaxID=35060 RepID=A0A2K5YVW6_MANLE  ali  22  13...TLYCRVFLLDGTVSVDLPKHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWLDHAKPIKKQMK-----------------------------YLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQ--------TEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIG---LFFWPKITKMDFKKSKLTLVVVREQEHTFVFRLDSARTCKHLWKCAVEHHAFFRLRTPGNSKSRSDFIRLGSRFRFSGRTEYQATHGSRRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVRPSIQDDRSHWKASASGDDSHFD....................................................................................................................................................................................................................................................................................................................................................................................................................................... 394
159 0.000e+00UniRef50_UPI000947E38A band 4.1-like protein 4 isoform X1 n=3 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI000947E38A  ali  17  11..KDIQVQICLLDGTDMVGIKKSSKGQVLLDLVFKKLHLLEKDFFGLRYLDSQDQTHWLEPTKPFSDQMETP-PPYRLYFGVKFYAEDPCR-LHQEITRYQFFLQVKQDILQGRLPCQANEAAQLAAYAVQSELGDFDPRKHTGNYVSEFRFVPNQ--------TEEMEKRIANIHRDLVGQVPSEAELNYLSLGRVLEMYGVDLHRVMGDDHVQYYLGLMPRGVVVYKNKTKVGM---YFWPRITKILFKDRQFFLRVRTKDNDTYTFELSNRAACKHLWKCCVEHHAFFRLNEVADVP-GAKTLSFQSQFRYSGRTAKQAQQDSQQPEPYVERAPSKRFDRRGGDDANGEVYKENPSDITMPTSPDGVTMVMAPEPVSSGKQYANGTAPGSAVSARSLPWEQRDETQGGLFTSGGSPRSTRSVASSKKFPRYPKSGSDSEGPRRRRHRRAYSSGMSSGDDTDAPRRRRSRGRSGQSSGSESEANRKHRKHRSRYSQQMVDS-----------HQQWEEIRKQQEGQEVVGQGVQAAVVKDLKKRHESPHRRKHRSRSRSPDKMKELWKHIQKDPIDTAGMTEDQLKDITYKEVDLPKLKQSPGYRRRRPRSIGRSDQETPHQSDVELKMVPALPITHGYQSGNESV---RSNPAHPPQDDQPPPPYTPPQHSTPRKNPEGRRTANNEQRPISL................................................................................................................................................ 695
160 0.000e+00UniRef50_A0A1Y1LKC2 Uncharacterized protein (Fragment) n=3 Tax=Eumetazoa TaxID=6072 RepID=A0A1Y1LKC2_PHOPY  ali  65  15..KSFPVKVCTLDAELEFNLEWRATGRDLFDLVCRTIGLRETWYFGLQYEDSKGFISWLKLDKKVQDQSIHKDPCTSFMFLAKFYPEEVADELVQEVTQHLFFLQVKQAILSMDIYCPPEASVLLASYAVQAKFGDFDEDTYKPGMLASEDLLPQRVIDQYQMTLDMWEERIRVWYADHRGMSRDEAEMEYLKIAQDLDMYGVNYFPITNKKETDLWLGVTALGLNIYEKENKLQPKTTFTWSEIRHISFDDKKFIIKPVDKNSPNFVFFSQKVRMNKLILDLCMGNHDLFMRRRKPDSMELQQMKAAAKEEK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 327
161 0.000e+00UniRef50_A0A0P5N1U0 Moesin/ezrin/radixin n=25 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5N1U0_9CRUS  ali  61  10.SKCFPVKILTLDAQLEFNLECKANGRDLFDLVCRTIGLRETWYFGLQYEDCKGFLAWLKMDRKVQDQDVPKTTPVPFVFLAKFYPENVAEELVQEITQHLFFLQVKQSILNMDIYCPPEISVLLASYALQAKYGDYDEAAMKPGLLGTEDLLPKRVLDQYQMTAEMWEERIKIWYADHKGLSRDEAEMEYLRIVQDLEMYGVNYFPIKNKRDSELWLGVTALGLNIYEQDNKSVPRINFPWSEIQNISYDDKKFAIKPVDKTAPPFIFYSDKHRVNKLILDLCIGNHDLFMRRRKPDSIEVQQMKAQAKEEKLRRQGER....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 328
162 0.000e+00UniRef50_Q6ZUT3 FERM domain-containing protein 7 n=50 Tax=Euarchontoglires TaxID=314146 RepID=FRMD7_HUMAN  ali  17  1...MLHLKVQFLDDSQIFVVDQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLELLKPITKQV-KNPKEIVFKFMVKFFPVDPGH-LREELTRYLFTLQIKKDLALGRLPCSDNCTALMVSHILQSELGDFHEETDRK-HLAQTRYLPNQ---------DCLEGKIMHFHQKHIGRSPAESDILLLDIARKLDMYGIRPHPASDGEGMQIHLAVAHMGVLVLRGNTKIN---TFNWAKIRKLSFKRKHFLIKLHANCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFRYSGRTQRQLLEYGRKKSLPFERKH---YPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGGGYYQNVNGVHASEPVLESRRRNSALEVTFATELEHSKPEADPTLLHQSQSSSSFPFIYMDPVFNTEPNPNPDPRDIFSERSSLSSFQTSSGNHMSIYSGLTSKVRPAKQLTYTDVPYIPCTGQQVGIMPPQVFFYVDKPPQVPRWSPIRAEERTSPHSYVEPTAMKPAERSPRNIRMKSFQQDLQVLQEAIART-----SGRSNINVGLEEEDPNLE---DAFVCNIQEQTPKRSQSQSDMKT............................................................................................................................................................................................................................... 598
163 0.000e+00UniRef50_A0A091CZF1 Merlin n=115 Tax=Amniota TaxID=32524 RepID=A0A091CZF1_FUKDA  ali  61  19.PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYT-IKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQESTQHLFFLQVKKQILEEKIYCPPEASVLLASYAVQAKYGDYDPSVHKLGFLAQEELLPKRVINLYQMTPEMWEERITAWYAGHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQM...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 321
164 0.000e+00UniRef50_UPI00057B8B12 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=2 Tax=Camelus TaxID=9836 RepID=UPI00057B8B12  ali  18  44.PARLHIRVQLLDDTMEFDVEPGCGGQALLTHVWRRLSLIECDYFGLEFQSAQAHWIWLEPMKPIVRQIRRPKNT-VLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCTDSTAALLTSHLLQSEIGDYDEEL-DRAHLRAHEYLPGQ---------ERALEKILALHREHAGQTPAESDFQVLEIARKLEMYGIRFHTASDREGAQIKLAVSHTGVLVFQSTTKIN---TFNWSRLRKLSFKRKRFLVKLHPEYQDTLEFLLGSRDECKNFWKICVEHHTFFRLSDQPKPKARAVLFSRGSSFRYSGRTQKQLVDYVRVKRTPYERRHSKTRVSLHTLTADLPRQASSRSHSGLLPGFPGASGLRGRRRQPGLVSVGGARSPEPLSIHSDSWVAARPSSSVSPPEDDECPQHPGAAAPAPDAKRPATERSSSPDASQAQPPRPPALQPCQGLSVESPLPSPSAQKSPPSLSPASQVPLGPAEQGLSPVLSDAGGAGMDDQEEPRHECPPE................................................................................................................................................................................................................................................................................................................................ 571
165 0.000e+00UniRef50_UPI0009361C57 uncharacterized protein LOC109402890 isoform X1 n=4 Tax=Stegomyia TaxID=53541 RepID=UPI0009361C57  ali  21  53..KKLAVRIQMLDDTVTFQVQAKALGKVLFEQVCRQLNLLEADYFGLEYQEAPGTKYWLDLEKPLNRQVGLSLIEPMLRFCVKFYTPDPLQ-LEEEYTRYLFCLQIKRDLATGSLQCNDNTAALMASYIVQASCGDYAPEDYPDHYLSSYRFVPQQDHT--------MQRRIMENHKKHIGQSPAEADLNLLETARRCELYGMKMHPAKDHEGVPLNLAVAHMGIAVFQGITRIN---TFSWAKIRKISFKRKKFLIKLHPEHKDTVEFFFEGRNECKNFWKKCVENHGFFRCSTQNVQRRKARVLSRGSSFRYSGKTQKQIIEFVRGKRQTFQRSQSFRQGPLHSS---NRSQSRTSCNVNQSISAHPLLPIETAEWERRSQSNALRTPSQMRKPVDTGEDHRPGSPTGLANRSQLTEAQVETYPTRTYAQTGPSAGPMGTSSAVDHHQGGHLQQDSSRSSSPYHPSNSSHVREADRVRVRQDGLSSGLSHHHYATMSPSYIHRSHKYTTQPQQRRASAGPLGQPGDRSSSMGETTVSSTSRESVLSPADIR.............................................................................................................................................................................................................................................................................................. 606
166 0.000e+00UniRef50_A0A0G2K095 Radixin n=38 Tax=Bilateria TaxID=33213 RepID=A0A0G2K095_RAT  ali  79  1MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVXXXXXXXXXXXXXXXXXXXXXHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDNFVPSTLFPLTKEAKVAHCDEIFLIKMIDFQSDDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQM...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 305
167 0.000e+00UniRef50_A0A1I8G0M1 Uncharacterized protein n=6 Tax=Bilateria TaxID=33213 RepID=A0A1I8G0M1_9PLAT  ali  74  1MGKPINVKVTTMDAELEFSIQSNTSGKQLFDQVVKTIGLREIWYFGLRYIDSKGFPTWLKLNKKVMQQDLPKEAQMVFEFRVKFYPEDACEELIQDVTQRMFYLQVKEAILNGDVFCPPETAVLLASTACQVKFGDYNPEVHTAGFLSREKTIPVHVLEKHSLTKGDWEEKIVNWYKEMRGRMKEDAMLEYLKVAQDLEMYGVNYFEIKNKKGTDLFLGVDALGLNIYAKDDKLTPKIGFPWSEIRNISFNDKKFVIKPNDRRAPDFVFFASRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAKEDRANKQFEK....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 322
168 0.000e+00UniRef50_E9IXH3 Uncharacterized protein (Fragment) n=2 Tax=Myrmicinae TaxID=34695 RepID=E9IXH3_SOLIN  ali  64  11..RSFPVKVCTLDAELEFNLEWRSTGRDLFDLVCRTIGLRETWYFGLQYEDAKGFISWLKLDKKVQDQGISQQSTTSFMFLAKFYPEDVAEELVQEVTQHLFFLQVKQAILSMDIYCPPEASVLLASYAVQAKYGDYDEVSYRPGMLASEDLLPQRVIDQYQMTPEMWEDRIKIWYADHRGMSRDEAEMEYLKIAQDLDMYGVNYFPISNKKETDLWLGVTALGLNIYEKENKLAPKTTFTWSEIRHISFDDKKFIIKPVEKTSPNFMFFSQKTRMNKLILDLCIGNHDLFMRRRKPDSMEVQQMKAQAKEEK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 355
169 0.000e+00UniRef50_UPI000D72570E band 4.1-like protein 4 isoform X1 n=3 Tax=Pomacea canaliculata TaxID=400727 RepID=UPI000D72570E  ali  16  33LPKCF---IHFLDDSHQLPFKGSWKGCQLLEKVYDMLNLHEKDYFSLRFIDSSGQTHWLDGNKTLSSQFKGCFNPYKLYFGVKFYAADPC-KLREEITRYLFFLQVKQDILQGRLPVTFDEAAELCAYAVQSELGDFDPRHHTPGYVSEFCFVPNQ--------SEELERKIAAIHRRLGGLVPMMAEYRFLDKVKWLDMYGVDLHPVMGEASVEYFLGLTPTGIVVYKNKNKVG---NYFWPRINKVTFRGKIFIIKVKDKNEHAYAFELPRKAACKYVWKCCVEHHAFFRLNQQERSFRQVRITRSFSANHGSGRTQRQAFSDNSRQSSAVVRLPSRRQPRRVSSDSRLNAHGQYESQYHKDSGMVTMVIRPEPVRGPRHRSLPELQGHESPRSTKSAPWEGKLDYGLYTGGRESPLSAPSDRMNQQRNRGVSGSDSESGISQRRKYFPNRRGSDNDSDASMSRRRRREIDSDSGSDVSSRYHTTRSNNEKSTKTSFPVLYPFHDKDSKQNGSVPSLHSAPAGETRQRRRRRRSKSPGKKPP--EELRRHFEYDLKDTEGMSQEQLREIPFVNVETKSSFFKLKYSPQKVKASKQKNAEGLDQNRNEILHRQTSAPSTDACDKSSVRQSQHTDTDAG........................................................................................................................................................................................................ 662
170 0.000e+00UniRef50_A7T1E3 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7T1E3_NEMVE  ali  25  5..KSFNCTVQVLDSDYECPIDKTTKGDHLFDQVCDHIGLAEKEYFGLRYIDEKGQFNWLEGDRSIKRQMGK--APLHFYFAVKFYPENPTT-LREDITRYQFVLQLREDLLKGRIQCSNPIHALLASYVMQAELGDLHPEEHEVAYLSDLKFFPKQ--------PPELRQKIEAFHRKHVGMTPSDAEFQYLDNVRKLPLYGRDMYQAWGDEGQAVTIAISAWGVEVFQNNRQMH---RFVWPKIISIGFKSKKFSLTLRAPSEDTIYFKCGSQRAAKRVWKVCVEHHAFFRLKEPVPLPKNTNFFKIGSKFRYSGRTQHQARNNESREQPSFDRVSSKRFSLRVLDSNRKSMLIDDDAKKEPKSPEHPVTPVEPAQEEKKEDEKPVTDSQEPDQTQKEDEQAAPPSQQQAEPE......................................................................................................................................................................................................................................................................................................................................................................................................................................... 414
171 0.000e+00UniRef50_UPI000A1BE2C9 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Odocoileus virginianus texanus TaxID=9880 RepID=UPI000A1BE2C9  ali  21  47.....QLRVQLLDDSIEFDVEPKCDGQVLLTQVWKRLNLIECDYFGLEFQNVQSCWIWLEPMKPIIRQVRRPKNA-VLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCTDTTAALLASHLLQAEVGDYDEAL-DREHLRAHEYVPRQ---------ERALHRILAFHRELAGQTPAESDFQVLEIARKLDMYGIRFHSASDREGAKIKLAVSHTGVLVFQSSTRIN---TFNWSRLRKLSFKRKRFLIKLHPEYQDTLEFVLGSRDECKNFWKICVEHHTFFRLFDQPKPKAKAVLFSRGSSFRYSGRTQKQLADYVKDKRVPYERRHSK---TRMSLRALKVDLPRQSLSFSEGVRTPVTPSPTATSFCSAPASPPAPPGLHDSQVGGGSSETGPPAPGAWWPAAEKSSVVAAQPPRPPALQPHQ.................................................................................................................................................................................................................................................................................................................................................................................................................... 466
172 0.000e+00UniRef50_A0A2B4SZL5 Radixin n=5 Tax=Eumetazoa TaxID=6072 RepID=A0A2B4SZL5_STYPI  ali  74  1MPKVLNVRVTTMDAELEFAIQPSTTGKQLFDQVVKTIGLREIWFFGLQYTDTKGYETWLKLNKKVQSQDVKKESPLQFKFRAKFYPEDVSEELIQEVTRRLFFLQVKEDILAERTFCPAETAVLLSSYALHAKHGTYNSDVHSPEFLKHERLVPERFITNKLI--DDVTGRVSVWWGEHAILSREDAMIEYLKAAQDLEMYGVNYFDIKNKRGTELFLGVDALGLNIYEKEDKLTPKIGFPWSEIRNISFNDKKFIIKPIDKKAPDFVFYAARLRINKRILALCMGNHELYMRRRKPDTIEVQQM...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 303
173 0.000e+00UniRef50_UPI0008FA4360 band 4.1-like protein 5 n=1 Tax=Cyprinus carpio TaxID=7962 RepID=UPI0008FA4360  ali  23  43....ITCRVSLLDGTVSVDLPKKAKGAELFEQIMYHLDVVEKDYFGLRFMDSAQVPHWLDVTKSIKKQV-KIGPPYCLHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECPFDTAVELAAYALQAELGDCDPAEHGLDLVSEFRFIPNQ--------TEEMEASIYNMWKECRVQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGVLVFEGETKIG---LFFWGK-----------------EQEHTFVFRMDHPKACKHLWKCAIEHHAFFRLRGPVQSSARSGFIRMGSRFRYSGKTEYQTTKANKRRSSSFESP----YKSSDNHNNGVSPRLETKPFQTRTPWSGMPVVSSPPSAPPPMEIETLPRSPGGSQSDKRRSCMMQADS............................................................................................................................................................................................................................................................................................................................................................................................................................................... 418
174 0.000e+00UniRef50_UPI000742BCFD band 4.1-like protein 4B isoform X1 n=2 Tax=Cyprinodon variegatus TaxID=28743 RepID=UPI000742BCFD  ali  18  66...TISCRVLLLDGTVSVDLPSKSKGQDLFDQIMYHIDLVETDYFGLQFMDTDQVSHWLDMSKLLKKQVQ-EGPPYRLFFRVKFYSSEP-NNLREEFTRYLFVLQLRQDILSGKLKCPYDVSVELAAYCLQGELGDCDPLEHSPELVSEFRFTPKQ--------SEAMEADIFSRWLELRGQSPSQAEISFLNKCKWLELYGVDMHFVKGRDGGEYALGLTPTGILVFEGSNKIG---LFFWPKITRLDFKKSRLTLMVVREQEHTFVFQLASAKSCKHLWKSAVESHAFFRLRQPTAGKSRSDFTRLGSRFRFSGKTEYQATHGGRRRASTFERRPSKRYPSRTQSLGKVAISPAKP--------LHISSHASPDLSPHAALHDPLQYQHNIPIGHEAWHPHHPALTLPVYLQPSAHTPSHSFPLSSSAS---DHQYSSSENENSYSGKTHHRHRRHTHSQDMLCHTHTKNKRRAPPSPSDGMDVSHSLLKALETDSDSTPWPTLHINIDNKGEEKQLSEKSLHPP........................................................................................................................................................................................................................................................................................................................ 599
175 0.000e+00UniRef50_A0A287AYQ7 FERM, ARH/RhoGEF and pleckstrin domain protein 2 n=4 Tax=Cetartiodactyla TaxID=91561 RepID=A0A287AYQ7_PIG  ali  25  42....LQVRVELLDGTVEFAVEPKCTGQTLLTQVWKRLNLIECDYFGLEFQTLQSRWVWLEPVKPIVRQVRRPKSA-ALRLAVKFFPPDPGQ-LQEEHTRYLFALQLKRDLLEERLTCTDATAALLASHLLQSEIGDYD-ETLDREHLRAHEYLPGQ---------ERALERVLQLHRQHVGQTPAESDFQVLEIARKLEMYGLRFHAAADREGAGISLAVSHMGVLVFQSTTKIN---TFNWSRVRKLSFKRKRFLIKLHPEYQDTLEFLFSSRDECKRFWKICVEHHTFFRLCDQPKPRAKAVLFTRGSSFRYSGRTQRQLADLVKAKRVPYERRHSKMRAPLRTPTADAPRPSISFTEGLRT........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 394
176 0.000e+00UniRef50_UPI000A178D41 uncharacterized protein LOC100648719 isoform X5 n=3 Tax=Bombus TaxID=144708 RepID=UPI000A178D41  ali  21  43..KMLAVRVQMLDDTITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQEPNGTKYWLDLEKPVCRQVGLSLIDPILRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQD--------QELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHEGVPLNLAVAHMGIVVFQNFTKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVVRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSRALQGLEGGGYRGATPSSSLMGSSSISAHPLLPLGDPALETPALSLSCGSMTLDSPTTVTSVSMGGTIHRREDTATSFRTLTSIDVHSPATPSQVPVPRQMLAASQQRISSAGRISPSNSSPPEFPPPRPMPRHPWQRSASCRELYASSFEDSGKARSKDDKPSDDPILEPFRLPSQGELDNPVTRESNRSYSAASSKLPSLDHDSVPERVYSSSYPGTSSLSTESGHEESGPAGDLDSYELLEREHEFEYPESYSSPRDDDDENEDRSDEGIEHEMFQMDSETD-SFVKHRSIKS........................................................................................................................................................................................................ 690
177 0.000e+00UniRef50_UPI0009482903 FERM domain-containing protein 5-like n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI0009482903  ali  21  21.....QCTVRLLDDTIQCDIQKDSKGQFLIDHVCGNLNLLEKDYFGLRFVDAEKQRHWLDPIKNVCKQM-KSNPPFLLCFRVKFYPPEPS-KLHEEITRYELFLQLKRDLLHGRLLCSTEDAAHLGAYIIQAELGDYDQDDHPQGYVSEFKLFAKQ--------SAKLEQKVAELHRDHRGQAPAEAELNFLRKVKELETYGLDPHPVKDVLGSQMYLGFTHQGVVIFQGNKK---THFFKWKDVQKFTYDSKSFHIYIVNEKKQIYDFRCTTPAAVKHLWKCAVENHAFFSFEKSSDTLQRSGLFLRGSRFRFSGRTEKEVSAESSRQEPQVVRSPTKPELVAKKKKAGEEEEEGETSESSPLNETFHDALKELQPIGTSTPIKSLQLNANSLTTTHKDSSPSPVAYSPCVSEPTTPEETSKNQNLLAKESLPNGHHSSN.............................................................................................................................................................................................................................................................................................................................................................................................................. 454
178 0.000e+00UniRef50_UPI0007B91371 FERM, RhoGEF and pleckstrin domain-containing protein 1-like n=1 Tax=Sinocyclocheilus anshuiensis TaxID=1608454 RepID=UPI0007B  ali  22  34MPRLVPIRVLLLDDSEEFDISHRASGRVLFEMVCLHLNLIEGDYFGLEFQSHHRKMVWLDLLKPIRKQITRPKHT-VLRFVVKFFPPDHTVLL-EELTRYLFALQVRQDLASGRLTCSDASAALLVSHIIQSEIGDF-EETQCRQHLLNTNYIPDQM---------ALMDKIMEFHHKHIGQSPAESDYRLLEVACRLEMYGIRLHPAKDREGTKLSLAVAHGSVLVFQEHNRIND---FNWSKIRKLSFKRRRFLIKLRADNQDTLEFLMASRDCCKMFWKICVEYHAFFRLFEEPRPKPKPVLFSRGSSFRFSGRTQKQVIDYVKEKKLPFDRKHSRVQYSSSLSPLRHQVPNQSVKQCWEGSFLVSSEDSAVVRPGGNSSPSTQRNGCSDQTYPIQEDSSSPAAKQPPVDQAEVTC.................................................................................................................................................................................................................................................................................................................................................................................................................................... 448
179 0.000e+00UniRef50_H0YXU2 FERM domain containing 7 n=8 Tax=Amniota TaxID=32524 RepID=H0YXU2_TAEGU  ali  25  1...MLHLKVQFLDDSQIFVVDQKSCGKGLFNLTCSHLNLVEKEYFGLEFHSQAGNQVWLEPLKPITKQV-KNPKEVLFKFMVKFFPVDPGH-LREELTRYLFTLQIKKDLAQGRLPCSDKSAALLVSHLLQSELGDFHEET-DQQHLATHRYLPNQ---------EYLDNKILRYHRRHRGKSPAESDVQLLDVARKLEMYGIRPHPASDGEGTQINLAVTHMGVLVLRGNTKIN---TFNWSKIRKLSFKRKHFLIKLHANCKDTLEFTMASRDTCKAFWKTCVEYHAFFRLSEEPKSKPKALLCSKGSSFRYSGRTQRQLLELGRKKSLPFERKH---YTSRYDERQCRSSPDLLTDVS.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 348
180 0.000e+00UniRef50_A0A1S3IK89 FERM, ARHGEF and pleckstrin domain-containing protein 1 n=1 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3IK89_LINUN  ali  17  13..KMMNIKVLMLDDEQIFQLPVKATGSLLRDQVIRHLNLVESDYFDLEFTGQNGVQYWLDPEKLILKQVSSH-HNLTFRFSVKFYTPDPG-LLEEEFTRYLFALQVKRDLNQGILPCNENTAALLAAYIAQAEIGDFLEEDYLDHYLQTFHFVPNQ--------TDELEVKVMEYHKTLLGQTPAEADFNLLDTARKVELYGLRMHPAKDNEGVPLNLAVAHLGIMVFQNSTKIN---TFSWAKIRKLSFKRRKFLIKLHPEHKDTVEFCFDSRDECKNFWKKSIEHHAFFRCQSVRTPRHKTRVISRGSSFRYSGKTQKQLLDYVREKREPFERTVSVRSTRSVGATPTTSTMNSRDLNYSRGGMSNHNLNASTRVETAEVHDDSSQSDVTSQSPKAKRVDVSQIPVPPEPSQPQRSPHKDFDRKMSAPVLTTLQQEEIEHQMDEPHLARSPEVANIPDSLRHPNDHQLTRTEDIENIPEEVGEPLDTSPVVTPPVSKGMIRAHSETEAQMRHDNNKAMFEYPPANYAPISEENAVEEEEEPPLDMSPDDTKATMTTTTFITSYDEEQPFSRSPPTPPPPLDEREIPVAPVQPRLKTFSVEPRENG--HTMREEKTERTEVVRRERAQLSSKMSPATTSSQGSVSLSSSRTED-SEEEVRRKRFPPD........................................................................................................................................................................... 687
181 0.000e+00UniRef50_A0A1S3KKC6 FERM, RhoGEF and pleckstrin domain-containing protein 2 isoform X1 n=44 Tax=Euteleostomi TaxID=117571 RepID=A0A1S3KKC6_SALSA  ali  20  50....LQLRVQGLDDSQEFNLESRADGQTLLSDVFRRSNLMESDYFGLEFQNMQMSWVWLEPTKLVVKQVKRPMNTL-FRLSVKFFPPDPGQ-LQEEYTRYLFSLQMKRDLLEGKLSCTENTASLLASHLLQSEIGDYD-DVADRDFLKLNKLLPNQ---------ERIQERIMELHHRHLGQTPADSDFQVLEIARKLEMYGVRFHPAADREGTKINLAVAHIGLQVFQGNTKIN---TFNWSKIRKLSFKRKRFLIKVHGPHQDTLEFQMVSRDQCKIFWKNCVEHHSFFRLLDQPQPKSKAILFSRGSSFRYSGRTQKQLVEYVKDRRTPYQRRNSKVRMSTRSLAPDVPKQTLSFNDSLRAPGSPSSATGSFHSIHVSSSPLRPEPQTQSPQPPPQSQAQSSQPPPQRQAQSPQLPPQQQQTQLLPPQLARPSSPPAKEDPHKATGIPPCHHAFSQGSSMDSPQLSPFSSKSSPLC........................................................................................................................................................................................................................................................................................................................................................................ 517
182 0.000e+00UniRef50_A0A1W4XRA3 FERM domain-containing protein 5-like isoform X1 n=4 Tax=Holometabola TaxID=33392 RepID=A0A1W4XRA3_AGRPL  ali  20  14....FKCTVRLLEDTLECEYKPNQKGKHLLEYVCQQLNIAEQDYFGLRYVDSSQQRHWLDLGKSITKQV-KDMQEVLFSFRVKFYPPDPF-KLKEEITRYQIFMQLKRDLLHGRL-CSPNESIMLAALIIQGELGDYDPEVHVGNYVSSFRILLKQ--------TEQNEEKIMEIHKRLKGQSPSQVENKFLKIASQLDTYGVDPHPAKDHKGTQLYLGINYSGILTFQGSRK---THHFRWPDIQKINYEGKMFIIHLNYEKKHTIGFKCATGASCKYVWRCAIEQMLFFTLPCSSDAPPVGGFFSWGTKFKYTGRTEREILEDANRKEPKVQRTSSISRKAASVPATPSTPLQPHLGYNTVPCSSHSDGGGFMAEPSSTLDGSSTHSCGDVAGLQTVSEDHESSGALKNSLEQFSEYNFRDSFDHSSSESQLHESSNYRSLDSSYSHRCNYNQALQFHPRTGSHM.................................................................................................................................................................................................................................................................................................................................................................................... 478
183 0.000e+00UniRef50_A0A158NTJ5 Uncharacterized protein n=18 Tax=Aculeata TaxID=7434 RepID=A0A158NTJ5_ATTCE  ali  19  43..KMLAVRVQMLDDSITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQEPNFTKYWLDLEKPVCRQVGLSLIDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQD--------QELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHENVPLNLAVAHMGIVVFQNYTKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVVRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSRALQGSEGGGYRGATPSSSLMGSSSISAHPLLPLGDPALATPAQSLSCGSMTLDSPTTVTSVSMGGTIHRREDTATSFRTLTSIDVHSPATPSQVPAQRQMHATSQQRISSTGRISPSNSSPPEFPLPRPLPRYPWQRSASCRELYASSFEDSGKARPRDDKVTADLPLDPFQLASQGELDNPITRESNRSYSAASSKLPSLDHDSVPERVYSSSYPGTSSLSTESGHEESGPAGDLDSYELLEREHEFEYPESYSSPHDEPISDQSDEGIEHEMFQMDSETD---SFVKHRS-LKPSEKQQYRSAFTDLKNSKIK-SIDRYSAVSKVDNDFVITESRIQRTGTQIERKFETRHANSVEQPPKTG................................................................................................................................... 752
184 0.000e+00UniRef50_T1IUU4 Uncharacterized protein n=2 Tax=Mandibulata TaxID=197563 RepID=T1IUU4_STRMM  ali  16  9..KFVDCKIILLDGTLNQSVKAEAAAQRLLDGVFQHLNIIETIYFGLRYLDDSNQSHWLEAEKKICKQLRKNLF-FTLYFSVKFYASDPC-KLAEEITRYQFFLQLKQDILQARLPVSFEVGTELSAYIIQSELGDYDPRRHLYGYVSEFHFLPAQTM--------EMENKISEIHKTLIGQIPSAAELNFLEKAKWLDMYGVDLHPVLGEDNMEYFLGLTPCGVIVLRNKTKVG---NYFWPRITKVYFKGRYFMIRVKDKDENTYGFELPTKQACKHLWKCCVEHHGFFRLAQVNIAPLDGSF--RFSTFRSSKRFQ-NRSEVIARPPQPIQRVPSQRSYRRL-------PPSDGIDNNQKQPGDPPTTIPSGSNNNTTFKSGDSPRSTRSAPWGSVKLSKGLYSSSANPSPRSVR---------SKHSVRTRSTHHFSSVESESSCDERSHSSRRRHKSGHGSDSSRTSNRSRKKNRRKDRGSDSEFIVKHRRRHHISATSTESITPQWCEI----QEQSVRLHDAVIKNLNSHRSGYMNSGMESETEVNYNQRKKHKRRSLTQSR--SSADSYKRFPEELRKHFQYVDSSGFSEDQLKDIPYTKVLTRNSSHSHRSPNTPKSRK................................................................................................................................................................................................................... 599
185 0.000e+00UniRef50_A8X7Z5 Protein CBR-FRM-2 n=14 Tax=Rhabditida TaxID=6236 RepID=A8X7Z5_CAEBR  ali  19  50..KFVQCKVLLLDGHLNIVVPRNAIGSELHEEVFYSLDLEERDYFGLQFTDQFNVQHWLDPCKKVAKQVA-IGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHPLGIELAALALQSELGDYNPEQHTALFISEFRFHPEQD--------EKMEIEILEKYKACRGQTPAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIG---LFLWEKLQKLDFKNKKITLVVEEDADHTFVFHLTSEKAAKHFWKCAIEQHAFFRLSRPVQPNRKMQFFRLGSTFKYRGRTEYETIHKSRRQSCSFERRPSQRYGPRQSHVTNAQMRDAKXXXXXXXXXXXXXXXXXXXXXQRSHAQSDPLPPLPPVSNLPIPSSPNLKKPLINNNNPFIGDXXXXXXXXXXXXXHVTKITVGTIGGGTSETSPSSSYIPRPVVSGSSSFSHPPPLPAHQSSSKIPRMSSSTDPRKYSQPPQPAVRMQNHFDDSRKFSQNGCAIPSRIVPPMQHQ................................................................................................................................................................................................................................................................................................................... 583
186 0.000e+00UniRef50_Q4T9L4 Chromosome undetermined SCAF7537, whole genome shotgun sequence (Fragment) n=1 Tax=Tetraodon nigroviridis TaxID=99883 RepID=Q4T9L4_TE  ali  18  1.................CVCQKHCKGLELFMKVCDHLNLLEKDYYGLAVWESPVRKTWMDLTKEIRRQVQ--GAVLNLTFNVKFYPPDPAQ-LSEDITRYYLCLQLRQDILQGHLPCSFVTLALLGSYALQSELGEYDPDLHGADYAKDMKMVPGQ--------TKELEDKMMELHQTYRSMSPAQADLMFLENAKKLSMYGVDLHPAKDLDGVDIMLGVCSSGLMVYKEKLRIN---RFPWPKVLKVSYKRSSFFIKIRPSYESAIGFKLPTYKAAKKLWKVCVEHHAFFRLTATEATHTPRKFLALGSKFRYSGRTQAQ----SRQASSLIDRPAPLFQRSSSKRNTHSLDGASTPDSRTPRPF----SAPVMSPLSPGEPSPSPVPSDPRGPAPREQRCADRKAEGPESTRGHDLQPQPTPETKTTPARRERRQPPSGSSSAGRREPSSQKVRFQSAPDLPFWKRVKKPEGETIYIKHSNLMLEDLEKTQTQTRHHNSISELKRSFMESLPEARPSEWDKRLSGSSRTVSTVSAGEQLQPSSPVLKTQTITISDVTEALRGVVVYRDAPLGHSETKTGSYESAQ------------TVKGGISETRIEKRIVITGDTEIDHDKALAQAIKEAKEQHP....................................................................................................................................................................................................... 664
187 0.000e+00UniRef50_UPI00072E5AEA FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Acinonyx jubatus TaxID=32536 RepID=UPI00072E5AEA  ali  18  49..KHLHLRVKLLDNSMEFDIEPKRDGQTLLTQVWRRLNLTECDYFGLEFQHPRAYWIWLEPMKPITRQIRRPKNAL-LRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLPCADTTAALLASHLLQSEIGDYD-ETLDREHLKVNEYLPSQERS---------LEKILEFHRKHTGQTPAESDFQVLEIARKLEMYGIRFHAASDREGAKINLAVSHMGVLVFQGTTKIN---TFNWSRVRKLSFKRKRFLIKLHPEYQDTLEFLLGSRDGCKNFWKICVEYHTFFRLFDQPQPRAKAVFFSRGSSFRYSGRTQKQLVDYVRDKRVPYERRHSKTRMSIRALTADLPRQSVSFTEGLRTSASPSSADASF----CSVPTSPLALRGLPDFRDSRGSLTEPQAPDTKRPAAERSSPAVSEEFIDDDPADISFF-AGGSEAFSFPYCALAPQAPPCGHPNSTPSSPDRYPPGVIPMHVEHGFEFEGEDGFGGNVHPSDTSELFEVKAQASLMQSLLSASETSSLRNNQSENSSLSHLPLHSGLSVRTPQSEASSMANCPACSVRSEASSAFRLSDVIDQLEQLSYPPTTAEDSS.................................................................................................................................................................................................................................................. 635
188 0.000e+00UniRef50_UPI000B90D266 band 4.1-like protein 4 isoform X1 n=3 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B90D266  ali  17  9..KDAYCSIRLLDETLTVNVQRNTRGSELLNQVFDKLNLLEKDYFGLRFLDSQDQTHWLDPVKAIGKQI-KNGPPFILYFGVKFYMENPC-KLKEEVTRYQFFLQLRMDMLQGRLPCPFHATAELCAYATQSELGDYDPSQHSVGYISEFRFIPNQ--------TEELEQQITQLHQKLKGMEPAKAEVSFLERARWLDMYGVDLHPVLGHNGVEFYLGLTPSGVVVYKNKAKV---ARYFWPRIAKVHFKDTEFSLVVLDKDEDECIFRLASRSACKHLWKCCVEQHAFFRLPKAGEESPHQRKLSFKSSFRHIGRTQREALEAASRPEQQVIRAPSRKYHRR-------PSQTDISLKNGMASDDMCLDSSPSSPNGVILRLSPQPACRLPSHHGLSGRESPTSGVSTRSVPWEDCQQARVGLFTPAGGSPVSVRSSASRQHRHRGRSKSPGPHHRHGDRSDCESEAAYGSRRRSRRSAGLDAGSDHESRHHHQHRKRRSRSRGVSSGSESEYSRQDEGRRHQRRSRERMVSSEDQWHAVEENKLVRGELREGQEVVV-----KRLKDGALANNLKHMEFQKHIKKDLVDQAQYTEEERSGIPYVVLDSGPVNSSNPIRDSHSRTRSKRNEDFSDSNISEHSTRHQSRNTSSKSHQHIRKMKKSQAPTQPDGTP................................................................................................................................................................... 666
189 0.000e+00UniRef50_UPI000614A74B nucleoprotein TPR-like n=1 Tax=Megachile rotundata TaxID=143995 RepID=UPI000614A74B  ali  20  43..KMLAVRVQMLDDTITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQEPNGTKYWLDLEKPVCRQVGLSLIDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVLEDYPDHYLSTYKFVPHQD--------QELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHENVPLNLAVAHMGIVVFQNYTKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVVRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSSGRARGATPSSSLMGSSSISAHPLLPLGDPALETPALSLSCGSMTLDSPTTVTSVSMGGTIHRREDTATSFRTLTSIDVHSPATPSQVPAPRQMLVTSQQRISSAGRISPSNSSPPEFPPPRPMPRHPWQRSASCRELYASSFEDSGKARSKDEKASGEANSFEPFCLPSQGELENPVTRYGEESNRSYSAASSKLPSLDHDSVPDRESGHEESGPAGDLSHDDLSHD-SYELLEREHEFEYPESYSSPRDDD-----EEENEPISDRSDEGIEHEMFQMDSETD-SFVKHRSIKSS....................................................................................................................................................................................................... 694
190 0.000e+00UniRef50_A0A1D2N223 FERM, RhoGEF and pleckstrin domain-containing protein 1 n=2 Tax=Hexapoda TaxID=6960 RepID=A0A1D2N223_ORCCI  ali  25  85..KLIALKIVLLDDSVTIQAQSKALGRVVFDQVCKQLNVLEADYFGLD--SRSSTVYWLDLEKRLTRQVAFNISDPVLRFSVKFYTPDPSQ-LEEEFTRYLFSLQIKRDLQAGILVCNDNTAALMASYIVQAECGDFSEEDYPDSYLSLYKFIPHQDY--------EIERKIRENHKKHIGQSPAEADLHLLETARRTELYGIRMHPARDEDGISLNLSVCHNGLLVFQNFTKIN---TFSWAKIRKLSFKRKRFILKLHP--EDLVEFIFDSRNECKAYWKRCVEHHAFFRCEKAPNPIHRSKLSSRGSSFRYSGRTQKQMVQFVREN--FVKRPTPMGVRSRASPPTGNVLVPDVSSSDNNSFDNS....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 436
191 0.000e+00UniRef50_A0A226MTS4 Uncharacterized protein n=3 Tax=Galliformes TaxID=8976 RepID=A0A226MTS4_CALSU  ali  20  49..RDLQIKIKMLDNTVELDIESKYYGQALLTEVYKHLNLIESDYFGIEFQNIQSYWIWLEPMKPVIKQVRRPKTTM-LRLAVKFFPPDPGQ-LQEEYTRYLFALQIKRDLAEERLTCSDNTAALLVSHLLQSEIGDFDESE-DREHLKINRYLPNQ---------ERIQGKILEFHRKHVGQTPAESDFQVLEIARKLEMYGIRFYLASDREGTKINLAVSHMGVLVFQGNTKIN---TFNWSKVRKLSFKRKRFLIKLHPEYQDTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKPKAKAVFFTRGSSFRYSGRTQKQLVDYIKDKKTPYERRHSKVRVSTHASNPDVPKQSVAFPEGLRTPGSPASATVPFHSVHSSAAPTVLPIFAESSPSSLEPRAPYSR................................................................................................................................................................................................................................................................................................................................................................................................................................................. 445
192 0.000e+00UniRef50_UPI000A2C0C52 FERM domain-containing protein 5-like n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=UPI000A2C0C52  ali  19  16......CTIRLLDDTLQCDFQSEQKGQFLLDYSCNALNLLEKDYFGLRYVDAQKQRQWLDLTKSIIKQV-KGMNPIIFCFRVKFYPQEP-YRLKEELTRYQIFLQLRRDLLHGRLYCSQSDAAMLAAYIIQSELGDFDSDEHPPTYVSEFKLLLKQ--------TQRLEEKIAEIHQQLRGQVPAVAEMNFLRKACLLDTYGVDPHPVKDHKATQLYLGINYAGILTFQGSRK---THHFKWPDIQKINYEGKMFIVHLRTKKKHLVGFKCPSQGACHYLWKCAVEQRYFFTMESSPQVTTSGGLFSRGCKFRYSGRVEKEIAEDTKREQPQFQRSLTRPSSFRKFIDGYSNSPSSSPQKDHLMNDYNNMLYSNHTTSITHASLNDQENLQMNHNLNSPPQSNNPTDGLDVLEEECDSYSPTDTILSESPSFSSNQVSCNNSLTCQNSEEGLRDDSDTTED.......................................................................................................................................................................................................................................................................................................................................................................................... 472
193 0.000e+00UniRef50_U4UCW6 Uncharacterized protein n=14 Tax=Polyphaga TaxID=41084 RepID=U4UCW6_DENPD  ali  24  27........ITMLDGSVTLNIDRKAKGRDLLDKVCEAINLIEKDYFGLVYADRYDPRNWLELDKRIAKFMKSK---------------------------YQLCLQIRNDILNSRLPCSFVTHALLGSYLAQSELGDYDPETMPRNYLKDFKIAPSQN--------QDLEDKVCELHKTHKGQTPAEAELHYLENGKKLAMYGVDLHSAKDSEGVDIMLGVCASGLLVYRDRLRIN---RFAWPKILKISYKRHNFYIKIRPQFESTIGFKLANHRAAKKLWKTCVEHHTFFRLMSPEVNQRNSLFPRLGSKFRYSGRTHYET------RKTPIERPAPQFERSLTGKRLTSRSMDPLSGVIPDDEYNEANKRHTMSHPPDHIP........................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 362
194 0.000e+00UniRef50_F6SBE3 Erythrocyte membrane protein band 4.1 n=11 Tax=Euteleostomi TaxID=117571 RepID=F6SBE3_ORNAN  ali  24  199..RNMNCRVSLLDGTYECVLE-----------------------------------TWLDSAKEIRKQV--HGAPWNFTFSVKFYPPDPAQ-LTEDITRYYLCLQLRQDIVTGRLPCSFATLALLSSYTVQSELGDFDPELHGDDYVSDFHLAPNQ--------TKELEEKVSELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHQAKDLEGVDIVLGVCSSGLLVYKDKLRIN---RFPWPKVLKISYKRSSFFIKIRPQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLT-STEAVPKNRFLALGSKFRYSGRTQAQT----RQASALIDRPAPQFERTTSKRVSRSLDGATAAAEGTPGRSPRPKSAPAIAQS--HVAEGGVPGTSRKPGMSRVDGEVAKADRKLEESQAHQAIPESSEVRKDXXXXXXXXXXXXXXXXXXXXXFMESVPEPRPSEWDKRLSTHSP................................................................................................................................................................................................................................................................................................................................................................................ 618
195 0.000e+00UniRef50_UPI0006D527D5 uncharacterized protein LOC103569367 isoform X2 n=1 Tax=Microplitis demolitor TaxID=69319 RepID=UPI0006D527D5  ali  20  42..KMLAVRVQMLDDKVTFQVQAKALGRVLFDQVCKQLNLLEADYFGLEYQEPNGTKYWLDLEKPVCRQVGLTMVDPLLRFCVKFYTPDPGQ-LEEEFTRYLFCLQIKRDLAHGLLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQDH--------ELERRIMENHKKHSGQSPAEADLNLLETARRCELYGMKMHQAKDHEGVPLNLAVAHMGIVVFQGYTKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFDGRNECKNFWKKCVENHGFFRCSVKRVLRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSRALQGSEGGGYRGATPSSSLMGSSSISAHPLLPLGDPALGTPHLSLSCGSMTPDSPTTVTSVSMGGTSHHRRDDTAMSCRTLTSIDVHTPATPNQVPGRHITAQQQQRITSSTGRISPSNSSPPEFPPPRPLPRHPWQRSASCRELYATSFEDSGRARQPRNDKLEAGLADTFQLPSQGELDAPVTRYDESNRSYSAASSKLPSLDHDSVPESSSYPGTSSVSTESGHEESGSHDSYELLEREHEFEYPESYSSPHEDDDEQEALSDQSDEGIEHEMFQMDSETD-SFVKHRSIKS........................................................................................................................................................................................................ 690
196 0.000e+00UniRef50_A0A0A9YV69 Band 4.1-like protein 5 n=4 Tax=Arthropoda TaxID=6656 RepID=A0A0A9YV69_LYGHE  ali  21  33...CVQCRVLMLDGTLSIDLTKKAVGSDLYEQVFYSLDLIEKDYFGLQFTDANNVQHWLDPTKAVKKQV-KIGPPYTLRLRVKFYSSEP-NSLREELTRYQFFLQLKQDLLDGKLECPDNLAIELSALALQSELGDYDDTVHTPAFISEFRFVPNQTEEMELLILEEF--------QKCRGLTPAQAETSYLNKVKWLEMYGVDNHTVLGKDGCEYSLGLTPTGILVFEGPQKIG---LFFWPKIGKLDFKKKKLTLVVVREQEHTFVFRLHNEKACKHLWKCAVEHHAFFRLRAPVKPSARQNFFRMGSRFRYRARTTTQA-EHHEPAQSPSPASSVVSAGPVAEERLDVLLKSLAKDNPGNSLEDKNDSSSIISSKTDTAKVEEELRKSPLPTVVETPSPQEPPTSLLDISIEDLPGETKPHHP............................................................................................................................................................................................................................................................................................................................................................................................................................. 452
197 0.000e+00UniRef50_P11171-5 Isoform 5 of Protein 4.1 n=107 Tax=Euteleostomi TaxID=117571 RepID=P11171-5  ali  24  208..RNMHCKVSLLDDTVECVVE-----------------------------------TWLDSAKEIKKQV--RGVPWNFTFNVKFYPPDPAQ-LTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQ--------TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRIN---RFPWPKVLKISYKRSSFFIKIRPQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLT-STDTIPKSKFLALGSKFRYSGRTQAQT----RQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRS---PRPTSAPAITQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKDXXXXXXXXXXXXXXXXXXXXXFMESVPEPRPSEWDKRLSTHSPFRT............................................................................................................................................................................................................................................................................................................................................................................. 627
198 0.000e+00UniRef50_A0A0K0JJB4 Bm5541 n=13 Tax=Onchocercidae TaxID=6296 RepID=A0A0K0JJB4_BRUMA  ali  24  44..KHCQCKVLLLDGTMNIVIPKNAPGRELYDQVFYALDLEERDYFGLQFMDHYHVQHWLDPVKRINKQV-PIGPPYTFRFRVKFYSSEP-NNLREELTRYQFFLQLKQDIQTGKLECPKDTAIELAAFALQSELGDYNSVEHTLAVISEFRFHPAQD--------EEMEIAILEKFITCRGQSPATAEINYLNKAKWIELYGVDMHTVEGKDGNLYSLGLTPTGMLVFDGVQKIG---LFLWEKIQKLDFKNRKITLVVEEDADHTFVFNLSSHKACKHLWKCAIEHHTFFRLKHKPRIAKTSQLFRLGSTFRYRGRTEYENVHKSRRQSATFERRPSQRYPRQSLMNKRIQLRNDFKKQIGVSVGLPVSVPISLEESCIAANSDTP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 431
199 0.000e+00UniRef50_UPI000D726907 FERM domain-containing protein 5-like isoform X8 n=6 Tax=Pomacea canaliculata TaxID=400727 RepID=UPI000D726907  ali  22  14.....TCSVRFLDDEMQFTFKKDTIGQWLLDRVCEKLNLMEKDYFGLRYVDAEKQRHWLDPLKTVYKQL-KGVNPMVLCFRVKFYAEDPM-KLHEEITRYYLFLQLRRDLHHGRLLCAPEDAISLAAYIVQSEVGDYDPQDHQPGYISEFKMLPKQ--------TPKLEERVMELHKSLHGQVPSDAEANFLRKACTLDTYGVDPHQVKDQRGDQLYLGITHQGIMTFRGSRR---TQLYKWGQIRRIAYEGKMFIAHVVNEKQQPVGYKCLTPAGAKYLWRCAVEQQLFFTLNSAPKMRSGGTLFSRGSKFRFSGRCQYEASEHIRRTEPKFQRSSSLPNFARRNTGNSRNSTISHKDVSTLNDSVQDTALHRRP............................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 379
200 0.000e+00UniRef50_O57457 Band 4.1-like protein 4 n=9 Tax=Euteleostomi TaxID=117571 RepID=E41L4_DANRE  ali  18  11....FYCEVLLLDETQQQGIKKSTRGSVVLDYVFSHVNLAETEYFGVRYCDRSHQTFWLDPSKTLAKDLIATGPPYTLYFGVKFYAEDPG-KLKEEITRYQFFLQVKQDVLQGRLPCAFNISAQLAALAIQSELGDYDPYKHTAGYVSEYRFVPDQ--------KEDLEDSIEQIHKTLLGQVPAEAENNYLAIAKTLEMYGVDLHPVFGEKQAEYFLGLTPVGVVVYKNKTQVGK---YFWPRITKVYFKETQFELRVRDCNETSFFFDAASKTACKNLWKCCVEHHTFFRMPSNSLTRKLSKFSSLGSKHRYSGKTARESTETLPRADLQVIRTRSKTYPKRSTQPAGRNNGGQAVTKMENTSEGQPKTSALTPVKSPRVKAESASVQQEKPSAPW----------------EEDAPQSGLYNSASERNKSPKFPKAHRRSPSGGSENEPRHRRGQTADDAQANKQHRRRSRSRGNTSSGSESENSNREHRKKRNRSRQSNEMVDSAPQWEVVLRRQKEKTPNDPNQRRSRHRSRSRSPDVQAKEQLWKHIQKELVDPSGLSEEQLKEIPYKKVETQGDPIKIRHSHSPRSFGST.................................................................................................................................................................................................................................................. 592
201 0.000e+00UniRef50_K7G5W0 Neurofibromin 2 n=9 Tax=Deuterostomia TaxID=33511 RepID=K7G5W0_PELSI  ali  61  12...................CEVKWKGKDLFDLVCRTLGLRETWFFGLQYT-IKDTVAWLKMDKKVLDHDVPTEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHQRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLSPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRL.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 314
202 0.000e+00UniRef50_A0A0D8XVU7 FERM central domain protein n=16 Tax=Protostomia TaxID=33317 RepID=A0A0D8XVU7_DICVI  ali  26  28....ITCTVTFLDSTRQFHIDRHACGAVLLEKVFDHLELIEKDFFGLQFLSKETQKRWLDPMKSIRKQM--ICPPFHLLFRVKFYVSDPS-KLCEEYTRYHFFLQLRHDMLEGRLPCAEGSLALLASYAVQSELGDYSPSDHPEGYLNQYRFAPSQSIDFPK--------KVAELHAMHKGQSPAEAEYNFLDHAKRLDMYGVELYPARDGKNLPIGIGVNSYGMVIFHEGSKINE---FAWSTIIKISFKRKNFYVQIKFAEQNTLSFQVNSSPTCKQLWKTCIEHHTFFRLIAPPIAPPR-GILSIGSKYRYCG........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 333
203 0.000e+00UniRef50_UPI000BB083B1 band 4.1-like protein 3 isoform X1 n=4 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BB083B1  ali  24  32..KMVLCRVLLLDGDFETEISRNAEGKELFDEICERLNINEKEYFGLTYTGAQDVKYWLNHDKKIAKQV--KSGTWVFEFAVKFYPPEPSH-LAEDITRYQLCLQIRADIYNGKLPCSFMTHAILGSYTVQAEIGDYDPQEDGPGYLKAFDFAPQQ--------TDELSKKIHELHKTHKGQTPEEAELNFLENAKKLAMYGVDLHKAKDSENRVIMLGVCASGLQLYREKLRIN---RFVWPKIIKLTYKRNNFYIKLRPEQETTICFKLDSHKLAKRLWKTCVEHHTFFRLKEPEKNSTGTLIPRFNSRFRYSGRTQKQIREQMDRPKVKVERRNSFRMPRDAEGHLIRPVGEGGNDSYDRTDKLAGQTDTMSSGPPPYSSMDRQGKHSKKPGETDADRPDTTEDR............................................................................................................................................................................................................................................................................................................................................................................................................................................... 435
204 0.000e+00UniRef50_A0A164QLV4 FERM, RhoGEF and pleckstrin domain-containing protein 1 n=1 Tax=Daphnia magna TaxID=35525 RepID=A0A164QLV4_9CRUS  ali  19  22.SKILVVRVQMLDDTVTFQIQAKAMGTVLFEQVCQQVNLLEADYFGLEYTSSENVKYWLDLEKPMNRQLEMSLTDPLLRFAVKFYAPDPAQ-LEEEFTRYLFCMQIKQDLAQGTLQCNDKTAALIASYLVQAECGDYVAEDYPDHYLSSYRFVPHQD--------PELERRIMENHKKHIGQSPAEADLNLLETARRCELYGVKMHPAKDPEGVPLNLAVAHMGVLVFQNFAKIN---TFSWAKVRKLSFKRKKFLIKLHPEYKDVVEFCFECRDECKNFWKKCVEHHGFFRCPTAKEPRPKPGVLSRGSSFRYTGRTQKEIVEFVREKRQSFQRSQSFRHTSPHHTVGTSLSVHPLLPVGDNVIVANDTVSPGSSAAISDSRARSISTPERTETVDVHHSREPRSASGHRDVDVEREMEVESPVTSNNSASSSSPQHPPYQYHQQPQQTPSGVFHSLPRTAGSSSSASPCSSPSLTNSPDRGSPLPVPQSASMQFQISSRSHSQSGGSQDESSLSSSEYTDPNTFPTEVAVGRDMTVSALEDPVSRDSYELLSESEP......................................................................................................................................................................................................................................................................................... 589
205 0.000e+00UniRef50_UPI000A2A473C FERM domain-containing protein 5-like n=2 Tax=Hexacorallia TaxID=6102 RepID=UPI000A2A473C  ali  21  16......CKISLLDDTMTCEFRREAKGQTVFDSVCKSLDLLEKDYFGLRFVDDSKQRHWLDLNKNILKQMKSLKPPFKLFFRVKFYALDP-NLVHEEITRYQFFLQIKRDILHGRLLCSYNELAELGAYIVQAELGDYDSEDNQEGYVSEFRIVPKQ--------SEKLEKKIGEIHKQLVGQVPSVAEKNFLGKVKNLDMYGVDPHPCKDQDNVQLYLGLTPTGIAIIRDGKKV---SGFDWPQIVKCSYDGKVFYIQVKEERKANYGFRLPDPLACKHLWKCSVEHHAFYSSQNPKEIKPKRRTLFRRSKYKYSGPTQEDVIEKISRPEPEIKRTPSIRITRRPKTPAADNISESTGDLALPSNPVQNSTSQLNADQSTELQKFETPHFPEIPPEDSAITETTTDLTDAEPTPTNVSNSIVAERPKPLRTSHESTKQAE............................................................................................................................................................................................................................................................................................................................................................................................................... 448
206 0.000e+00UniRef50_E2BV71 Merlin n=53 Tax=Bilateria TaxID=33213 RepID=E2BV71_HARSA  ali  46  15..KSFPVKVCTLDAELEFNLEWRSTGRDLFDLVCRTIGLRETWYFGLQYEDAKGFISWLKLDKKVQDQGISQQPTTPFMFLAKFYPEDVSEELVQEVTQHLFFLQVKQAILSMDIYCPPEASVLLASYAVQAKYGDYDEVSYRPGMLASEDLLPQRVIDQYQMTPEMWEDRIKIWYADHRGMSRDEAEMEYLKIAQDLDMYGVNYFPISNKKETDLWLGVTALGLNIYEKENKLAPKTTFTWSEIRHISFDDKKFVIKPVEKTSPNFVFFSQKVRMNKLILDLCIGNHDLFMRRRKPDSMEVQQMKAQAKEEKQRQRRSEETADLLAEKS------------RVAEEEAMLLSQKXXXXXXXXXXXXXXXXXXXXXKVHLERKTREAELLTERLXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXLLEFLSRNAYSATIPPVSNLFPSTQVLPSDLQADLQNIQLDAEPLPDLRSYDLIAEGDVDQLS--LEIEKERVDYWEKSKHLQEQLRELRSEIEVMKVGEKQCELDQLHEEQVR-----------------LGENKYSTLKKVKSGSTKARVAFFEEL............................................................................................................................................................................................................................................................. 564
207 0.000e+00UniRef50_A0A0S7KDA8 FARP2 (Fragment) n=4 Tax=Cyprinodontiformes TaxID=28738 RepID=A0A0S7KDA8_9TELE  ali  21  50....LQIRVQGLDDSQEFVIDPKLPGQNLLSEVFHRGNLIESDYFGVEFQNMQMNWVWLEPTKPIARQVRRPANTL-FRLSVKFFPPDPGQ-LQEEYTRYLFSLQMKRDLMEGRLICTENTGALLASHIVQSEIGDHDDAA-DREFLRANKLLPYQDKVQ---------ERIMEFHRRHLGQTPAESDFQILEIARKLEMYGVRFHPAADREGTKINLTVAHMGLQVFQGNTKIN---TFNWSKIRKLSFKRKRFLIKLHPEHQDILEFMMASRDQCKNFWKICVEYHSFFRLFDQPEPKTKAILFTRGSSFRYSGRTQKQLVEYVREKRTPYQRKNSKRMSARSFTSDMPKQTLSFSDSPRAPCSLSSTAESFLPAHMTRPRTEIHPQLQPFSALSPSPAQQPLQSPAGAARPPSPPKEDSVKAVLPSHFSLQDSVMDNPQLSPLTSKGPLSLSPSFQMSTLSLPPSQAPSP.............................................................................................................................................................................................................................................................................................................................................................................. 514
208 0.000e+00UniRef50_A0A2D0R3H3 FERM, RhoGEF and pleckstrin domain-containing protein 1 n=8 Tax=Neopterygii TaxID=41665 RepID=A0A2D0R3H3_ICTPU  ali  21  34MPRQIAIRVRMLDDSEEFDVSQRASGKVLFDLVCAHLNLVEGDYFGLEFQDQHKMTVWLDLLKPIMKQMKRPKHT-VLRFVVKFFPPDHAQ-LMEELTRYLFALQIRQDLASGRLTCTDSSAALLVSHIIQSEIGDF-EETQCRQHLLNNNYIPDQM---------ALMDKIMEFHHKHVGHTPAESDYQLLEVARRLEMYGIRLHPAKDREGTKLSLAVAHTGVLVFQGHTKINA---FNWSKVRKLSFKRKRFLIKLRPDCQDTLEFAMASRDCCKIFWKICVEYHAFFRLFEEPKPKPKAVLFSRGSSFRFSGRTQKQVIDYVKEAEHPFNRKHSKVQYNSNLSPLPSPAHSQVPNQVDGRSWKEPVLVSSEDSAALRICGSPPPSSQQSDGVLSEACVRQQSGELSTAEVPGLSVSLVNGHRHAHELNGASPSPDDQQPSPLTSPLLNDASTLRTDDEEENRRKRFPTDK............................................................................................................................................................................................................................................................................................................................................................................. 503
209 0.000e+00UniRef50_R7TG22 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7TG22_CAPTE  ali  17  38....LLCKVYLLDDALIVELSKKAIGEELYEKILKHLDLIEVDYFGLQYTDHQNVNHWLDPSKPIKKQLKSAGPPFTFRLRVKFYPSEP-NNLREELTRYQLFLQLKQDIYAGRLTCNFDTCAELAGYALQSELGDYEDGVHDVGFVSEFHFTRDQ--------TPELEQEILTKYRSCQGQTPAQAELNYLNKARWLEMYGVDMHIVMGRDGKVYHLGLTPTGILVFEGENRIG---LFIWPKMTKLDFKKKRLTLVVVYEQEHTFVFKMTNDKACKHLWKCAVEHHSFFRLRGPRGQASRQSFIRMGSRFRYSGRTEFLANTNTSRRSVRFERKASQRYSRRPVFDKRDRLIQASVRVRHPTASSVSDVTEDAPASGLPRATTPVAISNGPASEASTPVGGAAAAASVSPLERLDNLIKGPSAGAAAAGPAPSPNSLPPHPGRAPVANERRTSSTTIKEESEMAQAKIKGLDEPGPCKAPVRKDVNTFINNQLKFSHSHGPNAIPASQMKCNILKAAAAQENKNTEKELPDDANDLSERKEAKISNTDQQRHGKN.......................................................................................................................................................................................................................................................................................... 606
210 0.000e+00UniRef50_UPI000CEF9F65 protein 4.1 homolog isoform X1 n=3 Tax=Cimex lectularius TaxID=79782 RepID=UPI000CEF9F65  ali  18  1...MLTILVRKLDGDVNVQAERKDKGEVVFDKVCESVDLVEKDYFGLQYEDKMGVTNWLDLNKRLGRTM--KSDHWEFQFAVKFYPPDPSQ-LQEDVTRYQLCLQIRNDILTGKLLCSFVTYAMLGSYLVQSELGDYSPEEYPDSYLKNFRFAPDQ--------TPQLEAKVMELHKTHKGQTPAEAELHYLENVKKLAMYGVDFHPAKDSEGVDITLGVCSTGLLVYHERLRIN---RFAWPKILKISYKRNYFYVKIRPPYENTIAFKLDSHRAAKRLWNVCVEHHTFFRLMTPEDVARPGLIPGLSNKFPSLRKTHYQTKRNTIEREPPSSFRKSQRYPTSKSLDPLVEQPSNRENKRHTMPPENTQTSPVKREKEDGDSVSASSQEGDFSIDERIPGAVPVLPVGEFRKKEREQKENGVANESDDEKENRNKEDNRYKEEKKSKKSTGLGLFKKNEGKRDKMEEIGVKREYEYDYEGDEPTSRKRSPKGFSYEKRNVEDYAEEEEYEEGMERRSPTKGRTYAFNYAPELDNKSPEPEEKHSSLSGFFKKKKKDDSSSPKRDSPLSTFLVGKSKDK-DSSAKDKSKESDSPAKDKSKERDSPAKDKLKEKDPSLKEKLKDKETSFSFKMKDKEASSKDKSKNKESTSKDKSTDKDSPAKDKLKE............................................................................................................................................................................ 659
211 0.000e+00UniRef50_F1NKS0 Erythrocyte membrane protein band 4.1 like 4A n=36 Tax=Euteleostomi TaxID=117571 RepID=F1NKS0_CHICK  ali  17  7VPEEFYCEVLFLDETQQQGIKKSTKGSVVLGYVFRHLNLVEIDYFGLRYCDRNHQTYWLDPAKTLAKELINTGPPYTLYFGIKFYAEDPC-KLKEEITRYQFFLQVKQDILQGRLPCPVNTAAQLGAYVIQSELGDYDPYKHTAGYVSEYRFVPDQ--------KEELEDAIERIHKTLMGQVPAEAEANYLEVAKSLEMYGVDLHPVYGENKSEYFLGLTPIGVVVYKNKKQVGK---YFWPRITKVHFKETQFELRVKDCNETSFFFEARDKITCKHLWKSCVEHHTFFRMPENESNSLSRKFSKFGSKHRYSGRMSFQMT---RDPSIQLPRPDQCIERSRSKTYPKRTQQTGSSGINQITTDNEGTTKIIAPSPVKSFKKMKNENSPETQRSKVSAPWEENGQQSGLYNSPSDRNKSPKFPYSRRRNPSGGSENECGQPVRRRKTQNSGEDSDLKHRRR---------SRSRCNTSSGSESENSNREHRKKRNRLRQENDMVDSAPQWEAVLRRQKEKTQADPNY...................................................................................................................................................................................................................................................................................................................... 526
212 0.000e+00UniRef50_V5GQF7 Tyrosine-protein phosphatase non-receptor type 4 n=4 Tax=Polyphaga TaxID=41084 RepID=V5GQF7_ANOGL  ali  31  36..KGLNVTVRFLDDTHVFHIEKRAKGAVLLEQVYQHLELVEKDYFGLQYSDDSEWMRWLDPSKSIKKQLGNCQYP--LYFRVKFYVSDPS-KLQEEYTRYQFYLQLRRDILEERLHLPPSTAILLASYTVQSELGDYQPEEHGPNYLSNMQLVPGQ--------TEEIERKISELHKLHKGQLPADAEFNFLDHAKKIEMYGVELHKAKDNANKELQLGVTHIGLVVFQNNIRINV---FSWSKIMKISFKRKQFFIQLRREYDTLLGFNMETYRSCKTLWKACVEHHTFFRLHSPR.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 329
213 0.000e+00UniRef50_UPI0005CF8031 uncharacterized protein LOC105368349 n=1 Tax=Ceratosolen solmsi marchali TaxID=326594 RepID=UPI0005CF8031  ali  19  42..KMLAFRVQMLDDSITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQESNGTKYWLDLEKPVCRQVGLSLVDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQDN--------ELERRIMENHKKHAGQSPAEADLNLLETARRCELYGIKMHPAKDHEAVSLNLAVAHMGIIVFQHYTKIN---TFSWAKIRKISFKRKKFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVMRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQSSRALQGSEGGGYRGATSSSSLLGSSSISAHPLLPLGDPALETPALSLSCGSMTLDSPTTVTSVSMGGASHRREDTATSYRTLTSIDVHSPATPYSQGQVPLHATXXXXXXXXXXXXXSSTGRISPSNSSPTEFPAPRPLPRYSWQRSASCRDLYATSFEDSGKARTSSEKVKDSNLNLGDFQLPSQAELENPVTRYDEINRSYSAASSKLPSLDRDSVPDKIYSSSYPGTSSLSTESGDSYELLERENEFEYPESYSSPQDENEQISDQSDEGVEPEIFQMDSETD-SFVKHRSIRS........................................................................................................................................................................................................ 697
214 0.000e+00UniRef50_A0A2A3EN60 FERM, RhoGEF and pleckstrin domain-containing protein n=2 Tax=Apis cerana TaxID=7461 RepID=A0A2A3EN60_APICC  ali  20  43..KMLAVRVQMLDDTITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQELNGTKYWLDLEKPVCRQVGLSLIDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQALLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQD--------QELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHEGASLNLAVAHMGIVVFQNFTKIN---TFSWAKIRKISFKRKRFLIKLHSEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVVRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRISPKRTIVGRGGAKPPTTVEIKSPTSKETVTWKAQRSQKQETEIGGGGDRERKSGQTPVLFARARLGLSEGSGIGALQRQGATQSPTSQRRAKSLDAPVIAVHKLPPVNAFSSKDDTVEEAAEEGGKSEEAARHAATAPSKAQVAQSIQVEVSPNHSTTTTTTDHTTVPEIFTDSLSVTETSAQYLESPLTECNEIVASADLIPYERDAVRLEANDTMLESVKVDERTRFIDQSSVESGEQEARMGEKIDLLTVSRTVDSSIPRRSSSDEETREERRTRGEVIEVDLPDVTVTAATMET--ITFPKSIDLDDGQDMVKSP........................................................................................................................................................................................ 696
215 0.000e+00UniRef50_A0A146XAR1 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=9 Tax=Cyprinodontiformes TaxID=28738 RepID=A0A146XAR1_FUNHE  ali  20  48..RGLQIRVQGLDDSQEFDVDPKSLGQTLLSEVFHRGNLIESDYFGLEFQNMQMTWVWLEPTKPIARQVRRPANAL-FRLSVKFFPPDPGQ-LQEEYTRYLFSLQMKRDLMEGRLICTENTGALLASHLLQSEIGDYDDGAVDREFLRANQLLPYQDKVQ---------ERIMELHRRHLGQTPAESDFQILEIARKLEMYGVRFHPAADREGTKINLTVAHMGLQVFQGNTKIN---TFNWSKIRKLSFKRKRFLIKLHPEHQDILEFMMASRDQCKNFWKICVEYHSFFRLFDQPEPKTKAILFTRGSSFRYSGRTQKQLVEYVREKKTPYQRRNSKVRMSARSYTSDVPKQILSFSDSPRFPCSTTESFPPAHMTRIFPQTELPPQHQPVSVLSQSPAPPQQQQPPPLQHPLGAARPSSPPKDQVKALPPSPFSFQDSVMDNPQLSPLTSKGPLCLSPSFQMSTLSLPSQAPSPLQSPILSEVGS............................................................................................................................................................................................................................................................................................................................................................... 528
216 0.000e+00UniRef50_UPI00054D4399 uncharacterized protein LOC104965577 isoform X1 n=5 Tax=Notothenia coriiceps TaxID=8208 RepID=UPI00054D4399  ali  17  1....MQCKVTLLDDTFECELDKHAKAQELLTKVCDHVNLLERDYFGLANWENPSTCTWMESTKEIRKQV--PGAVYEFTFSVKFYPHDPAQ-LTEDLTRYFLCVQLRKDIMRAVLPCSFVTLSMLGSYTAQSELGEYDPELHGEDYVSDLSLAPGQ--------SKELEDKVMELHRTYRAMTPAQADLMFLENAKKLAMYGVDLHQAKDLDGVDITLGVCSSGLMVYKDKLRIN---RFPWPKVLKISYKRSSFFIKIRPQYESTIGFKLPNYKASKKLWKVCVENHTFFRVP-TVEPPASRRFLVLGSKFRYSGRTQAQT----RQASSLIDRPAPRFTRSASKRLSRNLDGAGDETLQLLQHLSASTRSDVDDWLLMLTSDKPQPSPDLPARGESEQISIQEQEQSVHSWQGTGTGQTGSQTIAQTASLPGQELTSDKQQQRGKEDEWSALLGRYPPFPFVSPLDFSKQPVXXXXXXXXXXXXXXXXXXXXXXXLRMADQDLTSEEVFESLRETEILLDQLKMADVLEWKLREXXXXXXXXXXXXXXXXXXXXXXXXELGKEEVEMLREGDLDQENGMQVERIVESVLRKSVKSMETKEDGVDELE-EQIKQVFLKGILPEEEE--SQIKQESEKEMTGEGPSDDSLREELCQIEKKWQDEMEDKLKAGSPDVTSVVTHRNVERRIKKRVT................................................................................................................................................. 675
217 0.000e+00UniRef50_UPI000BA7FE4E uncharacterized protein LOC106459951 isoform X1 n=2 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA7FE4E  ali  19  34..KMLSVRVQFLDDSLDFQVQFKALGKVLFEQVCKVLNLLEVDYFGLEYPDAYGVMYWLDLEKPICQQNSLSLVNPIMYFCVKFYTPDPAQ-LEEEYTRYLFSLQIKRDLTQGTLVCNDNTAALIASYIVQAECGDFDPEDYPDHYLSSFRFVLHQDF--------AFEKKIMENHKKHVGQTPSEADLNLLETSRKCELYGIKMTPAKDQEGVPINVAVAHMGILVFQNITRIN---TFSWAKIRKLSFKRKKFLIKLHPEYKDTVEFYFERRNLCKNFWKKCLENHGFFRCTEVHKPRHKTRIFSNGSSFRYSGRTQKQMSEYVRKKRHPFQRSTSLRLKRSCYRDIGSIGTSV----SAHPLLPVSDRMMNDFSSGNVAPSKQTRISQLTSFYVNNQGFESVVANGAVHGEVDVSTNQTSLLSSHDLEKRSQSYNHLASSPRPFQWEVSTSRSLHLSQNSSVNRLCNCKENSTNMCLFEDKPKNSKNMLELEIGKHNQICWNCGIRNNQQQFQRKGRVGKGSDLESSCCSVYLKDQKLSPLLSDMVETRTDMEKHVTHSAKRNVFFKGQQSVQSNLADTSKYSITCLSSGVPKVPDSLKSEERRTSRELVQNDDSNKHFTEETVDLSPGREAVSHGVLETPLPSHDLSQVLPVKR..................................................................................................................................................................................... 695
218 0.000e+00UniRef50_UPI000B9829E0 band 4.1-like protein 4A n=1 Tax=Nilaparvata lugens TaxID=108931 RepID=UPI000B9829E0  ali  17  41.......................SRGQEVLDTVYRHLNLLETSYFGLRYIDTSNQTHWLDTTKKVVKQL-KGKETFTLYFGVKFYAADPCKLL-EEITRYQFFLQVKQDILQGRLPVPFDLAAELGAYVVQSELGDYDPRRHSPGYVSEFRFLSNQSV--------ELEGKIAEQHKDMQGQLPSVAELNYLDKVKWLEMYGVDLHPVLGEDNVEYFLGLTPTGVIVLRNKNKV---ANYFWPRITKIYFKGRYFMLRVCDKNENTYGFETPSKPACKHLYKCCVEHHAFFRLVQVSPNPPD----VIGTRFS-SGRAEKQREAQMRLRSPPFTRTPSRRYQRRIVEGAQIPKVDEMPKSNKENIPVHEMKHISVPQPVQSVASLYRGAPVMPSSRGCDSPRRNRSGPWGAHGGAPSPRSVRSQPHSHQRKQARRSSSVESHSSNDSRSCRRHRHRSRRGSDNESELSRCSGKXXXXXXXXXXXXGSEHESRRHSSSKHRYELVESESQWKEVQRKQAEGSSGVHHANXXXXXXXXXXXXXXSGYMNSGMETESEHSYHHRRKHRKHRSRSRSPSDKPRLELKQHLEFQLVETAGMSESQLREIPYKVVETTSAKAAVKVRLSPTNKRRTHSSRRINSGTLKEEELPSTGD............................................................................................................................................................................................ 666
219 0.000e+00UniRef50_J9JXV0 Uncharacterized protein n=1 Tax=Acyrthosiphon pisum TaxID=7029 RepID=J9JXV0_ACYPI  ali  19  46..KMLNVRVQMLDDSVTFQVQTKADGSVLFEQVCKQLNLLEADYFGLEYQEGS-TKHWLDLEKPLNKQIGLSLVEPLMRFCVKFYTPDPAQ-LEEEYTRYLFCLQVKRDLSHGHMQCNDNTAALMASYIVQAECGDYSADDYPDHYLSSHKFVPHQDR--------EMEIRIMESHKRHIGQTPAEADLNLLETARRCELYGIKMHSAKDPEGVPLNLSVAHLGVLVFQNFTKIN---TFSWAKIRKLSFKRKKFLIKLHPEFKDIVEFIFETRNDCKSFWKKCVENHGFFRCTVKRLPRQRTKVLSRGSSFRYSGKTQKQMVEFVREKRQTFQRSQSFRHPGLSHSSNAGCSLSAHPLLPLAN-SEVTSLAGSLSPNAVHRQVVPGEVSTAQVVHPTTVMTTTSDITSITSSQHSYSVNDPGQKHSAVNNIIM-----YPNVICTRPCTRTNVIRSNYYEDDYDTDKSYASSRFSETFYKDIRCQSSQTDLILIDKSTPSIYSWQRSSSCKEFNSSRSCSGETPPVENEEVNSSFDRNSSVDHPITKIFSSSYPGTTSSLSTESGSDRKLEITGNVRVVPDKDDMYQDDISQDSYELLEKEVFNNTIKPKYR.................................................................................................................................................................................................................................. 647
220 0.000e+00UniRef50_D6WK31 Uncharacterized protein n=2 Tax=Tribolium castaneum TaxID=7070 RepID=D6WK31_TRICA  ali  18  49..KMLAIRVQMLDDTVTFQVQAKATGRVLFDQVCKQLHLLEADYFGLEYIDVNGTRYWMDLQKPISRQLGLSLVDPLLYFCVKFYTPDPGQ-LEEEYTRYLFCLQVKRDLAQGLMQCNENTAALMASYIVQAECGDYVSEDYPDHYLSSYKFVPQQD--------QEMERKIMENHKKHSGQSPAEADLNLLETARRCELYGIKMHPAKDHENVPLNLAVAHMGIIVFQNYTKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSSKNVSRHKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSASFRHSSAHSSASNMHSSTVGNSISAHPLLPLADSTLSVEASKLSASLSSMADARTITASPTTRSASHRPVTATSWSSAPDTRPIHAQTTTSPSPPLTTQSASPPTSATTSPLHTDHLKGGFASSPVAVRAAVHRADTGTIIHTTAVRMPSSHKSDGQSPPFTNHYHPPSQTQSQNDLGLRPNQAQTQTSPEYAYKSIIALPKRQLWQRSASCRDLYDFSFEDSGQAKRRAVKPPKPAEKTASCDNRK--------LDSPITRYDDHHAIYSTSSRDSSLEIHQDIMMPDQKVYSSSYPGTTTYSQESMEDPGNYDLRDSQDDLSHDSYELIEKSDDDYSTSGD............................................................................................................................................................... 719
221 0.000e+00UniRef50_F1KTU8 Tyrosine-protein phosphatase 1 n=1 Tax=Ascaris suum TaxID=6253 RepID=F1KTU8_ASCSU  ali  19  28..RTIVCTVHFLDDTRNFEIDRHSRGQALLDKVFEHLELVEKDYFGLQFINLPGVRRWLDPTKSIRKQMLY--PPYRLFFRVKFYVNDPA-KLVEEYTRYHVFLQLRKDLLEGRLTCPESTSALLGSYAAQSEFGDYSSDEHGSDYLDGFKVIPEQ--------SASFLKSVAELHKLHKGQSPAEAEYNFLEQAKKLELYGVDLYPAKESSGTSIGVGVSSSGVLVFRSGHR---EALYPWSSIMKLSFKKKLFSVYMRTLNEDNVEFNVQNPESCKALWKSCIEHHTFFRLIVPPTAPPKS-IFSIGSRYRYSGRTEFQSMEEMRRRERTFQRHGSRGSRATVTGTCSTSRTHTPSNITGTSPDLTSRLFSRSQTWCRKLPRRKSTIMFMSSKGRRLPPKPXXXXXXXXXXXXLTAQSLFSSPSSCSKSNNSKDSESAAPSTRRVSPSRRDVNPRIQDTSRVPPIQGSSFPSAYHRCPRETTFGIDEDGTWQS........................................................................................................................................................................................................................................................................................................................................................ 521
222 0.000e+00UniRef50_V5GLV9 Uncharacterized protein (Fragment) n=1 Tax=Anoplophora glabripennis TaxID=217634 RepID=V5GLV9_ANOGL  ali  24  2.......................................................................KVDPWRFSFEVKFYPPDPAQ-LQEDITRYQLCLQIRNDILSNRLPCSFVTHALLGSYLVQSELGDYDPDTMGRYYLKDFKFAPNQ--------SQDLEDKVLELHRTHKGQTPAEAELNYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDRLRIN---RFAWPKILKISYKRHNFYIKIRPQFESTIGFKLANHRAAKKLWKTCVEHHTFFRLMSPEINQKSSLFPKLGSKFRYSGRTHYET------KKTPIERPAPQFERSLTGKRLASRSMDPLGGIRPEDEYNEGNKRHTMPHPPEHIPDIDNQAPAKVKSPKEKKDKEKSPS................................................................................................................................................................................................................................................................................................................................................................................................................................................ 323
223 0.000e+00UniRef50_F1SIP2 FERM, ARH/RhoGEF and pleckstrin domain protein 2 n=3 Tax=Euteleostomi TaxID=117571 RepID=F1SIP2_PIG  ali  25  42....LQVRVELLDGTVEFAVEPKCTGQTLLTQVWKRLNLIECDYFGLEFQTLQSRWVWLEPVKPIVRQVRRPKSA-ALRLAVKFFPPDPGQ-LQEEHTRYLFALQLKRDLLEERLTCTDATAALLASHLLQSEIGDYD-ETLDREHLRAHEYLPGQ---------ERALERVLQLHRQHVGQTPAESDFQVLEIARKLEMYGLRFHAAADREGAGISLAVSHMGVLVFQSTTKIN---TFNWSRVRKLSFKRKRFLIKLHPEYQDTLEFLFSSRDECKRFWKICVEHHTFFRLCDQPKPRAKAVLFTRGSSFRYSGRTQRQLADLVKAKRVPYERRHSKMRAPLRTPTADAPRPSISFTEGLRT........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 394
224 0.000e+00UniRef50_UPI000813C82E LOW QUALITY PROTEIN: FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Manis javanica TaxID=9974 RepID=UPI000813  ali  19  47..KHLHVRVKLLDNTMEFAVEPKRNGQVLLTQVWKHLNLIECDYFGLEFQTIQSYWIWLEPMKPIIRQVRRPKNA-VLRLAVKFFPPDPGQ-LQEEYTRYLFVLQLKRDLLEEHLRCADATAALLTSHLLQAEIGDFDESL-DREHLRAHVYWPRQ---------ERALGKILEFHRRHAGQTPAESDFQVLEVARKLEMYGIRFHTASDREGAEIHLAVSHTGVLVFQNTTKIN---TFNWSRVRKLSFKRKRFLVKLHPEYQDTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKPKAKAVLFSRGSSFRYSGRTQKQLVDYVRDKRIPYERRHSKTRMSIRILTADSPRQSISFPEGMRTSASPSPVGASCSVSSTAPPAPPGLPGFQGSSGSVSELQAPEDRRPAAERSSGAAARGPDTCRAPPPRSPALQPCQGVGFCRVVRSCSPLGLGAGGAGRNDRGGGALPACSSPSNVEH...................................................................................................................................................................................................................................................................................................................................................................... 518
225 0.000e+00UniRef50_F1KT53 Band 4.1-like protein 5 n=3 Tax=Ascaridoidea TaxID=33256 RepID=F1KT53_ASCSU  ali  21  42..RQCQCKILLLDGTMNITVSKNASGQEVYDQVFYSLDLEERDYFGLLFMDHYHVQHWLDPMKKVSKQV-PIGPPYTFRFNVKFFSSEPSN-LHEELTRYQFFLQLKQDIQTGKLECPKDTAIELAALALQSEFGDYNPNEHSAAFVSEFRFHPEQD--------EEMEIAILQKYITCRGQSPATAELNYLNKAKWIELYGVDMHIVEGKDGNTYRLGLTPTGTLVFDGNQKIG---LFFWEKIQRLDFKNKKLTLVVEEDADHTFVFNLSSHKACKHLWKCAIEYHTFFRLKHQAKQRKGAQFFRLGSTFKYRGRTEYENVHKSRRQSSTFERRPSQRYGPRQSLVNRREQARNEIKQQVAAAAGLPVPDLVTIPESPPVCAEKRTTEENRIPLPLETTALGSRPNPLGSSATPQKEQPSDRIAAAEARLDNLIFQGRESTDRQNFISASVRQLNESPSASRR...................................................................................................................................................................................................................................................................................................................................................................................... 506
226 0.000e+00UniRef50_UPI000704152E FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Camelus ferus TaxID=419612 RepID=UPI000704152E  ali  21  44.PARLHIRVQLLDDTMEFDVEPRCGGQALLTHVWRRLSLIECDYFGLEFQSTQAHWIWLEPMKPIVRQIRRPKNT-VLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCTDSTAALLTSHLLQSEIGDYDEEL-DRAHLRAHEYLPGQ---------ERALEKILALHREHAGQTPAESDFQVLEIARKLEMYGIRFHTASDREGAQIKLAVSHTGVLVFQSTTKIN---TFNWSRLRKLSFKRKRFLVKLHPEYQDTLEFLLGSRDECKNFWKICVEHHTFFRLSDQPKPKARAVLFSRGSSFRYSGRTQKQLVDYVRVKRTPYERRHSKTRVSLHTLTADLPRQSISFPEGMRTPASPSATNASSSVPASPPAPPGPLHCQDRGGSLPPPPAPDAKRPATERSSSPDASQAQPPRPPALQP........................................................................................................................................................................................................................................................................................................................................................................................................................ 467
227 0.000e+00UniRef50_A0A0R3REE0 BMA-PTP-1, isoform c n=4 Tax=Onchocercidae TaxID=6296 RepID=A0A0R3REE0_BRUMA  ali  25  58..RTISCTVTFLDNTRRFEIERHAKGQILLNMVFDHLELVEKDYFGLQYISAAGVKKWLDPTKSIRKQLFY--PPYQLHFRLKFYVSDPS-KLMEEYTRYHVFLQLKNDLLEGRLVCPENSVAMLASYAVQSEFGDYSEEEHGTSYLNEFKFIPEQST--------ALVKNVIDLHKLHKGQSPAEAEFNFLKYAKDLDLYGIDLYPAKESNGTMIGIGVSNSGVVLVRCNRR---ESIYPWSAIMKLSFKKKLFSIHMRTEEDTLITFNIQNPESCKALWKSCIEHHTFFRLIAPPIPPPKS-FFSIGSRFRYSGRTEYQSMEEMRRR-ARVERTFLRHSSRESQNTMNGNSSSARDYASSYNTTSPVIASR.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 424
228 0.000e+00UniRef50_UPI0004407096 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=2 Tax=Cetacea TaxID=9721 RepID=UPI0004407096  ali  22  47.....PVRVQVLDDSVEFGVEPKCDGQVLLTQVWKRLNLIECDYFGLEFQNVQSCWIWLEPMKPIVRQVRRPKNT-VLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCTDTTAALLASHLLQAEIGDYEEAL-DREHLRAHEYLPGQ---------ERALERILELHREHVGQTPAESDFQVLEIARKLEMYGIRFHTASDREGAKINLAVSHMGVLVFQSSTKIN---TFNWSRLRKLSFKRKRFLIKLHPEYQDTLEFVLGSRDACKNFWKTCVEYHAFFRLSDQPKPRARGALFSRGSSFRYSGRTQKQLVDYVKDKRIPYERKHSKTRMSLRALNANLPRQSILFTEGTRAAASPSSGLASAPAPVGPLDSKDSSGSPTGPPAPSARWPAAERSGVAAAQPPGLPAFQPCQGAGLGRGVRSRGPSS................................................................................................................................................................................................................................................................................................................................................................................................................ 480
229 0.000e+00UniRef50_E2BXI1 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=4 Tax=Formicidae TaxID=36668 RepID=E2BXI1_HARSA  ali  19  40..KMLAVRVQMLDDSITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQEPNLTRYWLDLEKPVCRQVGLSLIDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQD--------QELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHENVPLNLAVAHMGIVVFQNYNKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVVRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSRALQGSEGGGYRGATPSSSLMGSSSISAHPLLPLGDPALATPALSLSCGSMTLDSPTTVTSVSMGGTIHRREDTATSFRTLTSIDVHSPATPSQVPAPRQMHATSQQRISSTGRISPSNSSPPEFPPPRPLPRHPWQRSASCRELYASSFEDSGKARPRDDKVTAEPLLEPFQLPSQGELDNPVTRESNRSYSAASSKLPSLDHDSVPERVYSSSYPGTSSLSTESGHEESGPAGDLDSYELLEREHEFEYPESYSSPHDEHEPISDQSDEGIEHEMFQMDSETD-SFVKHRS-SKPTEKQQYKSALTDL----KNARTKSIDRYSAVSKPDGDYIITESRIQRS....................................................................................................................................................... 728
230 0.000e+00UniRef50_UPI0008F9A740 band 4.1-like protein 4A n=1 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9A740  ali  18  10...THHCKVVLLDEELLHEIQDNTRGQELVDLVFRHLNLLETAYFGLRYIDANNQTHWLDNAKRVVKQLRGKD-TLTLYFGVKFYAVDPCKLL-EEITRYQFFLQVKQDILQGRLPVTPELAAELGAYVVQSELGDYDPRRHSPGYVSEFRFVANQ--------TAELETKIAQIHKELVGQLPCEAELNYLDKVKWLEMYGVDLHPVLGDDNVEYFLGLTPTGVIVLRNKNKV---ANYYWTRISKIYSKGKYFMLRVCDKNENTYGFETPSRAACKHLYKCSAEHHSFFRLVQVLPNPPDILTSRFSSREKLSGR----SLQLSLRNPPNFVRTPSRRYQRRIVEGALDPSKAEDPPPPTPKENVPPVKTVSIPQPVYSVRRSDSPRSTRSAPWGPRGSPQSVRAGLFSGSSPRSVRSAGPHRRHHHRRSSSVESHSSNDSHSCRRRRHRSRRGSDCESELSRCSGKSHHSHRRPRHRSRKTSHSDRESSKHSN--------YQLVESESQWKEVQRRRGEGSESLATASVSRPRSSGHHNSGMETESERSYXXXXXXXXXXXXSRSPSSDKSSRLPDELKQHLEFSLVETEGMSESQLKEIPYKVVETNTAKSALRVRLSPSNKRKLAPRRTKSNNSLKDG................................................................................................................................................................................................... 631
231 0.000e+00UniRef50_Q1JQ15 LOC553434 protein (Fragment) n=11 Tax=Bilateria TaxID=33213 RepID=Q1JQ15_DANRE  ali  80  1...........MDAELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYQDSKGFSTWLKLNKRVTAQDVRKENPLLIKFRAKFYPEDVAEELIQEATQRLFFLQVKEAILNDDIYCPPETAVLLASYAVQMKHSDYNSEHHIPGYLCRDKLLPQRVLEQHKLTKEQWEQRIQVWHEQHKSMSREDAMIEYLKISQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYERSDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKSPDFVFYAPRLRINKRILALCMGNHDLYMRRRKPDTIEVQQM...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 294
232 0.000e+00UniRef50_UPI0004F019AA band 4.1-like protein 1 n=37 Tax=Neognathae TaxID=8825 RepID=UPI0004F019AA  ali  37  1.....................KHARGQVLFDMVCEHLNLLEKDYFGLTFCDSDSQKNWLDPSKEIKKQI--RSGPWNFAFTVKFYPPDPAQ-LTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSELHFAPNQTR--------ELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRIN---RFAWPKILKISYKRSNFYIKIRP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 226
233 0.000e+00UniRef50_A0A2H1WJ87 SFRICE_005295 (Fragment) n=5 Tax=Noctuidae TaxID=7100 RepID=A0A2H1WJ87_SPOFR  ali  17  20.PRTLACRVVLLDEELLHEIQDNNTGQALLDVVFRHLDLLETAYFGLRYVDQDNQTHWLDAGKRLRRQL-RGSDPHTFYFGVKFYAADPCKLL-EEITRYQLFLQLKQDVLRGRLPVNFDLAAELAAYVLQSELGDYDPRRHGLGYVSEFRLLAHQ--------TPELEARAAEIHRTLTGISPAQAELSYLDKVKWLDMYGVDLHPVLGEDSVEYFLGLAPSGLLLLRGK---HTVANYYWPRVSKLYYKGRYFMLRVADKNNDTYGFESPTRSACRHLWRCCSDHHTFFRM--QQTSPASADIFSLGTRLRTSGRGSR------PRPPPAFTRTPSRRARPQHASHASLNDVPKLEDLRIKDCPPEIKQPTSVHRPNSLRISGEVLGVEVPAVGGSPRSTRSAPTRRGLYSASPTATRPPPAPRHRSASVDSQSSNDSRSNRKHKHRSRR------QQSDAESELSRGSGRSGRRHRRHRSRHKHESGSERDDSQPDTKEYELVDSESQWKEVLRQTTVGSGVQVANVRRSQMEPETGTHRSSHRHRRHRKHRSRSGSPNDKKWLPS-----------ELKQHLEFSLVDTTGMTEEQLKEIPYTVVQTSHARQTKLRTSSKHRQAEHGSLARRDKSSSSHG................................................................................................................................................................................................... 628
234 0.000e+00UniRef50_A0A067RE36 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Zootermopsis nevadensis TaxID=136037 RepID=A0A067RE36_ZOONE  ali  19  29..KMLAVRVQMLDDSVTFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQEVGGTKYWLDLEKPLSRQVGLSLVDTLLKFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVVEDYPDHYLSTYKFVPNQDH--------ELERRIMENHKKHAGQSPAEADLNLLETSRRCELYGMKMHPAKDHEGVPLNLAVAHMGIVVFQNFTKIN---TFSWAKIRKISFKRKRFLVKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSIKHVPRQKTRVLSRGSSFRYSGKTQKQIVEFVREKRQTFQRDKTYLLRSYFCCQFATSVTSSDDERGEKSLATPRKSRMGPPTELPTGPLLPRKRDRSPILFARARLGLSEGSAFSPVRQVGSPASSRRAKSLDAPVVAVHCLPPADAFSSKDDTLDNGVGKSEPLKPLEIIAKRLPSTIEDESSITDDDTQDVLGRLLEWEVPKQTSQPLRKHTSSNVADVQAEQLFSPTVGNVTPQTELCVSEEQPTVKPQVPYKPTSLKSLKVNDVK------IMKGESEQ-TAEYLHEHSTIEFIIDNRNQQPQEMKKTDGPEELHIKKIDKFQLPQVTCSEIVGGQENISVITSKDINSLLTHFSDTEVDTHEELEVLEDISGSENIFNESRELDKFKERERKILC................................................................................................................................................ 715
235 0.000e+00UniRef50_P35240 Merlin n=734 Tax=Eumetazoa TaxID=6072 RepID=MERL_HUMAN  ali  61  19.PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYT-IKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQM...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 321
236 0.000e+00UniRef50_UPI0008FA9B37 band 4.1-like protein 3 n=1 Tax=Cyprinus carpio TaxID=7962 RepID=UPI0008FA9B37  ali  22  71..KVMECKVKLLDGTYTCTVEKRAKGQVLFDKVCDHLNLLEKDYFGISYRDAENQKNWLDVSKEMKKQI--STGPWSCAFSVKFYPPDPSQ-LSEDITRYYLCLQLRDDVVSGRLPCSFSTHTVLGSYTVQSELGDCDAELQGSSYISDMCLAPNQ--------TKELEEKVLELHRGHK---------LLLKLTKKLSMYGVDLHHAKDSEGVEIMLGVCSSGLLVYRDKLRIN---RFAWPKILKISYKRNNFYIKVRPQFESTIGFKLPNHKAAKRLWKVCVEHHTFFRLVSPEAPPKR--FLSLGSKFRYSGRTQAQT----RRASAQIARAAPQFQR-RHTVTAGMDSTTVSHDDGKNDKPAVAIDDFIAIETPEKKAEEMNSVEEENKANSDESEQAPPPSVTKLPNNALCASSPTSLHHFMPIKSPS..................................................................................................................................................................................................................................................................................................................................................................................................................... 483
237 0.000e+00UniRef50_A0A0A9Z469 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=6 Tax=Paraneoptera TaxID=33342 RepID=A0A0A9Z469_LYGHE  ali  29  42...MLAIRVHMLDDNITFQVQAKAVGRVLFEQVCKQLHLLEADYFGLEYQDHSGIRYWLDLEKQLSRQVGLSLVEPLLHFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGHIQCNDNTAALMASYIVQAECGDYSADDYPDHYLSSYKFVQHQDR--------ELEKKIMDNHKKHIGQSPAEADLNLLETARRCELYGMKMHPAKDHEGVPLNLAVAHMGISVFQSYAKI---YTFSWAKVRKISFKRKRFLIKLHPDYKDVVEFFFESRNECKNLWKKCVENHGFFRCNVKRVPRQRTRVLSRGSSFRYSGKTQKQMVEFVRE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 361
238 0.000e+00UniRef50_A0A210QDZ7 Band 4.1-like protein 3 n=7 Tax=Pteriomorphia TaxID=6545 RepID=A0A210QDZ7_MIZYE  ali  21  23..RSVICRVTLLDGKLETDVDKRAVGCILFDKCCDNLDVLEKDYFGLSYIDSSGLKNWVNTLKKLSKQI--KSGPWEFNFEVKFYPPDP-QQLHEDITRYQLCLQIRRDIVSEKLPCSFVTYTLLGSYTVQSELGDYDVEEFGRGYIRKIQFAPHQDR--------ELLKKICDLHKTHKGQTPEEAELRFLENAKKLSMFGVELHDAKDAEGVIIQLGVSATGLLVFKDKLQIN---RFVWPKVLKMSYRRSKFYIKLRPDFQSQVGFKLESVKHAKRLWKICVEHHSFFRFREIELPKAKSTFPRFGSRFRYSGRTQFQTKQAMARPSPYFDRVHSRRATYHGRVPNRRNRDEVYRPEPPRDLPVPPEKRPRTPNNEDRFIENKPPVESDPEPEDHYEEDRHSHDEEPADRKSRMERIHAVQTPLAAVMMAAKKQQEQNNVDRSHQQRESDEDSESLPEKPPLNESMNRSMDEDLDGIPPPPPEERLEAPPLVYSXXXXXXXXXXXXXXXXXXXXXXXXXKKEEKADQKRLDRERKRSQKDKKGSRGKKEWDXXXXXXXXXXXXXXSEPKERNKRSRLSSFEDQPKGSPKDSPRDPEAPE............................................................................................................................................................................................................................................. 622
239 0.000e+00UniRef50_A0A1W4YD13 merlin-like isoform X3 n=13 Tax=Euteleostomi TaxID=117571 RepID=A0A1W4YD13_9TELE  ali  60  11.PKTFKVKVITMDAEVEFSCEVKWKGKDLFDLVCRTIGLRETWFFGLRYI-VKDTYAWLKMEKRVLDQEVPKEFPITFHFLAKFFPEKVEEELVQEITQHLFFLQVKKKILDEEIFCSPEACVLLASYAVQAKYGDYDPNFHKPGFLSQDELLPKRVLMQYQMTADMWEEKITAWYAEHRGIARDEAEMEYLKIAQDLEMYGVSYFSIQNKRDTDLLLGVDAQGLHIYSPNNKLNPNKSFPWSGIRNISYSEKEFTIKPLDKKKEVFKFYSSQLRVNKLILQLCIGNHDLFMRRRKVDTIEVQQMKAQAKEEKARKKVERQI..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 331
240 0.000e+00UniRef50_UPI000C03AF3F band 4.1-like protein 4 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C03AF3F  ali  17  12......CHVLLLDEEHPVEIQKKTKGEEVLEKVFQHLNILEKDYFGLRYIDRDSQSRWLDPLKPVVKQLT-AGPPYLLYFCVKFYAADPCR-LHEELTRYLFFLQVKKDIYQGRLPCSTNILAEVSAYSLQSELGEYEPKEHTTGYVSEFRFLPNQ--------TEELESKIYHRHKKLGNMVPSVAEFMYLDKIKWLEMYGVDLHPVKGEDFIEYFIALKPSGVAVYKNKTRVG---SYLWSKIEKVDFKGKKFYLTVKEEREYTFKFYLPTKTACKHLWKCCVEHHAFFRLDKANTSHRRSGLFRIGSSYRYSGRTQKEALEDGKRPDLQVKRKPSKRYERRISQSGESVATPTNASQVQIRRFSQTDNQAEVITVPVTGPNGTGIKTEGDPSSLNGNTTAVDGHQGPALPWEQSAQMQGGLYTPAPDSPRSLRSSGSGRAKRSPKFPRPHRRSAGQSSGSETDTPRRRCRHHHHRGHHSAESGSDRDSSYSREERRRHR................................................................................................................................................................................................................................................................................................................................................. 507
241 0.000e+00UniRef50_A0A2H8TZT2 Merlin n=5 Tax=Bilateria TaxID=33213 RepID=A0A2H8TZT2_9HEMI  ali  62  16..KSFPVKVCTLDAELEFNLELKATGRDLFDLVCRTIGLRETWYFGLQYEDSKGFIAWLKLDKKVQDQGIPQQTTMPFMFLAKFYPEEVAEELVQEVTQHLFFLQVNRAILAMDIYCPPEASVLLASYAVQAKYGDYDEGTYKPGMLASEELLPQRVIDQYQMTAEMWEERIKVWYADHRGMSRDEAEIEYLKIAQDLDMYGVNYFPISNKKDTDLWLGVTSLGLNIYEKENKLTPKTTFQWSEIRHVSFDDKKFTIKPVDKTSPNFVFFSHKVRMNKLILDLCIGNHDLFMRRRKPDSMEVQQMKTQAKEEKSRRQIERNKLAREKQ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 341
242 0.000e+00UniRef50_UPI0003316B2C FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Sorex araneus TaxID=42254 RepID=UPI0003316B2C  ali  22  50..KLLPVCVKLLDDTVEFDIEPKSHGQALLTAVWMRLNLVESDYFGLEFQNAPPHWIWLEPMKPIARQIRRPRNT-VLHLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEGRLTCADTTAALLTAHLLQAEIGDYD-ETLDREHLKGHRYLPSQERS---------LEKVLEFHRKHMGQTPAESDFQVLEIARKLELYGVRPHPAADREGARISLAVSHMGVLVFQSTTRIN---TFNWSKVRKLSFKRKRFLIKLHPEHQDTLEFLMGSRDECKNFWKICVEYHTFFRLLDQPKPRAKAAFFGRGSSFRYSGRTQRQLVDYVRDKRVPYERRLSKTRLSVQELPRQSPALPEALRTPAAPLPFSVPTCPRGPAGLPDFRDHSCPPATPPAERS.......................................................................................................................................................................................................................................................................................................................................................................................................................................................... 437
243 0.000e+00UniRef50_A0A1W4XTM2 uncharacterized protein LOC108744735 n=1 Tax=Agrilus planipennis TaxID=224129 RepID=A0A1W4XTM2_AGRPL  ali  19  50..KMLGIKVQMLDDTITFQVQSKALGRVLFEQVCKQLHLLEADYFGLEYEDLHGTKYWLDLQKPVSRQLGLSLVDPLLHFCVKFYTPDPSQ-LEEEYTRYLFCLQVKRDLAQGHLQCNDNTAALMASYIVQAECGDFVAEDYPDHYLTSYKFVPHQD--------QEIERKIMENHKKHIGQSPGEADLNLLETARRCELYGIKMHPTKDQENVPLNLAVAHMGIIVFQHYTKIN---TFSWAKIRKISFKRKKFLIKLHPEYKDTVEFFFESRNECKNFWKKCVENHGFFRCSSKTVPRHKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQAFQRSASFRHTSSHSSSVNMHASSVGNSISAHPLLPLSDSKRSVSLASMEDPKKIPDSPTTKSASLPQGTVMSWNSITDVQHISQLAQTTSSPSPPLTMQSISPATSATASPQHLSFQDPHRITQKYISTPPPSSPPPSLPVTDHKIETGIVQTIHTTFDKAGPNYKSESKSETTIQTSSFPLQVATPQNNTFECPQYTYKSSNISSKRSVWCRSSSCRELNEYSFEESGRTKHKTR............................................................................................................................................................................................................................................................................... 620
244 0.000e+00UniRef50_A0A2G8JJC8 Putative tyrosine-protein phosphatase non-receptor type 4-like n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8JJC8_STIJA :_  ali  26  89..KKIRCLIIFLDDEHCFEIERRARGQELLLKVFEHLDLVESDYFGLKIVEGEGQRQWLDPRKSIRKQLKGSA---FFLFQVKFFVSEP-EKLLEDYTRYQYVLQLKKDILEDRLQCTFNVGTKLASYLVQGRLGDYDAQEHLCGYLDSYVFVPNQ--------TEEFTKEVVRLHKSNCGLLPSEAELEYLNLARDLEMYGIDLHLARDQHAIEIQVGVTSLGLIIFQGLVKI---KLFPWASIVKISFKRKQFFLQQKREQKDTIGFNMASYRACKNLWKSCVEHHTFFRLVEPQQPAGKRNFFQLGSKFRYSGRTEVQTVEDTKKREREFSRSPSKRIFRRTIGGSSSDVIRNETRSLPSRGSNHSN..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 452
245 0.000e+00UniRef50_Q7ZWC7 Rdx protein (Fragment) n=38 Tax=Bilateria TaxID=33213 RepID=Q7ZWC7_DANRE  ali  84  1MPKTISVRVTTMDAELEFAIQPSTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQEATQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQAKYADYNKDAHTPGYLSNEKLLPQRVXXXXXXXXXXXXXXXXXXXXXHKGMLREDSMMEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDKMTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAQRLRINKRILALCMGNHELYMRRRKPDTIEVQQM...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 305
246 0.000e+00UniRef50_F7A4A9 Uncharacterized protein n=2 Tax=Ciona intestinalis TaxID=7719 RepID=F7A4A9_CIOIN  ali  25  18.PKNRRCQIYLLNGEFRCEVHKQANGNELLKQIYNLLNILESDYFGLYFVDQTDQKYWLEPNKSIKKQI--KNGPWSFFFAVKFYPPDPAQ-LQEDITRYYMVLQLRDDIVGGRLPCSFVTHALLGSYVVQSELGDYDRSEMRGNYVSEFSFAPNQTR--------ELEERVMELHKTHRRQTPAKAELNFLENAKKLSLYGVDLHVAQDSDGIDLSVGVSWNGILVYRDGTQIN---RFAWPRVIKLSYIRSKFYITIRPLDGNVIGFKMPNHRAAKKLWKSGVEHHAFFRLV-KCEPQPRPKLIRVGSKFRYSGRTQQETTETEKRPQPTVVRSHSKRLRSAIKQNFNC........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 362
247 0.000e+00UniRef50_A0A0P6F4A8 FERM, RhoGEF and pleckstrin domain-containing protein n=1 Tax=Daphnia magna TaxID=35525 RepID=A0A0P6F4A8_9CRUS  ali  22  22.SKILVVRVQMLDDTVTFQIQAKAMGTVLFEQVCQQVNLLEADYFGLEYTSSENVKYWLDLEKPMNRQLEMSLTDPLLRFAVKFYAPDPAQ-LEEEFTRYLFCMQIKQDLAQGTLQCNDKTAALIASYLVQAECGDYVAEDYPDHYLSSYRFVPHQD--------PELERRIMENHKKHIGQSPAEADLNLLETARRCELYGVKMHPAKDPEGVPLNLAVAHMGVLVFQNFAKIN---TFSWAKVRKLSFKRKKFLIKLHPEYKDVVEFCFECRDECKNFWKKCVEHHGFFRCPTAKEPRPKPGVLSRGSSFRYTGRTQKEIVEFVREKRQSFQRSQSFRHTSPHHTVGTSLSVHPLLPVGDNVIVANDTVSPGSSAAISDSRARSISTPERTETVDVHHSREPRSASGHRDVDVEREMEVESP............................................................................................................................................................................................................................................................................................................................................................................................................................... 469
248 0.000e+00UniRef50_UPI000A2A8275 tyrosine-protein phosphatase non-receptor type 4-like isoform X1 n=2 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A8275  ali  24  30.PQKIRCVVELLDDEFIIDLEKDAKGELLLKEVFKHLDLQEKEFFGLHYFDSPDNMVWLKDDKLIRKQ-RKGPTPYIFYFGVKFFVSDPA-KLSEDLTRYYFYLQIKRDLLTGRLPSFYDTAAELASYVLQAELGDYDPKLHLDGYVGEFRFIPDQ--------TEDFEERASEFHKHHVGQTPADAEFNYLEVAKNLDLYGVSLHCAQDTQGTDLYIGISALGLTVYHNKCKIN---FFPWSKVVKVCFKRKRFYIQIRPDKDNTIAFQMQTYRATKNLWKTCVEYHSFYRTHC-PKPMNNRRLFRMGSKYRYKGKTEYQAIEESRRPEPKIVRTLSRRYSKRSDSGTWSRSLRRLDLDREEKHAPPFHYSSAPNSTDKLNRIGNVKRSHSTSANVGGLVKPSHESHKKEGSCDS....................................................................................................................................................................................................................................................................................................................................................................................................................................... 449
249 0.000e+00UniRef50_F1KU02 Band 4.1-like protein 1 n=2 Tax=Ascaris suum TaxID=6253 RepID=F1KU02_ASCSU  ali  17  28...MQPATVHLLDATQIFYVPKKAEGKELFDKVVDYLKLVEKEYFGLSFLDTDGNRHWIYEDKRIAKQL--KGHPWEFNFEVKFYPPDPAT-LTDDLTRYHLTLQIRHDVYTGRLPATFATLALLGSYIAQAERGDFQDTPDYDDFLRDCRLAP--------VPSSALYEKIRELHKQHKGETPAEAELHYLDNAKKLSMYGVFLFPAKDSKGTSVHVGVCAHGINVYCDQIR---AHRFIWQNIIKIAYRRNTFSIKLQPGDRSAVLFHLPDYASAKRIWKCAVEHHTFFRL-IQPDEKPHKGLFRWGSRFRYQGRTHFQSKMASQHPAATVKRSHSARLASRSDENLAPEVAKHTSPLHYADDGTSRDLT-STPEKSYTLHSVDISGKKDMKKIAKTSEVESVTKPSEKRETKKKNEKKKAKNAVDGGGSTSSSDSESKERQYRPSYAPTKENVGPTEQLLSPSKEAPMCEGPIPWTKRTVESNQVRNEGANVPSNHMSDEQELTRTKEAEMFELEERVDNSYRIQGTGISPTIDPNDTESSAPHTTVESWHESNVGPESVVTDVDKYGNVIKKTVKTQQVKHTIQRQTYQTYSISGEGEQPGVQTVEASQQVITPIGGGIVMSGTTPIVETRSHTVAYEAGQEPFGSENGFQRSDIPGELISCRTISSGNRTVETITYKTE........................................................................................................................................................... 708
250 0.000e+00UniRef50_UPI000A33A7D4 FERM, RhoGEF and pleckstrin domain-containing protein 2 isoform X4 n=7 Tax=Amniota TaxID=32524 RepID=UPI000A33A7D4  ali  22  42..KHARVRVKLLDNTVEFDIEPKCDGQVLLTQLWKHLNLIECDYFGLEFQNIQSYWIWLEPMKPVIKQIRRPKNA-VLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCAATTAALLTSHLLQAEIGDYD-ETLDREHLKANVYLPSQ---------EQAFEKILAFHRRHTGQTPAESDFQVLEIARKLEMYGIRFHTASDREGTKINLAVSHMGVLVFQGTTKIN---TFNWSKVRKLSFKRKRFLIKLHPEYQDTLEFLLGSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYIKDKRIPYERWHSKTRSSIHVLTADLPKQSISFTEDLRSASLSSANASSYPATSPLLPPGLPDFKDSSSSLMDPLAPCISAAVKNAAMMRNSEAAGGPSAPSAQPPRSPALQSSPGLAMDSPQPSPSSQKSPLSLSPVFQVALAPPELASSP.......................................................................................................................................................................................................................................................................................................................................................................... 510
251 0.000e+00UniRef50_A0A1S3K5J1 FERM domain-containing protein 5 isoform X1 n=2 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3K5J1_LINUN  ali  19  15....FKCTVRFLDDSLDITFQRDVSGQWLIDHVCKHLNLVEKDYFGLRYVDTDKQRHWVDPLKPAYKQL-KNVSPLVLCFRVKFYPAEP-HKLKEEITRYFLFLQLRRDLHHGRLLCPPGDATLLAAYIVQSELGDYDPQDHGPGYVSNFKVLPKQ--------TPKIEERIAELHKGLTGQVPSEAESNFLRKAASLETYGVDPHIVKDQKGNPMYMGVTCHGISTFQGNKR---THFFKWTSINKIAFEGKMFILHLNMMKKHVVGFKCPTTAACKHLWRCAVEQQAFFTLPSASQAPKVGGLFRRGSKFRFSGRSQREVLENIKRDSPTFSRSSSNPIRNHSKKQQKENTLPINFTLSADASGDKADESRDASSPATVSESVDITLDSTLPNQTEVTITSENSPYEPDETIVEGSSDVQDTSAPXXXXXXXXXXXXXXXXXXXXXPVCSTPNHLNEVDRESETSSVEGEP.............................................................................................................................................................................................................................................................................................................................................................................. 505
252 0.000e+00UniRef50_F1MD05 Erythrocyte membrane protein band 4.1 like 4B n=78 Tax=Boreoeutheria TaxID=1437010 RepID=F1MD05_BOVIN  ali  23  1.....................KHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVPHWLDHSKPIKKQM-KIGPAYALHFRVKYYSSEP-NNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQ--------TEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIG---LFFWPKITKMDFKKSKLTLVVVREQEHTFVFRLDSARTCKHLWKCAVEHHAFFRLRTPGNSKSRSDFIRLGSRFRFSGRTEYQATHGARRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQFCSKTNPEVHNYQPQYHPNLHPGQPRWHPHSPNVSYPLPSPGLSSSDRLP.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 383
253 0.000e+00UniRef50_UPI00071215D5 uncharacterized protein LOC106752112 n=1 Tax=Dinoponera quadriceps TaxID=609295 RepID=UPI00071215D5  ali  18  40..KMLAVRVQMLDDSITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQEPNLTRYWLDLEKPVCRQVGLSLIDPLLRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQD--------QELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHENVPLNLAVAHMGIVVFQNYNKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVVRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSRALQGSEGGGYRGATPSSSLMGSSSISAHPLLPLGDPALATPALSLSCGSMTLDSPTTVTSVSMGGTIHRREDTATSFRTLTSIDVHSPATPSQVPAPRQMHATSQQRISSTGRISPSNSSPPEFPPPRPLPRHPWQRSASCRELYASSFEDSGKARPRDDKVAAPSEPPLEPQLPSQGELDNPVTRYDESNRSYSAASSKLPSLDHDSVPESSSYPGTSSLSTESGHEESGPAGDLDSYELLEREHEFEYPESYSSPHDEPISDQSDEGIEHEMFQMDSETDSFVKHRSSRATLEKQHKPALVENLKNARTKSIDRYSAKSDGDYIITESRIQRSGTQIERKFETRHANSVEQPSKTAVPHQDSVIL................................................................................................................................ 759
254 0.000e+00UniRef50_A0A0N0U7E0 FERM, RhoGEF and pleckstrin domain-containing protein 1 n=1 Tax=Melipona quadrifasciata TaxID=166423 RepID=A0A0N0U7E0_9HYME  ali  21  43..KMLAVRVQMLDDTITFQVQAKALGRVLFDQVCKQLHLLEADYFGLEYQEPNGTKYWLDLEKPVCRQVGLSLIDPILRFCVKFYTPDPAQ-LEEEFTRYLFCLQIKRDLAQGLLQCNDNTAALMASYIVQAECGDYVIEDYPDHYLSTYKFVPHQD--------QELERRIMENHKKHAGQSPAEADLNLLETARRCELYGMKMHPAKDHEGVPLNLAVAHMGIVVFQNFTKIN---TFSWAKIRKISFKRKRFLIKLHPEYKDTVEFFFEGRNECKNFWKKCVENHGFFRCSVKRVVRQKTRVLSRGSSFRYSGKTQKQIVEFVRDKRQTFQRSNSFRQTSRALQGLEGGGYRGATPSSSLMGSSSISAHPLLPLGDPALETPALSLSCGSMTLDSPTTVTSVSMGGTIHRREDTATSKLPSLDHDSVPERSSSYPGTSSLSTESGHEESGPAGDLSHDDLSHDSYELLEREHEFEYPESYSSPRXXXXXXXXXXXXXXXXXXXXNEPMSDRSDEGIEHEMFQMDSETDSFVKHRSIKSTDKQQFKSVLADLKNARTKSIDRYSTAATATATAKPEIRDVQKQKMSVLNELKNFKPKY-KITHVDSEILRDEGIMRPKSRIDDDLSPVDSTNRTIV......................................................................................................................................................................................................... 679
255 0.000e+00UniRef50_A0A1A7Y8B1 Protein tyrosine phosphatase, non-receptor type 4, a n=4 Tax=Percomorphaceae TaxID=1489872 RepID=A0A1A7Y8B1_9TELE  ali  24  28...QVVCNVLLLDNTVQFKVNKSDYGQVLLDVVFKHLELTERDYFGLHLADDSDSPRWLDPNKPIRKQL-KRGSPHSLSFRVKFFVTDPS-KLQEEYTRYQYFLQIKQDLITGRLPCPHNTAALLASYAVQSELGDYNETEHSFGYLSDYCFIPN--------PPEDFHKEVSKHHQQHSGLSPAQAEFNYLNTARTLELYGVELHYARDQSNTEILIGVMSAGIVIYKNRVRIN---YFPWLKIVKISFKCKQFFIQLRREAADTLGFNMVNYRACKNLWKACVEHHTFFRLER-PIPPQKNFFFSLGSKFRYCGRTEVQSVQYGKEKGIKFARSPSKPLARKLVGGTDSVSRNSLSDERLETQSLPTRSPPGTPNQNSLFIQEGTRIRPSSVGHLVDHVIHVSPSLPVFSSNHKSASSTQ................................................................................................................................................................................................................................................................................................................................................................................................................................. 446
256 0.000e+00UniRef50_UPI00084AAB0D putative uncharacterized protein DDB_G0282133 n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084AAB0D  ali  17  7.................CFIHDATTGQDLLDVVLQHLNLLETAYFGLRFLDPENHTHWLDPTKRLMKQL-KGTSPFTLYFSVKFYAADPT-KLVEEITRYQFFLQVKQDILQGRLPVSLELAAELGSYAVQSELGDYDPRRHSPGYVSEFRFIAGQTV--------ALESKIAELHKKLVGQVPAKAELNYLEKVKWLEMYGVDLHPVLGEDNIEYFLGLTPSGAIVLRNKTKVG---NYFWPRISKVYFRGRFFMLRVRDKSENTYGFETPSRAACKHLWQCCVEHHAFFRLTQSAGSGP-QAVFSLGSKFRYSGRTEKEVMQEARRQQPEVSRTPSRRYQRRVVEGAVDTPRIEDADPKIEPRLPTTSSSHVAPSTTSNVYRSSSMTLNGRGPSSPRSIRSAPQQASSSSSVPPINRAKLDENKPVNRTESRSESRGPGNRTESPRSVRSAAAAVTAESRMSRRTSSVDSQSSIDSRGHRSSRSRSPSEAKNSRYPTEIRQHIDYGLKDTSGLTEAELRDIPYTRVETATNIKTKFASTGN------------------GKKNKSPRRSKSNSSDRKL-------------------APPDGESPPPSFQDSTKKPHHHNSTSRRKNKSASEERKVEGQSRGDPPEDMRPVT......................................................................................................................................................................................... 597
257 0.000e+00UniRef50_E9QIC8 FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) n=46 Tax=Euteleostomi TaxID=117571 RepID=E9QIC8_DANRE  ali  21  35MPRQISIRVQMLDDTQEFEVSQRAPGKALFDLVCSHLNLVEGDYFGLEFQDQRKMIVWLDLLKPILKQIRRPKN-IILRFVVKFFPPDHTQLL-EELTRYLFALQIKHDLACGRLTCNESSAALLVAHIVQSEIGDFD-EVQCKQHLLNNKYIPEQDT---------LMDKIIGYHRKHVGQTPAESDYQLLEIARRLEMYGVRLHPAKDREGTRLSLAVAHSGVLVFQGHTKINA---FNWSKVRKLSFKRKRFLIKLRPDCQDTLEFMMGSRDCCKVFWKICVEYHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQRQVIDYVKDKKVPFERKHSKIQSNSNLSPFPSRQSAEGQGERNASASGH-QADSPLGRTQVTVENPALQRYTGSLNSQTNGCRNGTSDEADARLKPSPSKQQAEHLSTGPVSRSPQHSESPSAGQMMVNGQKQSLSVGQSPDGRQPSPLTSP................................................................................................................................................................................................................................................................................................................................................................................ 499
258 0.000e+00UniRef50_A0A2D0RXB9 FERM, RhoGEF and pleckstrin domain-containing protein 2 isoform X1 n=13 Tax=Gnathostomata TaxID=35060 RepID=A0A2D0RXB9_ICTPU  ali  22  45..KSLQIRVQGLDDAQEFELEAKADGQTLLNDVYRRINLIESDYFGLEFQNVQMNWVWLEPTKLIVKQVRRPMNT-HFRLSVKFFPPDPGQ-LQEEFTKYLFSLQMKRDLIEGLLNCTENTAALLASHLVQSEIGDYD-DVADREYLKLTKLLPHQ---------EHFQEKIMELHRRHVGQTPAESDFQVLEIARKLEMYGVRFHPAADREGTKINLSVAHMGLLVFQGNTKIN---TFNWSKIRKLSFKRKRFLIKLHPEHQDTLEFLMASRDQCKIFWKSCVEHHAFFRLFDQPQPKAKAMLFSRGSSFRYSGRTQKQLVQYVRD--SGVKRTPYQR-RNSSKIRMSTRSLATDFPKQSLSFNDSLKICSSPPSATVSFHSLHSSISPVRMDNNSKPQIQQIQHISSLQQPVRPPTPVKEEPAKIHSPSNSAFPGPIMDSPQLSPFGSKCPLSVSTSFQMSTLSLPSQAPSSP........................................................................................................................................................................................................................................................................................................................................................................... 505
259 0.000e+00UniRef50_A0A1W4Z0Z9 FERM, RhoGEF and pleckstrin domain-containing protein 2-like isoform X3 n=11 Tax=Euteleostomi TaxID=117571 RepID=A0A1W4Z0Z9_9TELE  ali  20  48..KGLQVRVQGLDDTQEFDLEAKAIGQMLLSAVFQRSNLIESDYFGLEFQNVQMNWVWLEPMKLIVKQVRRPMNTL-FRLSVKFFPPDPGQ-LQEEFTRYLFVLQLKRDLMENRLPCTENTAALLISHLIQSEIGDYD-DTADREFLKQNKLLPIQDR---------LQEKIMDLHRKHLGQNPAESDFQILEIARKLEMYGVRFHPAADREGSKINLSVAHMGLQVFQGNTKIN---TFNWSKIRKLSFKRKRFLIKLHPEHQDTLEFTMASRDHCKVFWKKCVEHHSFFRLFDQQQPKAKAVFFSRGSSFRYSGRTQKQLMEYMRDRRTPYQRRNSKMCGSTRSLASDVPKQSLNFSDSLRVPESPNSSFHSLHNSSPTPHREPLQLQHQPSKQLQQPTGILSCPKEEYSKTVPPAHTFQGSSLDSAQSPPFDSKSPLTLSPSTQMSALSLPGRTPSPLQSPILSEVGSPR.............................................................................................................................................................................................................................................................................................................................................................................. 512
260 0.000e+00UniRef50_A0A1V9XVC4 Band 4.1 protein 5-like n=1 Tax=Tropilaelaps mercedesae TaxID=418985 RepID=A0A1V9XVC4_9ACAR  ali  26  28....LLCKVILLDGDLVVEISKKALGEILLEQTFYNIDLVEKDYFGLQFTDAFSVQHWLDPTKSVRKQNT-IGPPYTFYMRVKFYSPEPT-LLREELTRYLFFLQLKQDVLHGRLPCPYDVMVELAGYALQSELGDFESRTHTAEFISEFRFCPEQ--------TEQMELDILGAFRQLRGQTPAQAELSYLSKAKWLELYGVDMHTVLGKDGYSYSLGLTPTGILVFESKTKIG---LFFWPKITRLEFKSKKLTLVVVYEQEHTFVFRLFNPKAAKHLWKCAIEHHTFFRLKSPPQSALKQNLFRMGSRFRYSGKTEFQATARPQHRRTQFERRPSQRFSRRVSQRTS......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 369
261 0.000e+00UniRef50_A0A1A7ZRA0 Erythrocyte membrane protein band 4.1 like 4B n=67 Tax=Clupeocephala TaxID=186625 RepID=A0A1A7ZRA0_NOTFU  ali  17  70....ITCRVLLLDGSVSVDLPSKSKGQDLFDQIMYHIDLIEMDYFGLQFMDSDQVSHWLDVSKLIKKQIQ-DGPPYRLFFRVKFYSSEP-NNLHEEFTRYLFVLQLRQDILSGKLKCPYDTSVELAAFCLQSELGDCDPLEHSPELVSEFRFTPKQ--------SEAMEADIFSRWLELRGQSPSQAEISFLNKCKWLELYGVDMHFVKGRDGGEYALGLTPTGILVFEGSNKIG---LFFWPKITRLDFKKSRLTLMVVREQEHTFIFQLDSAKNCKHLWKCAVESHAFFRLRQPTAGKSHSDFTRLGSRFRFSGKTEYQATHGGRRRASTFERRPSKRYPSRTHSLGKAAVSPAKPPHISTRASPQHNIPIGHEPWHPPHPALTTPLYLQPTGHTPPHSFPLTSPASDHQYSSSENENSHSGKTDRRPRRYSHSPDTRGHTHTKSKRRAPPCPLDISQSLLKALEAESGSPPWPSLHINIDKKGEEKQLSGKSLHPPASPVVLPDHLKCNILKAQVEAAFRKETPTETLNERYRSSSQDSAASSPTAEKTPHRQQDHNSATDVLQVKGNASSNRRKRL................................................................................................................................................................................................................................................................... 656
262 0.000e+00UniRef50_UPI0005C3C621 band 4.1-like protein 5 isoform X1 n=4 Tax=Crassostrea TaxID=6564 RepID=UPI0005C3C621  ali  17  34....VQCTVMLLDGTFSTELHKKAEGHELYEQVFYHLDLVEKDYFGLQYTDHYNVPHWLDPTKKIRKQL-KIGPPYSFRFRVKFYSSEP-NNLHEELTRYQFFLQVKQDIFSGRLECPQDVLVDLAAEALQSELGDYDPEVHTPGFISEFRFIPEQ--------TEELELAIFEAFKTKTKETPAQAELNFLMKVKFLEMYGVDMHIVMGRDQQEYRLGLTPTGILVFEGEQKIG---LFFWPKMTKLDFHGKKLKLVVVQEQEHTFVFRLQSEKAAKHLWKCAIEHHAFFRLKGPVKPNARQNFFRMGSRFRYSGRTEYQTSSVSRRRSVRFERRGSQRYSRRPTFEKXXXXXXXXXXXXXXXXXXXXXXXQRVQVEASKAQPKSPTTPEATPVTPPPRSPRVSGAGSPSASGGASAMDRIDALIKTDGEKKVEPPTSPKAGGSTKAWAPLPPPPPEPEVSLRDNEEAS---------EIAQAKLKGLDESAAKHNTVPPRPKPDINSFKNNQVKFAGGATTIPPDQMKCNIFKAKIEEELKKAPVVVNDVNIRDESFHESDSRSTDTGSNSGEEQEKDPIKEEKAQLTVDLPPVDIVDAPHSPRRRGHFSKSSSSSSHKGSEQTAPPSQLDNDSGTAPKSPSLSSEGSSCASPVENEQTSPISQPTEDLSHPQSLPKSPPATASK........................................................................................................................................................ 712
263 0.000e+00UniRef50_UPI0007B7BAC1 FERM, RhoGEF and pleckstrin domain-containing protein 1-like isoform X1 n=19 Tax=Euteleosteomorpha TaxID=1489388 RepID=UPI0007  ali  18  37MPRHVTVTVRMLDDTEEFDVSQKASGKVLFDLVCSHMNLIEGDYFGLEFQNHKSMMVWLDHIKPIIKQLRRPKNT-TLRFSVKFFPPDHAQLL-EELTRYLFALQIKQDLSSGRMTCNDTSAALMVSHIIQSEIGDFD-ESHCRSHLLNNNYIPDQMP---------LIDKIMEFHSKHIGQSPAESDFQLLEVARKLDFYGIRLHPAKDREGSKLNLAVAHTGVLVFQTHTRINA---FNWSKIRKLSFKRKRFLIKLRPDYQDTLEFLMASRDCCKVFWKICVEYHAFFRLFEEPKPKPKPMLFTRGSSFRFSGRTQKQVIDYVRESEIPFERKHSRRYSSRVQHNSRLSPLPSPRHHEVPSESGVPEDLSSSSPPRRHWKESVLVSAEDPAASRTSKMSPNHQRNGHEDRKESVSKPEESRG---STRQMSPEHPSQGPASWFAKGSSSATSFVDSELNMGREQASRTNQGYGEDFNLRRGSGSQQEHLLGKTQYRESPLLNMNHEPYRSLTQSRPKFDLSPGYSTVGEIRGHNRERQSSSPLPGQHTFGSRSVVSNPANKPTHRAPS............................................................................................................................................................................................................................................................................ 600
264 0.000e+00UniRef50_A0A2U9C8F2 Putative tyrosine-protein phosphatase non-receptor type 4 n=3 Tax=Euteleostomi TaxID=117571 RepID=A0A2U9C8F2_SCOMX  ali  26  997....ITCRVSLLDGDVSVDLPKKAKGEELFDQIMYHLDIVEKDYFGLRFMDSAQVPHWLDVTKSIKKQV-KIGPPYCLHLRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECPFDTAVELAAFSLQAELGDCDPLEHNLDLVSEFRFIPNQ--------TEDVELAIYNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGVLVFEGETKIG---LFFWPKITRLDFKKSKLTLVVVEEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVQNTASSGFIRMGSRFRYSGKTEYQTTKGNKRRSASFE......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1322
265 0.000e+00UniRef50_F1KTQ2 Tyrosine-protein phosphatase 1 n=1 Tax=Ascaris suum TaxID=6253 RepID=F1KTQ2_ASCSU  ali  20  82..RTIVCTVHFLDDTRNFEIDRHSRGQALLDKVFEHLELVEKDYFGLQFINLPGVRRWLDPTKSIRKQMLY--PPYRLFFRVKFYVNDPA-KLVEEYTRYHVFLQLRKDLLEGRLTCPESTSALLGSYAAQSEFGDYSSDEHGSDYLDGFKVIPEQ--------SASFLKSVAELHKLHKGQSPAEAEYNFLEQAKKLELYGVDLYPAKESSGTSIGVGVSSSGVLVFRSGHR---EALYPWSSIMKLSFKKKLFSVYMRTLNEDNVEFNVQNPESCKALWKSCIEHHTFFRLIVPPTAPPKS-IFSIGSRYRYSGRTEFQSMEEMRRRERTFQRHGSRGSRATVTGTCSTSRTHTPSNITGTSPDLTSRLFSESAAPSTRRVSPSRRDVNPRIQDTSRVPPIQGSPSAYHRCPRETTFGIDEDGTWQSVHNMIVNGNAQACTSASIHHRTSNGHVTTNGFRKSALLNGSPSNT............................................................................................................................................................................................................................................................................................................................................................................. 555
266 0.000e+00UniRef50_UPI00094EEE61 FERM, RhoGEF and pleckstrin domain-containing protein 2 isoform X2 n=4 Tax=Euteleosteomorpha TaxID=1489388 RepID=UPI00094EEE61  ali  19  53..RGLQVRVQGLDESQEFDLDPRAFGQDLLSEVFLRGNLIESDYFGLEFQNMQLNWLWLEPTKLIVKQVRRPANSM-FRLAVKFFPPDPGQ-LQEEFTRYLFSLQMKRDLMEGRLICTENTGALLASHLVQSEIGDYDAAA-DRDFLMNNKLLPYQ---------EKVLEAIVDFHRKHLGQTPAESDFQILEIARKLEMYGVRFHPAADREGTKINLAVAHMGLQVFQGHTKIN---TFNWSKIRKLSFKRKRFLIKLHPEHQDTLEFMMGSRDQCKVFWKICVEYHSFFRLVDQPQPKPKTILFTRGSSFRYSGRTQKQLVEYVREKRTPYQRRNSKVQTSSRSFTIDVPKQSLSFNDRLRTPCSHPSSSVSFLSPHISSVVGPRKDHPAHHHPQQPPSPAMPPSPAXXXXXXXXXXXXXIPPKEEAVNGGNPPTHYSLSDMALDSPHLSRFEAAGPLSLSPSFQMSTLSLP............................................................................................................................................................................................................................................................................................................................................................................. 517
267 0.000e+00UniRef50_A0A1I7VVL2 Ptpn4 protein n=1 Tax=Loa loa TaxID=7209 RepID=A0A1I7VVL2_LOALO  ali  25  27..RTISCTVTFLDNTRKFEIERHAKGQILLNMVFDHLELVEKDYFGLQYISATGVKKWLDPTKSIRKQLFY--PPYQLYFRLKFYVSDPS-KLMEEYTRYHVFLQLRKDLLEGRLICPENTVAMLASYAAQSEFGDYSEEEHGTTYLNEFQFIPEQST--------ALIKDIIDLHKLHKGQSPAEAEFNFLKYAKDLDLYGIDLYPAKESNGSMIEIGVSNCGVVLVRCNRRETI---YPWSAIMKLSFKKKLFSIHMRVIKNDNIEFNIQNPESCKALWKSCIEHHTFFRLIAPPVPPPKS-FFSIGSRFRYSGRTEYQSMEEMRRR-ARVERRHSSRELQSTMNGNSSNSRDQTSSYRTKSP.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 388
268 0.000e+00UniRef50_U3JPE9 Erythrocyte membrane protein band 4.1 like 4B n=25 Tax=Euteleostomi TaxID=117571 RepID=U3JPE9_FICAL  ali  23  1...................LQKNAKGQELFDQIVYHLDLVETDYFGLQFMDASQITHWLDHSKFIKKQI-KIGPPYTLHFRIKYYSSEP-NNLHEEFTRYLFVLQLRQDILSGKLKCPYETAVELAALCLQAELGECEHPEHTPELVSEFRFAPNQ--------TEAMEFDIFQKWKECRGKSPAQAELCYLNKAKWLEMYGVDMHVVKGRDGCEYALGLTPTGILIFEGANKIG---LFFWPKITKMDFKKSKLTLVVVREQEHTFVFRLDSAKTCKHLWKCAVEHHAFFRLRAPANSKSRSDFIRLGSRFRFSGRTEYQATHGTRRRTSTFERRPSKRYPSRRHSTYKANNPVKAAQLCAKNTPEVHNYQPQYHPNIHPAQPLWHPHTPVNVSYPLNNSDLHP.................................................................................................................................................................................................................................................................................................................................................................................................................................................. 384
269 0.000e+00UniRef50_F1LYQ8 FERM, ARHGEF and pleckstrin domain-containing protein 1 n=620 Tax=Gnathostomata TaxID=35060 RepID=FARP1_RAT  ali  25  38..KLMTVKIQMLDDTQEFEVPQRAPGKVLFDAVCNHLNLVEGDYFGLEFPDHRKIVVWLDLLKPIVKQIRRPKHVLV-KFVVKFFPPDHTQ-LQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEAL-DREHLAKNKYVPQQ---------DALEDKIVEFHHSHIGQTPAESDFQLLEVARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINA---FNWAKVRKLSFKRKRFLIKLRPDYQDTLEFLMAGRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEKKVQFERKHSKIHSTRSLVSQPTAPNSEVPKQSPQSASLTFGEGTESPS.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 405
270 0.000e+00UniRef50_UPI0008403299 FERM, RhoGEF and pleckstrin domain-containing protein 2 n=1 Tax=Callithrix jacchus TaxID=9483 RepID=UPI0008403299  ali  22  42..KQLHLRVKLLDSTMEFDIEPKCDGQLLLTQVWKRLNLVECDYFGLEFQNTQSYWIWLEPMKPIIKQIRRPKN-VVLRLAVKFFPPDPGQ-LQEEYTRYLFALQLKRDLLEERLTCADTTSALLTSHLLQSEIGDYD-ETLDREHLKANEYLPGQQRC---------LEKILEFHRKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDREGTKIQLAVSHMGVLVFQGTTKIN---TFNWSKVRKLSFKRKRFLIKLHPEYQDTLEFLLGSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVLFSRGSSFRYSGRTQKQLVDYFRDKRLPYERRHSKTHMSIRALTADLPKQSISFTEGLRTPASPSSTNASFYPLSHSTLVPAGLPEFKDSSSSLTDPQVSYVKTSAAERSS........................................................................................................................................................................................................................................................................................................................................................................................................................................ 447
271 0.000e+00UniRef50_A0A1Z5L583 KH domain RNA binding protein (Fragment) n=1 Tax=Ornithodoros moubata TaxID=6938 RepID=A0A1Z5L583_ORNMO  ali  22  16......CTIRLLDDSLQCDFQHLHKGQYILDYVCSSLNLLEKDYFGLRYVDSHKQRHWLDLNKPVVKQV-KGMNPIVFCFRVKFYPPDPFR-LKEEITRYQVFLQLRRDLLHGRLYCNQNDAAYLAALVIQSELGDYDSDEHVGNYVSEFKLLLKQ--------PPKLEEKIAEIHQQLRGQVPAVAEMNFLRKAAQLETYGIDPHPVKDHKGNQLYLGINHAGILTFQGSRK---THHFKWPDIQKINYEGKMFIIHLMFEKKHLMGFKCPTQSACHHLRRCAIEQKYFFTMPSSSEVPSVGGLFSRGARFRYSGRVEKEVMDDLRRRDPPFTRPPSFRYKPPGQPQTSPSIQATAPTYVSSQRPSLVTEATSTPQANH........................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 390
272 0.000e+00UniRef50_N6SZZ7 Uncharacterized protein (Fragment) n=6 Tax=Arthropoda TaxID=6656 RepID=N6SZZ7_DENPD  ali  26  13...TIHCKIVFLDETLVHELQRTSAGQLLLDTVFKHLNLLETAYFGLRFLDQNGQTHWLDPNKKLSRQLRGDDL-CTMYFGVKFYAADPCKLL-EEITRYQFFLQIKQDILQGRLLVAFDLAAELGAFVLQSELGDFDPRRHGYGYVSEFRFLPNQ--------SAELELRIAELHQTLIGQMPSQAELSYLDKVKWLEMYGVDLHPVLGEDHVEYFLGLTPSGIIVLRNKSTVG---NYYWPRITKIYFKGRFFMLRVKSNDECTYGFETPSKCACKHLWKCCVEHHAFFRLVQ--VAPTSPDIFALGSRFR.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 310
273 0.000e+00UniRef50_UPI0007B830B3 FERM, RhoGEF and pleckstrin domain-containing protein 1-like n=6 Tax=Clupeocephala TaxID=186625 RepID=UPI0007B830B3  ali  18  34MPRLVPIRVVLLDDSEEFNISHRASGRVLFEMVCLHLNLIEGDYFGLEFQSHHRKMVWLDLLKPIRKQITRPKHIF-LRFVVKFFPPDHS-LLLEELTRYLFALQVRQDLASGRLTCSDASAALLVSHIIQSEIGDF-EETQCRQHLLNTNYIPDQM---------ALMDKIVEFQHKHIGQTPAESDYRLLEVACRLEMYGIRLHPAKDREGTKLSLAVAHGGVLVFQGHNRIN---NFNWSKIRKLSFKRRRFLIKLRADNQDTLEFLMASRDCCKMFWKICVEYHAFFRLFEEPRPKPKPVLFSRGSSFRFSGRTQRQVIDYVKEKKLPFDRKHSRVQYNSSLSPLRSAQHNQAVKQSWEGSFLVSSEDSAVIRPCGNSSTSSQRNGCSDQTYTIQEDSRSPAAKQQPVDRAGLASHAAKGSSSSIPYIDCSDAEFSEQEVRGRVSRSHSHTRDGNSDSAYGTGFGLPRSHQQDRYLGKFRQRESLPLSPVSQATSPAHSYPSPSSPNQSANIFESPFFGGRVRVPLHSTLLEELATKSSLNHHTGTRSLTSSPAPSSIHRTSSLSTGRSFSSKAGWEERGGLFSSCSPIMNRSANKSQNTVNQLERNMRVSNQPHPPVLSRAERMAMLERRMLANGLTP-PGKANLKPSSPHRRFGAVQMIDGSTSSGTDTSDSEE............................................................................................................................................................... 717
274 0.000e+00UniRef50_A0A2C9L6V5 Uncharacterized protein n=9 Tax=Euthyneura TaxID=216307 RepID=A0A2C9L6V5_BIOGL  ali  15  29VPKKLVCTIMLLDETITVDINKKATGGTLIEQVFYHLDVIEKDYFGLQYTDHYNVNHWLDPTKQVRKQV-KIGPPYTFRFRVKFYSSEP-NNLHEELTRYQFFLQLKQDIYSGRLPCPYETLVELCALALQSELGDYDPDVHSAGTVSEFRFVPNQ--------SEEMEIDIFEKYKDCSGQTPAQAELNYLHKAKWLELYGVDMHTVMGKDNNSYSLGLTPTGILVFEGTTKIG---LFFWPKMTKLNFKHKKLMLVAVEDDEHSFQFQCTTEKACKHLWKCAVEHHAFFRLKGPVKPTGRQNFFRMGSRFRYSGRTEYQTATLNRRRSVKFERKPSHRYSRRPTFERKERKLKREAEMKKRMEEDRERRAAIAANKPSVETTFDSLPDSARASMNSNSTTATARSSVRVPDSPPPRPPKPGTRKAAKSSSASSEVPESIVPSASAIERLDNLIKSSALEKGSGEPSGSKSPTTECNINLKEESEKAIAKMKNLDESVPVPVKRKDVNTFQNNQLKFTGGASTIPPENMKCNILKAKMEEEHHKDDDDDRSPELSESSSEEEVEKNLRHDLSVTLESCGDEEQKLINNSFAAEAPRPRKERQSSKTSNHSLNNGYESKSSLVENIADRGVKGSTSRVIPENGSIDRKSRNAENETDRKARYAINDSGSSEKKSKSTNIDEPYIPEKRQSSRKS................................................................................................................................................. 731
275 0.000e+00UniRef50_UPI0009751472 tyrosine-protein phosphatase non-receptor type 4 isoform X6 n=8 Tax=Crassostrea TaxID=6564 RepID=UPI0009751472  ali  24  72.PKMVTCIVHFLDDSQQFEVDKKAKSQVLLDKVFGHLELVEKDYFGLQFVDPDGMMRWLDPLKTIKKQC--RGPPYEFYFRVKFYVSDPS-KLEEEYTRYHFFLQVKRDILEGRLVTPPSTAALLASFAIQSELGDYNPDEHKGNYISDYRFIPHQ--------TEDFEKQVSELHKQHRGQTPADAEYHYLDKAKRLEMYGVDLHNARDQSNIDIQLGVTSVGLVVFQNNVKIN---TFPWAKIVKISFKRKQFFIQLRREMNDSIGFNMVSYRSCKNLWKSCVEHHTFFRL--YVPNPPSKKIFSMGSKFRY--------------------RSPSKKFARRTVSGHTRDQIIQERNFIDGHRNLPKSQTFGGTPSTARPKSSNSVNHSFNRYESINNQKRATLPHD.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 493
276 0.000e+00UniRef50_A0A1D2NME6 Band 4.1-like protein 5 n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2NME6_ORCCI  ali  16  5...................ITKKALGSELYEQVFYSLDLIEKDYFGLQFTDVNHVQHWLDATKPIKKQV-KIGPPYTLRLKVKFYTSEP-QHLREELTRYQFFLQVKQDILTGKLVIPQQTAIELGALAIQSELGDYDPEIHTPSFVSEFRFTPDQTEEMEILILEEF--------KKLTGQTPAQAEMNYLNKAKVLEMYGVDMHTVLGKDGCEYSLGLTPTGILVFEGNQKIG---LFFWPKIARLDFKKKKLCLIVVREREHTFVFRLHNEKAAKHLWKCAVEHHAFFRLKGPVKPSARQNFFRMGSRFRYSGRTEIQTLAQNRRRTVQFERRPSQRYARRQSHILRERQRP----IGFAPVAPQTQPTAAAVSEPETVLLQEPRVLHPRSGASTPNNPGVSTPGSPPVTPTSRSTPSPSSASPNDESSTPPPPEDDPLDNLIKSIAKETGGFMTTETSVVDADVNVIPNNQTKYFSLPKPLPPDKVKCNIWKAKQLEDDLKKPSAAETNGSSHTVLNGENYPPAKKRENALQNGRENASTDAATFISVGGDKLTLPYNGPLTSTQSVSANSSTSRTSVETDIDNSLNDEDNESAPLLPPPPVTVTHFTAKGKIEKIKLSSESSSVSPKILREKDSDIETNIDDDDFSSEKEILLIEGPLSIPSFVKNDVSSTNNSNPFTHPF--LNSNVSTAATTVTNIGTSSASTKS............................................................................................................................... 688
277 0.000e+00UniRef50_UPI000BA8206F FERM, RhoGEF and pleckstrin domain-containing protein 2-like isoform X1 n=4 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA82  ali  22  1...MLSVEVRFLDESVNFQIQYKATGNVLFDQACKMLNLLEVDYFGLEYADSNNTKYWLDQDKPMCRQLGLSLVNPVMYFRVKFYTPDPAH-LEEEYTRYLFSLQIKQDLAQGALQCNDNTAALIASYIVQADCGDYSLDDYPDHYLSSFKFVPHQD--------DELERKIMENHKKHAGQSPSEADMNLLETARRCELYGIKMTPAKDHDGVPLNLAVAHMGILVFQHSTKIT---TFSWAKIRKLSFKRRRFIIKLHPEYKDAVEFFFEGRNSCKNFWKKGIENHGFFRCSEVRKPRQRARIFSRGSSFRYSGRTQKQITEFVREKRQPFQRSTSLRIPSTSRRSVGNSVLGQPLLPVTSSQSCGSVALNDSGP--IFTASEPRPISASQPSSPRTIQEPERMAINGTVYSEEKERPARQRDFSSGLESPDFEYDKDGLYSPDAIGHDTDDNLSHDSYHLEEHIVGLESPYFYHSSTKGNVSPTSCRDGSTVRSEASFSL-CVPSSTDDLTQSPITPMKGVKNGSDLLASPETNSEKRKQKTTPDIAYFIAKELLMTERKYKKELELI............................................................................................................................................................................................................................................................................ 564
278 0.000e+00UniRef50_A0A238BXN6 Uncharacterized protein n=1 Tax=Onchocerca flexuosa TaxID=387005 RepID=A0A238BXN6_9BILA  ali  24  27..RTISCTVTFLDNTRKFEIERHAKGQILLNMVFEHLELVEKDYFGLQYISASGVKKWLDPTKSIRKQLFY--PPYHLHFRLKFYVSDPS-KLTEEYTRYHVFLQLKKDLLDGRLICPENTVAMLASYAVQSEFGDYSEEEHGTSYLNEFHFVPEQSTT--------LVKNVIDLHKLHKGQTPAEAEFNFLKYAKDLELYGVDLYPAKESNGAMIEVGVSNNGIVLVRCNRR---ESIYPWCAIMKLSFKKKLFSIHMRMEEDTVVIFNIQNPESCKALWKSCIEHHTFFRLIAPPAPPPKS-FFSIGSRFRYSGRTEYQSMEEMRRR-ARVERTFLRRSNRESQTTMNGNSLGSRDFTSSYKTNSPAITSR.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 411
279 0.000e+00UniRef50_A0A0V1HJR2 Tyrosine-protein phosphatase 1 n=19 Tax=Trichinella TaxID=6333 RepID=A0A0V1HJR2_9BILA  ali  19  48..RTLHCTVHFLDGSHDFELEKHALGQDLLNLSFEYLELLEKDYFGLQFTDGPDSMRWLEPTKSIRKQMQ--CPPYILHFRVKFYVSDPSKLL-EEYTRYHFYLQLRKDILDGHLVCPEPSLALLASYAVQSEFGDHSSEEHGDNYLSSFRFISKQ--------SATFLQKVADLHKQHRGQTPADAEFNFLDHAKRLDTYGVELYHAKDGNLAEVQLGVGAFGVGLFQQTVRAN---TYPWSKIVKISFKRKQFFLQLKPEPDAVLSFTLSSTLTSKLLWKSCIEHHTFFRLVSPPAPVSKP-LFAFGSRFRYSGRTEYQTLEEMKRRQRPFTRFNSNGCFARSTICGGSTTYGRCKEAANFVGSPSTSGTNVHNSSAPSTSASFKHANSTVDGTPANGPCELIPSSAANSNGFEKQLPSSCKQQTDSLVRKMPLETTFGLGGTTVEIIDQSFDFPSTSAQQRSSASLGLSSSHFSTGTTVHHH.................................................................................................................................................................................................................................................................................................................................................................. 529
280 0.000e+00UniRef50_UPI000C207C7E band 4.1-like protein 3 n=1 Tax=Onthophagus taurus TaxID=166361 RepID=UPI000C207C7E  ali  28  27...NVVVKVAMLDGTLELGISKKSKGQELLNTVCELANILEKEYFGLIYTKKRSSRNWLDMEEKIERHI--KFEPWLIHFEVKFYPPDPSQ-LQEDITRYQLCLQIRNDILNNKLPCSLVTLALLGSYLVQSELGDFNSETMQDDYLSSFKF--------GFDQNEELESKIMELHKLHKGETPAQAELNFLENAKKLPMYGIDFHSAKDSDGFEIRIGVHSSGLVIFKNQLRMNK---FVWPKIVKISFKEHNFYIKLRDEFQSTVCFKLESYRDAEKLWKSAVEHHSFFRLMSPRD-KEKRILPRLGSKFRYSGRTLYQT------RQEKIERPAPKFERS................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 350
281 0.000e+00UniRef50_U6PC34 FERM and FERM central and FERM adjacent (FA) domain containing protein n=3 Tax=Trichostrongyloidea TaxID=6314 RepID=U6PC34_HAECO  ali  23  27...TITCTVSFLDAERQFQVDRHAHGSVLLDKVFAHLELVERDFFGLQFLTKDTQKRWLDPNKSIRKQMV--CPPFHLCFRVKFYVSDPS-KLVEEYTRYHFFLQLRLDMLEGRLPSAEGSLALLASYAVQSELGDYSPEDHPEGYLNQYRFAPTQSIDFPK--------RVAELHAMHRGQSPAEAEFNFLEHAKKLDMYGVDLYAARDGKNLPIGIGVNSYGMVVFHEGTKINE---FAWATIMKISFKKKNFYVHIKLGEDTVLSFHVMSSPACKQLWKACIEHHTFFRLIAPPLAPPR-GLLSIGSKYRYCGRTEFQTMEDVKQR-ARVERT---FHRSHSKSSFLRSTFSGVPSCDTSRTFTPTTASPDVSSRSHGGSCSTSRNRNKMMSGGDESSILLSTPPLNGYSSDGTLSRPHREPRERSIRDAKR.................................................................................................................................................................................................................................................................................................................................................................................................................... 450
282 0.000e+00UniRef50_A0A194QBU0 Protein 4.1-like n=18 Tax=Obtectomera TaxID=104431 RepID=A0A194QBU0_PAPXU  ali  21  35.....RANVEILDGSMELDVDRKIRGHELLAKVCDSLNLVEKDYFGLLYEDRGDPRVWIDLEKRVSKMIKR--EPWEIRFAVKFYPPEPAQ-LQEELTRYQLVLAVRRDLLEGRLPCSAVTHALLASYLLQSELGDHEESQAGAALCRQLKLVP------PAACTPELEEKVVELHKTHRGQTPAEAELNYLENAKKLAMYGVDLHPAKDSENVDITLGVCSSGLLVHREKLRIN---RFAWPKILKISYKRHNFYVKLRPQFESTVGFKLANHRAAKKLWKTCVEHHTFFRLMSPEPAARGTLFPRLGSRFRYSGRTHYES------RAAPPQRAPPHFARTLSSRKLSSRSMDALAAGDKDESMPPDAAKRHTMPPQPAPRPTIKDKQLRRRS............................................................................................................................................................................................................................................................................................................................................................................................................................................................ 411
283 0.000e+00UniRef50_A0A0R3R4U2 Uncharacterized protein n=2 Tax=Ecdysozoa TaxID=1206794 RepID=A0A0R3R4U2_9BILA  ali  26  27..KLMCIKVRMLDDSVVFHLGHKALGQALFDEVCRHLNLLECDYFGLEFTDCYGNRCWLDKDKPILRQITTTHSDARFYFIVKFYTPNPA-DLVEEYTRYLFALQIKRDLAMGELLCNENTAALLVSYIVQSDCGDFAAEDYPDDYLSSARFIPNQNT--------EFQRKVMENHMKLIGMSPGESDLTLLETARRCDYYGVKLHAAKDVEGTEVNLTIAHMGIRVFH---QFQCVSTFSWAKIRKLSFKRRKLLIKLHPEYKETIEFLFETRNECKNFWKKCVEHHTFFRCIEVLPVKKTRRFFSKGSAFRYQGRTQKQLIDYTRKRREPFTR........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 358
284 0.000e+00UniRef50_A0A2A2JWT6 Uncharacterized protein n=2 Tax=Diploscapter pachys TaxID=2018661 RepID=A0A2A2JWT6_9BILA  ali  21  48..RQLCCKVLLLDGSLNVVVSKNAAGAEVYEQVFYSLDLEERDYFGLQFTDHYNVQHWLDPAKKIAKQV-PIGPPYTFRFRVKFYTTEPTSNLKEELTRYQYFLQLKDDILNNRLPCPKDMAAELAGYALQSELGDFNPMEHTAVTVSEFRFHPEQD--------EAMDLEILERYKLCRGQTPAQAEINYLNRTKYLEMYGVDMHIVRGRDGNNYKLGLTPQGMLVFDGAQKIG---LFFWDKIQKLDFKNKKLTLVVEEDADHTFVFNLESHKACKHLWKCAIEHHSFFRLKTHLGPRQRSQLFRLGSTFKYRGRTEYETVRLSRRHSSTFERRPSQRYGPRESHAVNRQIRRDQFKQEVAASVLPPSDLMAGIHLNDTRQISAGNTVSSPLISTYHPPS..................................................................................................................................................................................................................................................................................................................................................................................................................................................... 451
285 0.000e+00UniRef50_E0V975 uncharacterized protein n=10 Tax=Bilateria TaxID=33213 RepID=E0V975_PEDHC  ali  29  31..KTIDSVVIFLDDTHTFRIDKHAKGQELLDAVFLHLELIEKDYFGLQFVDNGNLKIY----NYYFTVVFSKKAILEIIFLVKFYVMDPS-KLQEEYTRYHFYLQVRKDILSGRLIVPTSAACLLASYMVQSELGDYNPVDHSYGYLSTLALIPNQN--------EELERKICELHKLHKGQTPADAEYNFLDHAKRLEMYGVDLHKARDSSNKEIYLGVSSIGLVVFQNNIKVN---TFSWSKIVKISFKQKQFFVQLRREQSENYGFNMVSYRSCKSLWKCCVEHHTFFRLQSPQLRSRRFPLFGIGSRFSYSGKTEFQTVEEGKQR.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 349