current user: public

If you have questions about the server, please let us know.

Query: IDP04391 gene: cotJB; spore coat protein CotJB [Clostridium perfringens ATCC 13124] CPF_1067 [Clostridium perfringens ATCC 13124], from CSGID

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# E-value Template Links and tools%idFirst MKALELLDDIQKLQFYAVELNLYLDNFPENRKATEDYKEISSKLSELIERFECEYGPIRNFGQAYVENPVAWIEQPWPWEIRYLast
1 2.000e-33UniRef50_UPI0008DA01E3 spore coat protein CotJB n=1 Tax=Romboutsia timonensis TaxID=1776391 RepID=UPI0008DA01E3  ali  42  5.NRYEIILKIQELSFACVDLNLYLDTHPDDANAVNMYNSFSKQLNEAIRNYECKYGPLTNFGYGKSGCPWQWIDQPWPWDREF 86
2 1.000e-31UniRef50_A0A1Y4SHD8 Uncharacterized protein n=3 Tax=Lachnoclostridium TaxID=1506553 RepID=A0A1Y4SHD8_9FIRM  ali  29  28.SRQQLMKNIMLYGFACVDASLYLDTHPDDAEALSYFKEHNRIYQEAVEEYSKTYGPLTIAHAHHCGAYWNWVDQPWPWQ... 106
3 1.000e-30UniRef50_A0A0H3JBJ7 Spore coat peptide assembly protein CotJB n=27 Tax=Clostridiales TaxID=186802 RepID=A0A0H3JBJ7_CLOPA  ali  45  9.SREELMDNIHQLKFAAVDLNLYLDTHPDCKPALTDYNNITSDLKAVIAMYEKKYGPLTNFGGAESKHPWSWVDEPWPWESG. 89
4 1.000e-30UniRef50_A0A1G9DWW9 Spore coat protein JB n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1G9DWW9_9CLOT  ali  36  4.ERIALMKRIQEVEFAATDLQLYLDTHPQDQRALMQFNQYAAELMMLKQQYELAYGPLLNFGFSQSQYPWRWIETPWPWEEEF 85
5 1.000e-30UniRef50_UPI0008334F73 spore coat protein CotJB n=1 Tax=Desulfotomaculum intricatum TaxID=1285191 RepID=UPI0008334F73  ali  42  4.DRLIMLRQIMELEFTAVELNLFLDTHPDSSEALNYFNQISEELRQAKAQYEMNYGPLMNYGFSPSQYPWQWIEEPWPWEIDY 85
6 2.000e-30UniRef50_A0A0A2UXY4 CotJB protein n=174 Tax=Bacillales TaxID=1385 RepID=A0A0A2UXY4_9BACI  ali  38  11....ELLEEIQAVDFVLVELTLYLDTHPEDYEAIKQFNQYAQQSKKLKKQYEQQYGPLRQYGESYSGYPWNWNNAPWPWQV.. 87
7 3.000e-30UniRef50_D4M4V0 Uncharacterized protein n=13 Tax=Clostridiales TaxID=186802 RepID=D4M4V0_9FIRM  ali  29  8MNRRELFEYINQISFAVDDVKLFLDTHPENQKALDYFQKYKEKRMEALKEYAEVYGPLTVDTVSENSDCWNWINEPWPWQEG. 89
8 4.000e-30UniRef50_A0A0B7MFD7 Protein CotJB n=90 Tax=Firmicutes TaxID=1239 RepID=A0A0B7MFD7_9FIRM  ali  38  1MDQMRMLRELQELEFALVELNLYLDTHPCDTQAIKTFNELAVRYEQARKAYEDKYGPLVNFGHSGPSHVWQWIDEPWPWEIEY 87
9 7.000e-30UniRef50_A0A2N2ANI0 Spore coat protein CotJB n=10 Tax=Firmicutes TaxID=1239 RepID=A0A2N2ANI0_9FIRM  ali  37  7.QQAKMLKEIMSYEFTAVDLNLYLDTHPCDMKALAEYNCVTHQLDILKRAYEQCYGPLAAFGSTPSQFPWMWIDEPWPWEVEF 88
10 1.000e-29UniRef50_S0FJI7 Uncharacterized protein n=2 Tax=Ruminiclostridium TaxID=1508657 RepID=S0FJI7_9FIRM  ali  25  45.ERESMLLQVQAYEFALVEVGLFLDTHPNDQTALAYFGQYRELKHRAVSDYTRMYGPITMDHMDNDLSTWRWIDNPWPWETG. 125
11 1.000e-29UniRef50_A0A1M6CEX6 Spore coat protein JB n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1M6CEX6_9CLOT  ali  48  6.DRLELLKEIMALDFSLIELNLYLDTHPEDEKALMVFKQYSCKSRELKEKYENQFGPLTASNGANRE--WKWIEDPWPWEIDY 85
12 2.000e-29UniRef50_A0A151AM26 CotJB protein n=10 Tax=Clostridium TaxID=1485 RepID=A0A151AM26_9CLOT  ali  39  11.SRTELLRQIQQFEFALVDLNLYLDNHPTDKKAIEDFNDIQEKYMKLKKEYENKFRMFANFGNSKADSSWSWVDDPWPWERG. 91
13 2.000e-29UniRef50_R6H1B5 Spore coat protein COTJB n=7 Tax=Clostridium TaxID=1485 RepID=R6H1B5_9CLOT  ali  33  39..KEEMLQQIRCCDFAITELALYLDTHPQDDRALCLHRKYCKEAKELKDKYQKVYGPLTI---NFPCNKWRWIEEPWPWEGG. 115
14 2.000e-29UniRef50_A0A178U454 Polypeptide composition of the spore coat protein CotJB n=84 Tax=Terrabacteria group TaxID=1783272 RepID=A0A178U454_GEOTM  ali  41  10....ELLEQIQTVDFALVELTLYLDTHPADYQAIQQFNQLSQRRKHLKKQFESAYGPLQQFGNSYSNYPWNWNDAPWPWQI.. 86
15 4.000e-29UniRef50_A0A0A1SEG7 Spore coat peptide assembly protein CotJB 2 n=8 Tax=Clostridiales TaxID=186802 RepID=A0A0A1SEG7_PAESO  ali  38  4..RAEMLTTIEELCFACVDLNLYLDNNPEDARAIATYNKLCAEFAKARMCYEKKFGPLTNFGYSPSQCPFQWVESPWPWENEF 84
16 4.000e-29UniRef50_F0Z3V4 CotJB protein n=41 Tax=Clostridiales TaxID=186802 RepID=F0Z3V4_9CLOT  ali  25  6.CRKDLLDHINAVSFAVDDVKLFLDTHPCDEDALAYFREYSRMRNEALKEYAAYFGPLTIDTTVYSCDRWDWVNEPWPWQEG. 87
17 4.000e-29UniRef50_R6SUH7 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:58 TaxID=1262824 RepID=R6SUH7_9CLOT  ali  22  90.SRQALMKQINEASFAVDEAVLFLDTHPDCAQAMQYYQSAVGARKAAMDAYQSRFGPLLVDDVI--GNTWTWVTEKWPWEGG. 168
18 4.000e-29UniRef50_B0ADH4 Spore coat protein JB n=13 Tax=Clostridiales TaxID=186802 RepID=B0ADH4_9FIRM  ali  37  6.CRYDLIKAVMELGFAAVDMNLYLDNNPDDQTAVSTYNSFVSQYAKARCNYEKQYGPLTNFGHAPSNCPWQWVEAPWPWEKEF 87
19 5.000e-29UniRef50_A0A1Y4IEW0 Spore coat protein CotJB n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1Y4IEW0_9FIRM  ali  31  8..RKQMLSWINMVSFAVVEANLYLDTHPADPTALAYFREYSQLRRQALDDYAAIYGPLTLDTAPAGQEQWEWINQPWPWEGG. 87
20 5.000e-29UniRef50_C0CLX7 Uncharacterized protein n=6 Tax=Firmicutes TaxID=1239 RepID=C0CLX7_9FIRM  ali  24  33.SREVLLKRINEVSFAVSDILLFLDTHPDCQEALAFYQKNVAIRKEALAEYARLYGPLTIDTDDTCSRSWEWVQQPFPWEVK. 114
21 5.000e-29UniRef50_A0A0J1GEK5 Uncharacterized protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A0J1GEK5_9FIRM  ali  30  153.SREELMCYINEVSFAVNDMVLYLDTHPCDEKALAFCKEHVKKRDKALREYAALYGPLTIDTTDDVKSTWEWVMQPWPWERG. 234
22 6.000e-29UniRef50_A0A0D5NKU4 Uncharacterized protein n=64 Tax=Bacillales TaxID=1385 RepID=A0A0D5NKU4_9BACL  ali  40  13....EKLEELQQLDFALVELNLYLDTHPGDLQALQQFNQLAQKYKECMQQFEMQFGPLMNFGHSYSRYPWQWNDTPWPWQV.. 89
23 9.000e-29UniRef50_R9MLC5 Uncharacterized protein n=20 Tax=Firmicutes TaxID=1239 RepID=R9MLC5_9FIRM  ali  27  7.CRHELMEWINIVSFAVDDVKLFLDTHPCNTEALEYFEEFKKQRVQALKEYAKFYGPLTLDTASSCEDHWTWIHEPWPWQEG. 87
24 9.000e-29UniRef50_UPI0009DF5129 spore coat protein CotJB n=1 Tax=Robinsoniella peoriensis TaxID=180332 RepID=UPI0009DF5129  ali  30  42.SREELMCYINEVSFAVNDMVLYLDTHPCDEKALAFCKEHVKKRDKALREYAALYGPLTIDTTDDVKSTWEWVMQPWPWERG. 123
25 1.000e-28UniRef50_A0A143X5P8 CotJB protein n=2 Tax=Clostridiales bacterium CHKCI006 TaxID=1780379 RepID=A0A143X5P8_9FIRM  ali  32  59..RQACLMQVQILEFAAHELNLYLDTHPDDEKMLALFNEYNACALKVRKEFEVKFGPLAVSDVNADCTSWIWIQGPWPWERQ. 138
26 1.000e-28UniRef50_R6DLX9 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=R6DLX9_9CLOT  ali  27  4.EQHQLLMYIDQISFALDDTVLFLDTHPCDTEALAYYQELKEERKMAMEKYASKFGPLQN-DNVKCGCSWSWVETPWPWESE. 83
27 1.000e-28UniRef50_C8W3H7 CotJB protein n=4 Tax=Firmicutes TaxID=1239 RepID=C8W3H7_DESAS  ali  38  1MDKERLLKCIMELEFTAIDLNLFLDTHPNDRRALAHFEKTVMELGKEKREYEERYGPLTFYSGASNKNYWQWIEEPWPWEIVY 85
28 1.000e-28UniRef50_N9XDT1 Uncharacterized protein n=13 Tax=Bacteria TaxID=2 RepID=N9XDT1_9CLOT  ali  28  6MNCSALLQAVYEASFAMDDVILYLDTHPSDQDALNYYQYVSDLRKQAMDAYEAQCGPLM-FDEVRSDNYWTWVNNPWPWEGE. 86
29 1.000e-28UniRef50_A0A0B5QDB4 Spore coat protein CotJB n=14 Tax=Clostridium TaxID=1485 RepID=A0A0B5QDB4_CLOBE  ali  58  1MNQREMLNSIRVYQFCAVELNLFLDNFPEDKNAKEDYNKVSCKLTELISAYEKNFGPLTNFGSAYVENPKAWVNTPWPWEN.. 81
30 2.000e-28UniRef50_A0A1F8UFA3 Spore coat protein CotJB n=6 Tax=Clostridiales TaxID=186802 RepID=A0A1F8UFA3_9FIRM  ali  42  17.NYEDLLLEIQKFEFATVDLNLFLDTHPDNQRALNDYNMYTVELSKLKKEYRLKFGPLANFGSAPSMSPWQWVETPWPWEV.. 96
31 2.000e-28UniRef50_A0A1I4HL52 Spore coat protein JB n=1 Tax=Pelosinus propionicus DSM 13327 TaxID=1123291 RepID=A0A1I4HL52_9FIRM  ali  43  1MNCEKMLKKIQEIQFVAVELNLYLDTHPCDADAINDFNCAVQILEKRKQAYQDEFGPLLNFGGGYSKEPWQWVESPWPWEI.. 85
32 2.000e-28UniRef50_A0A1Y3PCU5 Uncharacterized protein n=1 Tax=Bacillus thermozeamaize TaxID=230954 RepID=A0A1Y3PCU5_9BACI  ali  37  1MSRDKLLEEIQAVGFALTELSLYLDTHPWDQQALGDLNSLSKHYRMLTHEYECRFGPLYNLGHSISPYPWKWNEPPWPWQM.. 81
33 2.000e-28UniRef50_UPI00048793CF spore coat protein CotJB n=2 Tax=Ruminococcaceae TaxID=541000 RepID=UPI00048793CF  ali  25  6.ERESMLLQVQAYEFALVEVGLFLDTHPNDQTALAYFSQYRELKHRAVSDYTRMYGPITMDHMDNDLSTWRWIDNPWPWETG. 86
34 2.000e-28UniRef50_A0A1C5KH80 CotJB protein n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C5KH80_9CLOT  ali  28  42MNQEQLLAYINQVSFVVSDMLLYLDTHPTDREALAYCEDHIAMRNKALKEYAVLYGPITIDSDDASSECWEWVNTPWPWEGR. 124
35 2.000e-28UniRef50_U2PZE2 Spore coat peptide assembly protein cotJB n=3 Tax=Clostridiales TaxID=186802 RepID=U2PZE2_9CLOT  ali  37  1MDKKDLLKKIQEVGFSLVDVNLYLDNYEDNKDALEYFNCLSKELMDLRKEYEKKYGPLTNYGIQTAKDWDQWVSGPWPWERKF 83
36 2.000e-28UniRef50_A0A1C5W707 CotJB protein n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C5W707_9CLOT  ali  30  48.SKDQLLRLIATTGFACVDACLYLDTHPEDSEAIAYFREMNLKYQEALHEYSQKYGPLNLSHVHHPTDYWKWVDQPWPWQ... 126
37 3.000e-28UniRef50_UPI00085CA6E5 spore coat protein CotJB n=1 Tax=Cellulosilyticum sp. I15G10I2 TaxID=1892843 RepID=UPI00085CA6E5  ali  28  5.EREELLRCIDTTSFAIDDVTLYLDTHPTDKAALEYYAKVNALRKQAIKDYTTYFGPLMIDD-VNTTNIWSWVQDPWPWEME. 84
38 3.000e-28UniRef50_F6B790 Spore coat peptide assembly protein cotJB n=6 Tax=Clostridia TaxID=186801 RepID=F6B790_DESCC  ali  39  5.QQAQMLLQIQQLEFAAVELNLFLDTHPDDQQALALYNQVHQQLMQCVQNYEQYYGPLLSYGFSPRQNTWVWAETPWPWEIKY 87
39 4.000e-28UniRef50_A0A1M4VKP2 Spore coat protein JB n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1M4VKP2_9CLOT  ali  29  8.CKEQLLQLINEVSFAVDDILLYLDTHPCDEKALAFYQEKIAIRKEALKEYAAYYGPLTIDTDDACSDSWEWVMQPWPWEVK. 89
40 4.000e-28UniRef50_A0A1H8ANA0 Spore coat protein JB n=1 Tax=Lihuaxuella thermophila TaxID=1173111 RepID=A0A1H8ANA0_9BACL  ali  40  5.EQFRHLRRIQEIDFVLVELNLYLDTHPDDLQALEQYNWLARQRAGLVSSYEQQYGPLTNFGHSLNRYPSGWDEGPWPWEM.. 84
41 4.000e-28UniRef50_F5SKE8 CotJB protein n=12 Tax=Bacillales TaxID=1385 RepID=F5SKE8_9BACL  ali  40  18....KLMKEIQTVDFVLVELNLYLDTHPDDQQAVQQYNEFVQRSAALKNRFQSMFGPLYGFGNSYATCPWSWKEAPWPWQV.. 94
42 5.000e-28UniRef50_A0A031WDQ0 CotJB protein n=32 Tax=Clostridiales TaxID=186802 RepID=A0A031WDQ0_CLODI  ali  40  4.NRRELLERISEYQFACIELNLYLDNNPRDKKALDSYNRYCDKFTQAVCDYESKYGALTNFGYESSEYPWSWISEPWPWDKSF 85
43 6.000e-28UniRef50_F8FF54 CotJB1 n=187 Tax=Bacillales TaxID=1385 RepID=F8FF54_PAEMK  ali  34  1MERKALLQELQAIDFVLVELTLYLDTHPGDAQAIAQYNQFAQYRMGLAHQFQQEFGPLTSYGHSFSKQPWEWVEVPWPWQV.. 88
44 6.000e-28UniRef50_A0A0Q1FTT0 Uncharacterized protein n=10 Tax=Clostridiales TaxID=186802 RepID=A0A0Q1FTT0_9FIRM  ali  26  1MNREKLLAYITQVSFAMDDTVLFLDTHPCDKDALCYYNKLKKERKEAVNEYTQKYGPLSKYD-VPDSCYWEWVKDPWPWE... 81
45 8.000e-28UniRef50_A0A078KME2 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A078KME2_9FIRM  ali  26  3.EREMLLKKISTVSFAMFDLHLYLNTHPNDTEALKLHDKYAKQRQFLVDQFTSKFGPLNTRDITPST-RWQWINSPWPWE... 80
46 8.000e-28UniRef50_C9RAX6 Uncharacterized protein n=1 Tax=Ammonifex degensii (strain DSM 10501 / KC4) TaxID=429009 RepID=C9RAX6_AMMDK  ali  43  8.EKYELLHEIQKWRFRVLELVLFLDTHPDDNRALEDYNEAAKRLHSLQRTYEERYGPLTNFGGAPSGHTWTWIEELWPWETG. 88
47 9.000e-28UniRef50_A4IQC1 CotJB protein n=41 Tax=Bacillales TaxID=1385 RepID=A4IQC1_GEOTN  ali  37  12......LEELQAVDFALVELTLYLDTHPTDYQAIQQFNQLAQKRRQLKKQFEAAYGPLEQFGHSYSNYPWNWDDTPWPWQV.. 86
48 1.000e-27UniRef50_R6XLB9 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:798 TaxID=1262841 RepID=R6XLB9_9CLOT  ali  39  87MTRAEMLEKIRCLGFSVVELAEYLDTHPEDEKALCLHREYATKLRELADKYQKVFGPLTI---TFPCNKWRWLEEPWPWERG. 165
49 1.000e-27UniRef50_A0A212LY06 Protein CotJB n=4 Tax=Firmicutes TaxID=1239 RepID=A0A212LY06_9FIRM  ali  41  6..QRALLRKVQEMEFVAVELNLYLDTHPCDQEALHDYNCAVEMLTKYKEKYQAEFGPLLNFGGGPSREPWQWVQGPWPWE... 84
50 1.000e-27UniRef50_N2BFQ0 Uncharacterized protein n=1 Tax=Eubacterium plexicaudatum ASF492 TaxID=1235802 RepID=N2BFQ0_9FIRM  ali  30  6.NRQELLSWINKVSFMAYDMALYLDTHPDDQQAFEFFQKYSQMRRQALSNYAAQFGPLTMDCINT-DDHWQWADQPWPWEGGY 86
51 1.000e-27UniRef50_A0A231RAI7 Spore coat protein CotJB n=1 Tax=Cohnella sp. CIP 111063 TaxID=1955714 RepID=A0A231RAI7_9BACL  ali  39  49..RRELL-ELQKTDFALVELTLYLDTHPNDMQAVQQFNQLSQRRRQLAHDFEMKYGPLLQFGLSYSRFPWQWNDTPWPWQV.. 126
52 1.000e-27UniRef50_D4S1Q6 Uncharacterized protein n=2 Tax=Butyrivibrio TaxID=830 RepID=D4S1Q6_9FIRM  ali  32  6MDSKELMKKIMEYGFAITDLGLYLDTHPKDTDSLMTYSSLRDTYNSLIIEYTRRYGPLTIT-QVTSDNYWTWISTPWPWEG.. 85
53 2.000e-27UniRef50_D4LX56 Uncharacterized protein n=24 Tax=Clostridiales TaxID=186802 RepID=D4LX56_9FIRM  ali  28  10..RENLLSRINEVSFAVNDILLYLDTHPECKEGLAFYQECDKERQKLMKEYAQCYGPLTVDDAESGGDTWKWAEQPFPWEVE. 90
54 2.000e-27UniRef50_A0A0E1KWY2 CotJB family protein n=11 Tax=Clostridium botulinum TaxID=1491 RepID=A0A0E1KWY2_CLOBO  ali  47  6.SKKELLLMLQEYEFTAVELNLYLDNYPENKRALEYFNEISCRLMEIKEIYEERFGPLFNFGFSKSKFPWQWVEGAWPWEKEF 87
55 2.000e-27UniRef50_A0A1C5ZDY7 CotJB protein n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C5ZDY7_9CLOT  ali  25  4.SKEELLKEITQASFAVNDLTLYLDTHPNDMEALKMFDQCKQQRKDAMKQFTEKYEPLCIDDVEAGASSWAWNNAPVPWEGG. 84
56 3.000e-27UniRef50_H6CHR0 CotJB protein n=17 Tax=Paenibacillus TaxID=44249 RepID=H6CHR0_9BACL  ali  36  87....ALLEKLQAVDFVLVELNLYLNTHPDDLQAIEQFNKLTRERTAIANEYQLLYGPLQNFGRAYSKYPWEWSQTPWPWQV.. 163
57 3.000e-27UniRef50_A6BI25 Uncharacterized protein n=8 Tax=Firmicutes TaxID=1239 RepID=A6BI25_9FIRM  ali  25  27.CKKELLEWINIVSFAVDDVKLFLDTHPNCTEALEFFDEFKKQRVQALKEYAKYYGPLTLDTATTQMDYWKWINDPWPWQEG. 107
58 4.000e-27UniRef50_D9R6L4 Uncharacterized protein n=17 Tax=Clostridiales TaxID=186802 RepID=D9R6L4_CLOSW  ali  30  7.NCDMLLRQVYEASFAMDDVVLYLDTHPDDQEALNYYFYVVNMRLQAMQAYEEQCGPLMADG-VMDENYWTWIEDPWPWEG.. 85
59 4.000e-27UniRef50_A0A161WSR3 CotJB protein n=25 Tax=Clostridia TaxID=186801 RepID=A0A161WSR3_9CLOT  ali  35  5MNKKELLKEITAVDFSLIDLHLYLNTHPTDRNALKTYNSLVTKARMLKQNYERFFGPLS--YGDYSQYPWQWINEPWPWECE. 84
60 4.000e-27UniRef50_R7LNW4 Spore coat protein COTJB n=7 Tax=Clostridium TaxID=1485 RepID=R7LNW4_9CLOT  ali  32  14.EKEEMLQQIRCYDFAITELALYLDTHPTDDKALCLHRKYCREAKDLKDKYQKVYGPLTI---NFPCNKWRWLEEPWPWEGG. 91
61 4.000e-27UniRef50_UPI00036984E6 spore coat protein CotJB n=1 Tax=Desulfurispora thermophila TaxID=265470 RepID=UPI00036984E6  ali  32  6.EKMALLRKIMELDFAVLEATLFLDTHPMDAAALAYHQEYSKQLKELKITYSQQYGPLVSDSPDAATSEWRWLAQPWPWE... 84
62 4.000e-27UniRef50_A0A1B1YMQ7 Manganese catalase n=3 Tax=Clostridium stercorarium TaxID=1510 RepID=A0A1B1YMQ7_CLOSR  ali  31  3.ERQKLLEQIMAYDFCLVDLGLFLDTHPSDANALKDYRMCYEESQKLRKIYEEKYGPLSLRHL-PNPNCWQWVDSPWPWEKE. 82
63 4.000e-27UniRef50_R6F331 Spore coat peptide assembly protein cotJB n=3 Tax=Firmicutes TaxID=1239 RepID=R6F331_9FIRM  ali  34  1MNRAELMRKIQETGFALYDLTLFLDTHPQNQMALDYFTDVQKNHTELQAEYEMMYGPLTAFDTNT-EHGWTWIQDPWPWELE. 81
64 5.000e-27UniRef50_A0A0H4KJI0 Spore coat protein CotJB n=8 Tax=Bacillales TaxID=1385 RepID=A0A0H4KJI0_9BACI  ali  36  12......LEEIQAIDFVLVELTLYLDTHPNDQQAMQQFNEYAKYAKKLKRNFEAKFGPLQQYGNSYTDAKWSWGKMPWPWQI.. 86
65 5.000e-27UniRef50_W0U8U4 Spore coat protein JB n=12 Tax=Ruminococcaceae TaxID=541000 RepID=W0U8U4_9FIRM  ali  30  6.EKERLLRKIQACSFALVEANLYLDSHPTCRDGLAYFARHKAEKEKLIAQYNEKYGPLTITQNNSSK-KWEWVTSPFPWER.. 84
66 6.000e-27UniRef50_A0A0L8F284 Spore coat protein n=5 Tax=Clostridiales TaxID=186802 RepID=A0A0L8F284_9CLOT  ali  28  3MDKMELLKEIMAVDFTIIDLSLYLNTHPTDKDAIAKHNSFVAQSHMLKGKYERYFGMLTAT-NSCSPYPWQWIDEPWPWEYD. 83
67 6.000e-27UniRef50_R7JT60 Uncharacterized protein n=10 Tax=Clostridiales TaxID=186802 RepID=R7JT60_9FIRM  ali  32  7.SREKLLAWIDQVSFAVVEMNLYLDTHPEDEDALAFFREKVELRKEALKQYAEQYGPLTIDTANDRMSRFEWVMQPWPWEVN. 88
68 6.000e-27UniRef50_A0A0E3WH43 Uncharacterized protein n=79 Tax=Bacillales TaxID=1385 RepID=A0A0E3WH43_9BACL  ali  40  12....EMLEQLQTLDFALVELNLYLNTHPEDLRAIEQFNQLTQERTRLANQFQELYGPLQSFGRAYSKCPWEWNQTPWPWQV.. 88
69 6.000e-27UniRef50_B8I5Z7 Putative spore-coat protein n=8 Tax=Clostridiales TaxID=186802 RepID=B8I5Z7_CLOCE  ali  28  6.EREALLWKVQAYEFACIEVGLFLNTNPNDKTALAYFKQYRDMKHQLESEFTKRFGPLTAGHMDNDLSTWRWIENPWPWEIG. 86
70 7.000e-27UniRef50_A0A075KPX4 Spore coat assembly protein CotJB, domain containing protein n=15 Tax=Firmicutes TaxID=1239 RepID=A0A075KPX4_9FIRM  ali  43  1MSCEQMLKKIQEIQFVALELNLYLDTHPMDRDAINDFNCAAERLRKHVKAYEDEYGPLLNFGGGYSNEPWQWSQGPWPWE... 84
71 7.000e-27UniRef50_A0A0K2FFK1 CotJB protein n=15 Tax=Paenibacillus TaxID=44249 RepID=A0A0K2FFK1_9BACL  ali  35  1.....MLEKLQAVDFVLVELNLYLNTHPDDLQAIEQFNKLTQERTAIANEYQILYGPLQNFGRAYSKYPWEWNQTPWPWQV.. 76
72 7.000e-27UniRef50_UPI0008325011 spore coat protein CotJB n=1 Tax=Clostridium sp. AT4 TaxID=1720194 RepID=UPI0008325011  ali  27  9.SRGAMLQAVNQTSFAVVEANLYLDTHPCDMEALSYLNQMMEAYKNAKAAYEAQFGPL-NAGNVTENAYWTWVSDPWPWEGG. 88
73 7.000e-27UniRef50_A0A1H1Z0N5 Spore coat protein JB n=11 Tax=Paenibacillaceae TaxID=186822 RepID=A0A1H1Z0N5_9BACL  ali  40  52......LKELQILDFALVELNLYLNTHPGDLQAIQQFNQLAQKRKGVAQQFEMQYGPLVNFGNSYSRYPWQWNETPWPWQV.. 126
74 7.000e-27UniRef50_A0A1M7Y778 Spore coat protein JB n=1 Tax=Anaerocolumna xylanovorans DSM 12503 TaxID=1121345 RepID=A0A1M7Y778_9FIRM  ali  28  5.SRDQLMCIINEASLAVHDTVLFLDTHPCDKEAMEYYQMYRQIRNEAMEEYRDCYGPLSAYDVAPS-NMWTWINDPWPWEGE. 84
75 7.000e-27UniRef50_A0A2V2CZ66 Spore coat protein CotJB n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2CZ66_9FIRM  ali  29  1MDKEKLKYEIMALDFALADLKLYLDTHPDCTESIKLFNSIVDKRKVMFDTYQSLYGPLVAETYSGSESTWDWIDDPWPW.... 79
76 8.000e-27UniRef50_F7JQA1 Uncharacterized protein n=43 Tax=Firmicutes TaxID=1239 RepID=F7JQA1_9FIRM  ali  28  6.CRKELLNQINEASFAVDDVKLYLNTHPWDDEALVYFQEYSRIRNEALKEYAKHYGPLTIDTASSCEEQWDWIDAPWPWQEG. 87
77 9.000e-27UniRef50_A0A084JP21 Spore coat peptide assembly protein cotJB n=5 Tax=Clostridiales TaxID=186802 RepID=A0A084JP21_9FIRM  ali  29  7.DCDMLLKQVYETSFAMDDVVLYLDTHPDDQDALEYFFYVMGMRQQAVMAYEAQCGPLMVEG-VMDENYWTWINDPWPWEG.. 85
78 9.000e-27UniRef50_UPI00082A121D spore coat protein CotJB n=1 Tax=Clostridium sp. Marseille-P299 TaxID=1805477 RepID=UPI00082A121D  ali  32  4.NREKLIHCITEVSFYLDDLRLFLDTHPCDREALAVYAEFQKRREALLKEYEEVYGPLRWYGYNNSCDIWNWTQYPWPWEG.. 83
79 1.000e-26UniRef50_A0A2I0QX01 Spore coat protein CotJB n=2 Tax=Bacillales TaxID=1385 RepID=A0A2I0QX01_9BACI  ali  36  31....EMMEKIQAIDFTLVELTLYLDTHPEDSYALEQFNSFAELSHQHKRQFEEKFGPLMQFGRSFVWNEWSWNSPPWPWQV.. 107
80 1.000e-26UniRef50_A0A1C0ZU84 CotJB protein n=15 Tax=Bacteria TaxID=2 RepID=A0A1C0ZU84_9BACL  ali  34  14......LRDLQAVDFVLVELTLYLDTHPDDLSVIQQYNQFAQKRMNMVGQFELEFGPLMAYGHSFTKHPWQWVKTPWPWQV.. 88
81 1.000e-26UniRef50_R7B1K4 Uncharacterized protein n=1 Tax=Bacteroides pectinophilus CAG:437 TaxID=1263051 RepID=R7B1K4_9BACE  ali  33  72.DHQTLMNEIYQLGFAIVETVLYLDTHPSDADALNYYNQIKRRYSHVMEMYSREYGPLLNT-NVMNDNYWSWVATPMPWEVE. 151
82 1.000e-26UniRef50_A0A173RKL6 CotJB protein n=5 Tax=Clostridiales TaxID=186802 RepID=A0A173RKL6_EUBRA  ali  25  8.EKQRLMNAIYQCGFAISDITLFLDTHPKDPDALDYFQHMKHKYNHFVAEYETKFGPLTQTGE-QRQNYWQWTVSPWPWERGY 88
83 1.000e-26UniRef50_Q45537 Protein CotJB n=163 Tax=Terrabacteria group TaxID=1783272 RepID=COTJB_BACSU  ali  34  13......LEQIQAADFVLVELSLYLNTHPHDEDALKQFNQYSGYSRHLKRQFESSYGPLLQFGNSPAGKDWDWGKGPWPWQV.. 87
84 2.000e-26UniRef50_R5IY39 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:822 TaxID=1263032 RepID=R5IY39_9FIRM  ali  30  96.EQAELLTKVDAYAFAAHDINLYLDTHPNDRSMIDLFNQLSADAKAARREYESKYGPLLV--NSNEGYPWTWNNMPWPWENN. 174
85 2.000e-26UniRef50_B9DZH6 Uncharacterized protein n=7 Tax=Clostridiales TaxID=186802 RepID=B9DZH6_CLOK1  ali  39  10.NRENLLNKIRQLEFATLDLSIFLDNFPDNKKALSDFNTFSKQLMKLIREYELNFGALFNFGFSQSQYPWTWVNEPWPWE... 88
86 2.000e-26UniRef50_G7W0M1 Uncharacterized protein n=4 Tax=Paenibacillaceae TaxID=186822 RepID=G7W0M1_PAETH  ali  36  54....ALLEKLQTVDFVLVELNLYLNTHPDDLQAIEQFNKLTQERTAIANEYQFLYGPLQNFGRAYSKYPWEWSQSPWPWQV.. 130
87 2.000e-26UniRef50_D5HHU0 Uncharacterized protein n=19 Tax=Firmicutes TaxID=1239 RepID=D5HHU0_9FIRM  ali  32  4MNKKQLLRFIAEVSFALDDIALYLDLHPDCTKALSSYDNYQSMRTQAINDYVNMYGPLNKY-QVTDNNYFNWVNDPWPWEGE. 84
88 2.000e-26UniRef50_B9Y8Q2 Uncharacterized protein n=6 Tax=Firmicutes TaxID=1239 RepID=B9Y8Q2_9FIRM  ali  28  1MNKNELLRELQELDFAIQEAVLFLDTHPRSEVALSYYRYVTGLRRKAAEEYNRVCGPLTSRD--SRGRRWDWVNSPWPWERE. 80
89 2.000e-26UniRef50_R5ZK10 Uncharacterized protein n=3 Tax=environmental samples TaxID=2231195 RepID=R5ZK10_9FIRM  ali  27  6.NRLKLMKIINQASFAMDDVKLFLDTHPSCSEAIEYYKKVKKIRMDAVDEYTREFGPITAYDVD-VKDYWNWNDSPLPWEGG. 85
90 2.000e-26UniRef50_UPI000B36183D spore coat protein CotJB n=2 Tax=Clostridiales TaxID=186802 RepID=UPI000B36183D  ali  31  3.EREQLLNRVRMYDFALVDVSLYLDGHPHNASALAYYQKNRKLLNEAKAAYEARFGPLSRK-NSTDETEWTWINDPWPWEG.. 81
91 2.000e-26UniRef50_R7L4Q2 Uncharacterized protein n=8 Tax=Clostridium TaxID=1485 RepID=R7L4Q2_9CLOT  ali  35  59..RCEMLKNIRCLSFAIVDISEYLNTHPDDQKALCLHKEYCRQLRDLKDKYQRIYGPLSIY---YPCNKWRWLEEPWPWEGD. 135
92 2.000e-26UniRef50_C6LJH9 Uncharacterized protein n=2 Tax=Marvinbryantia TaxID=248744 RepID=C6LJH9_9FIRM  ali  27  91MNQTQLLDCINEVSFAVSDILLYLDTHPDDCAALSYSREMIAARREAMAVYARRFAPLTIDSNDADSCRWEWVMQPWPWE... 171
93 2.000e-26UniRef50_A0A1M4M8R4 Putative spore-coat protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1M4M8R4_9FIRM  ali  32  4.NQAELLEQLMEVGFVLVETNLYLDTHPDDERALRLHNTFSQKYKELECIYEAQYGPLKF--TSMSVLPWQYVDEPWPWDVDF 83
94 3.000e-26UniRef50_R9LWA9 Uncharacterized protein n=1 Tax=Anaerotruncus sp. G3(2012) TaxID=1235835 RepID=R9LWA9_9FIRM  ali  26  3.ERHRLLNQIRMCDFALTEVGLYLDSHPFCQKGLAYYQKHRQMRDEAAAAYQAQFGPLNIRSN-NDPDRWTWVDSPWPWEME. 82
95 3.000e-26UniRef50_D4CA18 Uncharacterized protein n=5 Tax=Clostridiales TaxID=186802 RepID=D4CA18_9CLOT  ali  27  13.....LLREIDKISFAVNEFTLFLDTHPDCQEALLAFNSAAKTRKELMKQYADAYGPLTVDCISAEGDHWSWQDGPAPWEGG. 91
96 3.000e-26UniRef50_A0A1C5X562 CotJB protein n=1 Tax=uncultured Roseburia sp. TaxID=512314 RepID=A0A1C5X562_9FIRM  ali  28  4.ERKKLFDYINQVSFSINDLTLYLDTHPDDAEALEYMKELIPCRKKALKEYQEKYMPLLVDGTSEHADIWKWSTTAWPWERGY 85
97 3.000e-26UniRef50_R5LKJ8 Uncharacterized protein n=1 Tax=Mycoplasma sp. CAG:877 TaxID=1262907 RepID=R5LKJ8_9MOLU  ali  31  62.EKEKMLLEIGRISFAAHDLNLYLDLYPNDESMLTLFNDYRKSANELISQYEVKFGPLNIVSNSLENGPFKWINGPWPWE... 140
98 3.000e-26UniRef50_UPI0009888CE2 spore coat protein CotJB n=3 Tax=Clostridiales TaxID=186802 RepID=UPI0009888CE2  ali  31  6INCDVLLQQVYVYSFAMDDVALFLDTHPDNREALDYFFYVSDLREQAMEAYEEQCGPLMVEG-VMDENYWTWINDPWPWEG.. 85
99 4.000e-26UniRef50_UPI0008734B0D spore coat protein CotJB n=1 Tax=Bacillus marinisedimentorum TaxID=1821260 RepID=UPI0008734B0D  ali  33  13......LKKLQAIDFAMMELTLYLDTHPDDAEAIKQYNELADKRKDAKVAVEEEYGPLSISQKNSKETIWQWSTGPWPWQV.. 87
100 4.000e-26UniRef50_Q73D18 CotJB protein n=255 Tax=Bacteria TaxID=2 RepID=Q73D18_BACC1  ali  41  24.............DFVLVELTLYLDTHPDDTAAINQFNEFSYKRRVLKQKMEEKYGPLQQFGNSYSNAPWEWSKGPWPWQI.. 91
101 4.000e-26UniRef50_C5ENG3 Putative cotJB protein n=18 Tax=Clostridiales TaxID=186802 RepID=C5ENG3_9FIRM  ali  25  10..REMMLKQVNETGFAVVDSNLYLDTHPCDAMAINYQNQMAEAYRCSLAEYEAQFGPLRASD-SRDAQYWCWVNGPWPWEGG. 88
102 4.000e-26UniRef50_A0A2I5JWL5 Uncharacterized protein n=16 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2I5JWL5_9BACI  ali  42  88....RLLEQIQAADFVLVELTLYLDTHPHDRLALQQFHEYSRYSRQLRKRFEPEYGPLLQFGVSQVGAQWDWGRGPWPWQV.. 164
103 4.000e-26UniRef50_A0A0A0WSF5 CotJB family protein n=112 Tax=Bacillales TaxID=1385 RepID=A0A0A0WSF5_BACMY  ali  37  11....KWIEELQELDFVLVELTLYLDTHPDDTAAINQFNDFSYKRRVLQQKIEEKYGPLQQFGNSYSNAPWQWSQGPWPWQI.. 87
104 4.000e-26UniRef50_A0A285CNE4 Spore coat protein JB n=10 Tax=Bacillales TaxID=1385 RepID=A0A285CNE4_9BACI  ali  33  12....DLLEQIQAADFVLVELTLYLDTHPDDVTAMQQFNQYVQYSKQLKQMYEERYGTLQQFGNSYTDANWSWGRAPWPWQV.. 88
105 5.000e-26UniRef50_A5Z7P3 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A5Z7P3_9FIRM  ali  28  5MSKEKLMDIITKASFAMDDVKLFLDTHPNCMEALEYYRKAKEMREEAWEMYTNNFGPLSAYDVA-NKDYWDWNKGPMPWEGG. 85
106 6.000e-26UniRef50_R6VK71 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=R6VK71_9FIRM  ali  29  6.EQTALFQYINEVSFAINDMNLYLDTHPEDKKALAFMEEHVKMRKRALKEYAMKYGPLTIDTTDDGQCSWDWVMQPWPWE... 85
107 6.000e-26UniRef50_A0A2G3PX90 Spore coat protein CotJB n=1 Tax=Lachnospiraceae bacterium TaxID=1898203 RepID=A0A2G3PX90_9FIRM  ali  26  6.QQSELLDLISSINFALFDTVLFLDTHPTDQNALAFYNQYLKLSKQAVNEYVRYFGPLTSDD-VQESNEWTWVNSPWPWEME. 85
108 6.000e-26UniRef50_B7AR76 Uncharacterized protein n=2 Tax=unclassified Clostridiales TaxID=186813 RepID=B7AR76_9FIRM  ali  33  128.DHQTLMNEIYQLGFAIVETVLYLDTHPSDADALNYYNQIKRRYSHVMEMYSREYGPLLNT-NVMNDNYWSWVATPMPWEVE. 207
109 6.000e-26UniRef50_D7GUG0 Uncharacterized protein n=5 Tax=Clostridiales TaxID=186802 RepID=D7GUG0_9FIRM  ali  26  45.DKELLMRQIMEAGFAMDDVALFLDTHPENQDALRYYKAVRDMRDQSMAAYERRFGPLRYTDVTSMS--WNWVTEKWPWEGG. 123
110 7.000e-26UniRef50_N1ZBF2 Uncharacterized protein n=10 Tax=Firmicutes TaxID=1239 RepID=N1ZBF2_9CLOT  ali  32  1MNREELLNSLTQLDFMAVDLGLYLNTHPEDTEAIEAYNQVIVAADTVRAKYEDAFGPLCSFSYASDVQNWQWKNNPWPWQSQF 84
111 7.000e-26UniRef50_U2FI52 Spore coat peptide assembly protein cotJB n=10 Tax=Bacteria TaxID=2 RepID=U2FI52_9BACT  ali  44  14.SKEDLMKRITELSFYAVDLNLFLDNHPDSQQALQDYRIISQNLRQLEDIYAKNYGPLYNFGASGQFNNWTWIEEPWPWENK. 94
112 7.000e-26UniRef50_UPI0009E22B2E spore coat protein CotJB n=1 Tax=Halobacillus massiliensis TaxID=1926286 RepID=UPI0009E22B2E  ali  35  1.....MLQDIQEIEFVLLELQLYLDTHPEDIEALNLFNAFSGELQKLKLLYDLIYGPLLGFGFSQSKDEWKWVNDPWPWQLE. 77
113 7.000e-26UniRef50_UPI000A02A63C spore coat protein CotJB n=1 Tax=Ruminococcus callidus TaxID=40519 RepID=UPI000A02A63C  ali  31  38.EKQKLLSMIRKYDFVLYELQLYLDTHPRCPEALRMWKNYQAMRQKAATAYVRQYGPLQPLQTS-GDSPWAWNQGPWPWEKE. 117
114 9.000e-26UniRef50_T4VKK4 CotJB family protein n=7 Tax=Clostridiales TaxID=186802 RepID=T4VKK4_PARBF  ali  39  5..RRELLDAILEYNFACIELNLYLDNNSYDEDALELYNKYSEKFEEAREAYESKYGVLTNFGYESSPCYWKWVDEPWPWDNEF 85
115 9.000e-26UniRef50_G7M5C0 Spore coat peptide assembly protein CotJB n=5 Tax=Clostridium TaxID=1485 RepID=G7M5C0_9CLOT  ali  55  1MSPRDMLNSIMIYQFCAVELNLFLDNFPEDKNAREDYSKVSCKLTSLINEYEKNCGPLTNFGSAFVENPKAWVDQPWPWEN.. 81
116 1.000e-25UniRef50_E6U560 Spore coat protein CotJB n=1 Tax=Ethanoligenens harbinense (strain DSM 18485 / JCM 12961 / CGMCC 1.5033 / YUAN-3) TaxID=663278 RepID=  ali  33  3.EQATLLRNIAAIGFSMQELRLFLDTHPADATGIALFNKYQQKLSVLTAEYTRAYGPIDSN-TANAGNTWQWVKDPWPWE... 80
117 1.000e-25UniRef50_C0EGE0 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=C0EGE0_9FIRM  ali  22  3.DREKMMKRLAIANFAIDDVKLFLDTHPMDRAALDYYHKYRKLRDQVLEEYTSRFGPITA-DMVESTDQWTWVENPWPWDN.. 81
118 1.000e-25UniRef50_A0A1H6I1Z6 Spore coat protein JB n=9 Tax=Ruminococcus TaxID=1263 RepID=A0A1H6I1Z6_RUMFL  ali  31  3.ERRILLNKIKKYDFTLKELNLYLDTHPNCQRALAMFSKYKELRQNAIDEYNRRFGPLTPEQNNDMQ-HWSWIDDPWPWERR. 82
119 1.000e-25UniRef50_A0A1Y4R6L7 Spore coat protein CotJB n=2 Tax=Lachnoclostridium sp. An14 TaxID=1965562 RepID=A0A1Y4R6L7_9FIRM  ali  23  13.DAAQILQALDQASFALDDVILFLDTHPNDTEALAYYQYVRSLRAQAMNAYTDQYGPLMKDQENSTTD-WTWVNGPWPWEGG. 92
120 1.000e-25UniRef50_UPI000C14AB6A spore coat protein CotJB n=1 Tax=Lachnospiraceae bacterium Marseille-P3773 TaxID=2002841 RepID=UPI000C14AB6A  ali  27  5.DRRSLMHKISMVSFGIVEATLYLDTHPMDETALKYINELIPVRQSLLEKHSQCFGPLTIDSVLPSQ-KWEWACNPMPWEGGY 85
121 1.000e-25UniRef50_A0A1D7XB22 CotJB protein n=34 Tax=Firmicutes TaxID=1239 RepID=A0A1D7XB22_MOOTH  ali  39  4.KRLNLLKKVMALEFTCVDFNLYLDTHPEDYRALAEYNAASEALAAAKKEYEALYGPLTNYGHSPSPQAWRWIEEPWPWETTF 85
122 1.000e-25UniRef50_A0A2V2F8T1 Spore coat protein CotJB n=1 Tax=Ruminococcaceae bacterium TaxID=1898205 RepID=A0A2V2F8T1_9FIRM  ali  30  31..RAMLLRHVQMHGFAMIEAGLYLDGHPDCRRALEYFRRQRELYMKYTAEYEAAYGPLTIASQ-TDCDAWKWVQGPWPWESE. 109
123 1.000e-25UniRef50_K0B2M6 Spore coat composition protein, manganese catalase family n=12 Tax=Firmicutes TaxID=1239 RepID=K0B2M6_CLOA9  ali  32  6.ERKALLMQIMEIDFSLLETSLYLATHPDDEHALRLHNTLAKKSKELIKVYECNFGPLTNKGMS--KFPWQYINSPWPWDEKF 85
124 1.000e-25UniRef50_G2T2U8 Spore coat protein CotJB n=18 Tax=Clostridiales TaxID=186802 RepID=G2T2U8_ROSHA  ali  24  7MNQAQLLHWINMVSFAVVDIAEYLDTHPVDAEAICYFNHHIEMHRNAMQVYADKFGPLTI-DTANPDAYWDWAKQPLPWEGG. 87
125 1.000e-25UniRef50_A0A2U1BFX1 Spore coat protein JB n=4 Tax=Clostridiales TaxID=186802 RepID=A0A2U1BFX1_9FIRM  ali  28  3.DKAKLLGRVRMYDFALVEVIEYLDGHPDNAAALKYYNEMRTAFDKAAAEYEDAFGPLTAREVDTRSGHWTWIDDPWPWEG.. 82
126 2.000e-25UniRef50_R7C932 Uncharacterized protein n=2 Tax=Clostridium TaxID=1485 RepID=R7C932_9CLOT  ali  22  7.SKHQKMTAVREAGFCMIDAGMYLDTHPCDGKAMDYFNRYQQMYKEAVCDYEKHCGPLFLTGIDTN-DGWTWTDEPWPWEGG. 86
127 2.000e-25UniRef50_R5E9M2 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:590 TaxID=1262825 RepID=R5E9M2_9CLOT  ali  30  4MCKEDLFKFIQNTNFALIEMALYLDTHPECPCGLETYHDYHHSIKRAIDIYEKKYGPLTIYG-VNCKDNWDWVDEPWPWQKG. 84
128 2.000e-25UniRef50_A3DCH4 Spore coat protein CotJB n=4 Tax=Ruminiclostridium TaxID=1508657 RepID=A3DCH4_CLOTH  ali  30  4.NQAQLLKEVMAADFTLIDLNLYLNTHPYDQNAIMLFYNCAQRAKILRNEYERLYGPLTAQSTPY-KCPWQWINSPWPWE... 81
129 2.000e-25UniRef50_R9JVC8 Uncharacterized protein n=9 Tax=Firmicutes TaxID=1239 RepID=R9JVC8_9FIRM  ali  30  12.ERQKLLQEISKVDFVLKELNLYLDTHPYDQQAMERFGQFNTLKNKMVKDYTEKYGPLVLSITDMDSREWKWATQDWPWEGGY 93
130 2.000e-25UniRef50_A0A2N2AWJ8 Spore coat protein CotJB n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A2N2AWJ8_9FIRM  ali  28  4.EQLAILKELMEVGFCTIEMALFLDTHPSDERGVGLHNSYAARYKELSETYNMKYGPLT--SNDLSKCPWEFINGPWPWEIEY 83
131 3.000e-25UniRef50_R5VQ73 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:631 TaxID=1262996 RepID=R5VQ73_9FIRM  ali  30  49.EREALLLFIQKSGFAAHDLGLYLDTHPNAKAALDLRNFYLKQYNNAMNRYQKQFGALGMNDENLNETPFQWVQSPWPWE... 127
132 3.000e-25UniRef50_F8IG38 Uncharacterized protein n=21 Tax=Bacillales TaxID=1385 RepID=F8IG38_ALIAT  ali  33  16......LQELQAIDFVLVDLTLYLDTHPDDEQALAQFKQFQKRKHNLMTQFESAFGPLHQYGLSPTGASWAWSETPWPWQV.. 91
133 3.000e-25UniRef50_U2F0W0 Uncharacterized protein n=2 Tax=Clostridium TaxID=1485 RepID=U2F0W0_CLOS4  ali  26  4.EKEKLMKVIRESDFAIQECALYLDTHPRDSAALRLYGDQQALRKKAVDAYEQAFGPLTTAGNQFSS--WRWIDDPWPWDLE. 82
134 3.000e-25UniRef50_R6E2J1 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=R6E2J1_9FIRM  ali  27  1MDRQELFNKVEAVGFALYDTALFLDSHPTNRMALDFFRDNQAMYMQYRDEYEKNYGPLTFYGVDTSK-GWTWTQGPWPWEVE. 81
135 3.000e-25UniRef50_A0A174L6D0 CotJB protein n=3 Tax=Ruminococcaceae TaxID=541000 RepID=A0A174L6D0_9FIRM  ali  28  3.ERQKLLRQIQIHNFAITDVVLYLDGHPTCQPALAYYEKHKQLRDEAVALYNQRFGPL-NMRENTNPNRWTWVDDPWPWELE. 82
136 3.000e-25UniRef50_A0A1Q9J521 Spore coat protein CotJB n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1Q9J521_9FIRM  ali  25  9.NQGQLLHYINVVSFAALDAALYLDTHPKDEAALSYFNQYEDLRRTALKTYAEHFGPLTL-DTTNPDCNWSWGEQPLPWEGG. 88
137 3.000e-25UniRef50_R6BCY5 Uncharacterized protein n=4 Tax=Clostridiales TaxID=186802 RepID=R6BCY5_9CLOT  ali  27  7..RRTLLDRVQMYEFAVIEANLYLDTHPQDQDALKYHDKYANLLEQAKAEYEKQFGALNPM-KANNGARWSWVDDPWPWDLN. 85
138 3.000e-25UniRef50_R6QRK3 Uncharacterized protein n=4 Tax=Anaerostipes TaxID=207244 RepID=R6QRK3_9FIRM  ali  20  5.DQEKLLRYIDAVSFALIDTTLYLDTHPDDQEAISHFNQYQCARNKAVKEYSQYFEPLTIDS-AEITDTFTWATTKWPWQKE. 84
139 4.000e-25UniRef50_UPI000831112B spore coat protein CotJB n=2 Tax=Clostridium TaxID=1485 RepID=UPI000831112B  ali  55  1MNRHEYLEKIQKLQFFIIDLNLYLDNFPNCEKAKTDYDNISCELKKTIWDYEKEYGPLTNFGAAYFQNPEKWVNSPWPWE... 80
140 4.000e-25UniRef50_A0A2V2BZ54 Spore coat protein CotJB n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2BZ54_9FIRM  ali  37  8MNKDELLKSLMSLDFMAVDLGLFLNTHPENEEAVAEYDRIIRAADEVRSQYESQFGPLCSF-RSYAGGQWKWIDNPWPW.... 85
141 4.000e-25UniRef50_A0A1V6BL66 CotJB protein n=1 Tax=Tenericutes bacterium ADurb.Bin140 TaxID=1852919 RepID=A0A1V6BL66_9BACT  ali  35  63.EKDQLLLPVQALDFMRVELNLYLDTHPDDVNAINLFAQNQIALNEAKRRYEERFGPLVVFNATSTATPWSWTQG-WPWEGG. 142
142 4.000e-25UniRef50_UPI0009E7F209 spore coat protein CotJB n=2 Tax=Ruminococcaceae TaxID=541000 RepID=UPI0009E7F209  ali  31  4.NREMLLKRVQICDFILVETNEYLDTHPNDQAALDYFKKYNEMRRTAAKEFTEKYGPL-NMWDFEGGNRWNWVDDPWPWEKQ. 83
143 5.000e-25UniRef50_R6CTR9 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:594 TaxID=1262826 RepID=R6CTR9_9CLOT  ali  37  85.EKQMMLYDIQKVSFAAHDLNLYLDTHPFDTNYINLYNEYNKEAKRLTNLYEQKYGPIDLSDDVGSMTPWSWINEPWPW.... 163
144 5.000e-25UniRef50_UPI0009DDB163 spore coat protein CotJB n=1 Tax=bacterium MS4 TaxID=1120746 RepID=UPI0009DDB163  ali  30  3.EQEALMTRIRSYQFAMWELHIFLDTHPGDCKAAQKLEEYRKATNEMTAKYEAAYGPVNV--NSQNTSRWAWIADPWPWDG.. 80
145 5.000e-25UniRef50_A0A0M6WN65 CotJB protein n=3 Tax=Roseburia TaxID=841 RepID=A0A0M6WN65_9FIRM  ali  28  9MNRSELYRWVMALGFCAYDMLLYLDTHPDDAQALSYYNQCNELYNSAKKTYEERFEPLSAFGSQPLED-WDWNDGPMPWEG.. 88
146 5.000e-25UniRef50_A0A1I3T9Y9 Spore coat protein JB n=1 Tax=Brevibacillus sp. OK042 TaxID=1884381 RepID=A0A1I3T9Y9_9BACL  ali  37  1MEYGSTLRKLQEIQFALVELQLYLDMNPDDQRAVKQYKELTVQLVQQKQAYEKERGPVMQYGHSSTPDRWTWHKTPWPWEIEY 83
147 5.000e-25UniRef50_A0A133NBB7 Spore coat protein CotJB n=49 Tax=Clostridium TaxID=1485 RepID=A0A133NBB7_CLOPF  ali  100  1MKALELLDDIQKLQFYAVELNLYLDNFPENRKATEDYKEISSKLSELIERFECEYGPIRNFGQAYVENPVAWIEQPWPWEIRY 83
148 5.000e-25UniRef50_A0A0B0I2E6 CotJB protein n=2 Tax=Paenibacillus sp. P1XP2 TaxID=1472719 RepID=A0A0B0I2E6_9BACL  ali  42  79....ELLEQLQVIDFALVELNLYLDTHPDDLKRIEQYNRLAQERIPLVRKFQELYGPLMHFGHAYSKFPFEWPEAPW...... 151
149 6.000e-25UniRef50_R7NBZ2 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=R7NBZ2_9FIRM  ali  31  64.DKRGLMQNIYELGFVLTEVNLYLDTHPDDLEAIEYYAQIKDKYCDYMTQYADYYGPLDKLHIS-NDNYWMWVATPMPWEME. 143
150 6.000e-25UniRef50_UPI0009F611A6 spore coat protein CotJB n=1 Tax=Traorella massiliensis TaxID=1903263 RepID=UPI0009F611A6  ali  36  190..KRKLKCRIQVLDFALLETILFLDTHPCDFEALRYYRIIRKKLARLEKLYECKFGPLTNQGVDT-EFGWEWATCPWPWEGK. 268
151 6.000e-25UniRef50_R6CMZ0 Uncharacterized protein n=4 Tax=Ruminococcus TaxID=1263 RepID=R6CMZ0_9FIRM  ali  30  8.EKQKLLRKVQAARFALIEANLYLDSHPTCREGLKYFREKRAEADKLMKEYETEYGPLTA-AASHAEDCWEWVNTGFPWERG. 87
152 6.000e-25UniRef50_R6K8D9 Uncharacterized protein n=1 Tax=Eubacterium sp. CAG:248 TaxID=1262885 RepID=R6K8D9_9FIRM  ali  31  42.DKHALMKNIYELGFILTETNLYLDTHPNDMEAIEYYAQIRDKYCNYMTKYADYYGPLDKLHIS-NDNYWMWVSTPMPWEME. 121
153 6.000e-25UniRef50_R6QKK2 Uncharacterized protein n=1 Tax=Butyrivibrio sp. CAG:318 TaxID=1262761 RepID=R6QKK2_9FIRM  ali  28  11.SKCTLMRRIMELGFYIDDIGLYLDTHPDDCRSLARYHEIHHEYDTAVQNYAEWYGPLNKY-HVTCNSRFDWIDGPWPWEGG. 90
154 6.000e-25UniRef50_T0NG38 Uncharacterized protein n=2 Tax=Clostridium TaxID=1485 RepID=T0NG38_9CLOT  ali  39  4.SKSDLMLLLQQYGFYAVELNLYLDNFPDNKKALRDFQKVAEIYHNLKSEYETKYGLLSNFGHSQPCGDWNYVNDPWPWEGK. 84
155 7.000e-25UniRef50_UPI00085C19D9 spore coat protein CotJB n=1 Tax=Massilioclostridium coli TaxID=1870991 RepID=UPI00085C19D9  ali  30  6.EREQLMKKLQEAAFAVYDVQLYLDTHPTDQAALRYFDQQRQAKQKAMEEYAAKYGPVRV-EQSSGERKWNWIEDPWPWEME. 85
156 8.000e-25UniRef50_A0A1M6HPX8 Spore coat protein JB n=1 Tax=[Clostridium] caenicola TaxID=659425 RepID=A0A1M6HPX8_9FIRM  ali  33  4..KNELLEQIRATDFALIELNLFLDTHPSDENALKDFRMLAETREKLYRQFTQKYGPLKAVDGATSDC-WLWINDPWPWD... 80
157 8.000e-25UniRef50_R6SK13 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=R6SK13_9CLOT  ali  30  12.DCRKLMKRIHELDFAINEVVLYLDMYPACAKALAYYHQLHEARQETVALYEEACGPLTPFGNNNRT-RWQWTDSPMPWEPE. 91
158 9.000e-25UniRef50_R5HLD1 Uncharacterized protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=R5HLD1_9MOLU  ali  31  68.EQAKMLTNIDALGFAMTDLNLYLDINPNDQNAINLFNQYRVQKEDLLKTYQNNYGPLLLNSDILATTPWAWDNQPWPWEN.. 147
159 9.000e-25UniRef50_R6Y4Z1 Uncharacterized protein n=2 Tax=Clostridium TaxID=1485 RepID=R6Y4Z1_9CLOT  ali  34  41.ERDELMQKIQMYAFAAHELNLYLDIYPNDAQAIGLYNQYSEISNKYLKEYEKKFG--NIILNSNESSPWPWINSPWPWERQ. 119
160 1.000e-24UniRef50_UPI000A04C574 spore coat protein CotJB n=1 Tax=Thermicanus aegyptius TaxID=94009 RepID=UPI000A04C574  ali  30  67.....LLHELQAIDFVLMDLTLYLDTHPADGTAISQYNALTLQRKKLKEDVEARFGPLSGAGHSFSGYPWSYSQTPWPWQV.. 142
161 1.000e-24UniRef50_E2SP19 Uncharacterized protein n=14 Tax=Firmicutes TaxID=1239 RepID=E2SP19_9FIRM  ali  30  3MNRERLLRRLQILDFAIQETALFLNSHPKDKDAMQYYQNALRERKSIAGDFERCYGPLTNRDNQSES--WEYIKGPWPWERE. 82
162 1.000e-24UniRef50_R5DW86 Protein CotJB n=8 Tax=Clostridiales TaxID=186802 RepID=R5DW86_9FIRM  ali  31  6.EREILLKKISTYEFAALDLQIYLDTHPHDTAMIQKMNGFKEKLKPLVEEYEEKFGPLKKSMTS--TNMWSWIKGPWPWENE. 84
163 1.000e-24UniRef50_A0A140LA55 Uncharacterized protein n=7 Tax=Firmicutes TaxID=1239 RepID=A0A140LA55_9THEO  ali  45  9....ELLKEIQALEFGVYELALFLDTHPGDRRALEDHNRLVSRLNQLRKAFEDRYGPLRLDSESP--YPYRYINDPWPWEIQY 85
164 1.000e-24UniRef50_F8FFU3 CotJB2 n=20 Tax=Terrabacteria group TaxID=1783272 RepID=F8FFU3_PAEMK  ali  44  16......LEELQALDFVLTELQLYLDTHPADEKALRQYKELSAQRLELVEPFERKYGPLIHNGRSQAEEPAEWNTTPWPWQV.. 90
165 2.000e-24UniRef50_A0A1G4WLA7 Spore coat protein JB n=2 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1G4WLA7_9FIRM  ali  36  3.KRETLLKKISTYQFAVLDLQMYLDTHQNDAETLEKVEKYQSLLRPLVEEYEMKYGPLTKS--ANDGNSWAWIKGPWPWESE. 81
166 2.000e-24UniRef50_R6GG44 Uncharacterized protein n=2 Tax=environmental samples TaxID=2231195 RepID=R6GG44_9CLOT  ali  37  3.NREELLNRIASYDFAIVELHLFLDTHPNNSSAAAKLDEYIAKSNKLRKEFEDKYGPL--NTMNENADRWAWVANPWPWDI.. 80
167 2.000e-24UniRef50_M1Z4C5 Protein CotJB (Modular protein) n=1 Tax=[Clostridium] ultunense Esp TaxID=1288971 RepID=M1Z4C5_9FIRM  ali  28  148.....LLHELQAIDFVLMDLTLYLDTHPADGAAISQYNALTLQRKKIKEDVEARFGPLSGAGHSFSGYPWSYSQTPWPWQV.. 223
168 2.000e-24UniRef50_A0A267MJZ3 Spore coat protein CotJB n=1 Tax=Anaeromicrobium sediminis TaxID=1478221 RepID=A0A267MJZ3_9CLOT  ali  25  1MDKRQMLKKLMEISFVLLEISLYLDTHPDDKKALQIHNNIRMQHKYLRDKYTTMYGPLSISDE--NKDTWQYIQTPWPWDYDF 83
169 3.000e-24UniRef50_A0A2V2G400 Spore coat protein CotJB n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2G400_9FIRM  ali  24  7.SRERLMRNVQEESFAVDEARLYLDTHPNDKKAQMFFDRHNQARKKAMDMYEQQYGALLTDNLQAEKDGWTWINQPFPWDRG. 87
170 3.000e-24UniRef50_A0A1C0AD54 CotJB protein n=7 Tax=Halobacteroidaceae TaxID=53434 RepID=A0A1C0AD54_9FIRM  ali  40  4.EQLEMLKELMALDFYLVELSLFLNTHPDNRQALEDHNRIARQYEELRRDYVRRYGPLCIGCVS--EYPWQYIETEWPWQIEY 83
171 3.000e-24UniRef50_S0DFI8 Putative spore coat protein cotJB n=1 Tax=termite gut metagenome TaxID=433724 RepID=S0DFI8_9ZZZZ  ali  23  4.ERAMLLRRVQICDFALNDAALFLDVNPDDQMALGFYKKYNDMRKQAADEYISKYGPLAHADYD-GGERWKWVDSPWPWQNE. 83
172 3.000e-24UniRef50_A0A1I5U5H5 Spore coat protein JB n=2 Tax=Lachnospiraceae bacterium XBB1006 TaxID=1520827 RepID=A0A1I5U5H5_9FIRM  ali  30  8MEQSKLLNWISMVGFAAMDMAEYLDTHPMDLDAMEYYNHLNKMKNQAERDYAANYGPLTL-GTFTPENKWCWSVTPWPWEGG. 88
173 3.000e-24UniRef50_A0A1C7I5M4 Spore coat protein CotJB n=4 Tax=Blautia TaxID=572511 RepID=A0A1C7I5M4_9FIRM  ali  29  7.SKAQLMQLINEVSFAVNDMNLYLDTHPDDKSAMEFMCDKIRIREEALKEYAMYYGPLTITADDDCSNSWDWVMQPWPWE... 86
174 4.000e-24UniRef50_A0A1W1ZQU7 Spore coat protein JB n=2 Tax=Papillibacter TaxID=100175 RepID=A0A1W1ZQU7_9FIRM  ali  33  73......LTELMALGFAIVDLGLYLDTHREDTEALELYTYYVKLYQESRASYEKLYGPIVQT-NVTMKTGYTWLNDPWPWER.. 146
175 4.000e-24UniRef50_UPI0004E0D64D spore coat protein CotJB n=1 Tax=Desulfotomaculum alkaliphilum TaxID=105483 RepID=UPI0004E0D64D  ali  34  8..CMKLLYDLMEWGFAQTELILFLDTHPDDVRALEEYNRVTQRMNQLTREYEAYCGPLVVQDFACPQEYWAWLETPWPWEIDY 88
176 4.000e-24UniRef50_UPI00088CFCAC spore coat protein CotJB n=1 Tax=Sporolituus thermophilus TaxID=608505 RepID=UPI00088CFCAC  ali  39  6..QLAMLKRVQEMEFVAIELGLYLDTHPCDEDAIYDYNCAIDLLKKYIKEYEDQYGPLTPM--AKSKVPWQWAEGPWPWE... 81
177 4.000e-24UniRef50_W7UKU9 Spore-coat protein n=3 Tax=Ruminococcus TaxID=1263 RepID=W7UKU9_RUMFL  ali  34  7.....LLSKIKKYDFALKELDLYLDTHPNCRRALAMFRKYKELRSQAVDEFTKRFGPLAPEQNNDMQ-HWSWIDDPWPWERR. 82
178 5.000e-24UniRef50_UPI0008331452 spore coat protein CotJB n=2 Tax=Firmicutes TaxID=1239 RepID=UPI0008331452  ali  28  1MEQKRDLKILMEVDFSLLEINLFLDTHPNDETAIKLHNTLAQKRMQVRNDYVCKYGPLSNEDMSM--CPWQYIEAPWPWNINF 83
179 5.000e-24UniRef50_A0A1Q6KG55 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1Q6KG55_9FIRM  ali  36  2..KKKLLMRLSALQFGMVETRLFLDTHPDDKEALELYNKYYEKHSALLKEYEAEYGPLTLNGLNSDD----WLKDPWPWDNEF 78
180 6.000e-24UniRef50_R7M7K3 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:914 TaxID=1262846 RepID=R7M7K3_9CLOT  ali  30  65.KREELLYNYMMYNFTLTDLGLYLDNYPNDVNVINLYNNYLNEYYKILNEYERNYGPLTIDSHYLNTSPWTWDNSPWPWEV.. 144
181 6.000e-24UniRef50_A0A1M5CFK7 Spore coat protein JB n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1M5CFK7_9CLOT  ali  23  3.DRTALLNELNDISFVMNDVTLYLDTHPLDEQALELFEQSKNRRKQLMQEYEQQFEPLTVFCNYPGQRHFTWVDGPTPWEGG. 96
182 6.000e-24UniRef50_R5STI6 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:762 TaxID=1262837 RepID=R5STI6_9CLOT  ali  28  74.NRQALLEKVMQYNFAITDLNLYLDNYPNDANVINIFNNYRNLYLNAVKDFENSYGPLEITDNPVNTNNWVWDKNPWPWEVQ. 154
183 7.000e-24UniRef50_R6BCA4 Uncharacterized protein n=2 Tax=environmental samples TaxID=2231195 RepID=R6BCA4_9CLOT  ali  31  83.KKDELLYNIQMYSFAMKDMNLYLDIYPDDKNILNSFHDYRKKYEVLKKQYESEYGPLC-MSNTLNTEKWTWVSNPWPWDKG. 162
184 7.000e-24UniRef50_UPI0009F2C456 spore coat protein CotJB n=1 Tax=Ruminococcaceae bacterium Marseille-P2935 TaxID=1852383 RepID=UPI0009F2C456  ali  29  5MNAAALMQKIMICKFVLLETGMFLDTHPANQEALAYFVKYRDLLEQLLKEYTTNYGPITHADF-NGGPTWNWIDEPWPWQNR. 85
185 7.000e-24UniRef50_R7N8N6 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=R7N8N6_9FIRM  ali  29  7.EQSRLHHNIDIMDFVIVEMNEYLDTHPTDRDAIEYTRHYVRMKNQAMKEYAAKYGPLSIQDIDASKDEWKWALQPWPWEGEY 89
186 8.000e-24UniRef50_U5MP58 Protein CotJB n=2 Tax=Clostridium saccharobutylicum TaxID=169679 RepID=U5MP58_CLOSA  ali  54  1MYGREILDKILTYQFCAVELNLFLDNFPDSKNAKDDYEKVSAKLTSLVHEYEKDYGPLTNFGSSFVENPRAWVDQPWPWEN.. 81
187 8.000e-24UniRef50_A0A1C5W4M8 CotJB protein n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C5W4M8_9CLOT  ali  24  3.SRAMLLKRLQVCDFVLTEVGLFLDTHPNDKEALAYYHKYLALKQETQTEFTRRFGTVSRY-EPKNSDTWDWVDNPWPWDN.. 81
188 8.000e-24UniRef50_C0EXL1 Uncharacterized protein n=1 Tax=[Eubacterium] hallii DSM 3353 TaxID=411469 RepID=C0EXL1_9FIRM  ali  21  1MNQQNLKCYIDFVSFAALDCAMFLDTHPKNAEGLEYFEYYTNARKQALKEYSSRFSPLTLDTVPKGTDFWAWANEPWPWEME. 82
189 9.000e-24UniRef50_A0A285PPP8 Spore coat assembly protein CotJB, domain n=9 Tax=Eubacterium TaxID=1730 RepID=A0A285PPP8_9FIRM  ali  23  40.EQKKLKRYIDLVSFAALDCAMFLDTHPESKEALEYFEYYKNARKQAIKEYSSRFSPLNLDTVPKDTEFWAWANKPWPWEME. 120
190 9.000e-24UniRef50_R6PWA3 Spore coat protein CotJB n=2 Tax=environmental samples TaxID=2231195 RepID=R6PWA3_9FIRM  ali  28  6MDQSQLLDWINQVSFVAYDTALYLDTHPYDEEALSFYNHYRTLRLKAVKMYEEKYGPLTLDGADTDG-HWSWGSMRNPWEGG. 86
191 9.000e-24UniRef50_D9R8D5 Spore coat protein CotJB n=34 Tax=Clostridiales TaxID=186802 RepID=D9R8D5_CLOSW  ali  24  3.DQKTLLKQITEISFTVNDLTLYLDTHPLDDNALTAFKQAMDQRKQLLKTYAENFEPLTINCVCPDTNHFTWTDGPLPWEGG. 96
192 1.000e-23UniRef50_A0A2V2F1E4 Uncharacterized protein n=2 Tax=Dielma fastidiosa TaxID=1034346 RepID=A0A2V2F1E4_9FIRM  ali  34  199..CRELKKRIQHLDFALQEVTLYLDMHPCDCRALRYYHRIKCELDKCMALYERHCAPISNKGN-ENQYEWEWAQSPWPWEGQ. 277
193 1.000e-23UniRef50_R6MG16 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=R6MG16_9FIRM  ali  32  4.SRVEMLKKIQCSNFAAYDMLLYLDTHSDDKKAFKMFQALVKKTKELKCEYEEKFGPLNQFSTAM-QDEFNWLDNPWPWEKE. 83
194 1.000e-23UniRef50_A0A173QT87 CotJB protein n=4 Tax=Blautia TaxID=572511 RepID=A0A173QT87_9FIRM  ali  30  72.QQEAMMRQIQEVSFMADDVRLYMDTHPEDQKGLELLQNVLSKRSMLMEEFAEKFFPLTIFERNPKSHCYCWKEGPMPWEGG. 158
195 1.000e-23UniRef50_A0A1V5XE48 CotJB protein n=1 Tax=Firmicutes bacterium ADurb.Bin193 TaxID=1852885 RepID=A0A1V5XE48_9FIRM  ali  35  4.NREKLLKELQELDFRMIELQLFLNTHPFEAKAVEEYNTAARKSKSMTEHFEKLYGPL-KLGNDDNTVPWKWVNGPWPWQ... 81
196 1.000e-23UniRef50_A0A2P2FAZ1 Uncharacterized protein n=3 Tax=Clostridia TaxID=186801 RepID=A0A2P2FAZ1_9FIRM  ali  29  75......LVELQALEFVVLELGIYLDTHPDDMEAFQLFQQYAAMEKSAKAAYEKRFGPLMK-STAATEDTYRWLQDPWPW.... 146
197 2.000e-23UniRef50_R7BI62 Putative CotJB protein n=1 Tax=Firmicutes bacterium CAG:882 TaxID=1262991 RepID=R7BI62_9FIRM  ali  28  6MDKMALFLKIHECEFMMIDLGLYLDTHPDCVQALNAFHTHQASYERNAAEYERLYGPLT-FYQVNSDTSWTWQQLPWPWEME. 86
198 2.000e-23UniRef50_A0A1G9VGV8 Spore coat protein JB n=2 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1G9VGV8_9FIRM  ali  30  3.DKNTLIRRIQICDFVLFETQLFLDTHPTDKDALAYYSKFLDLRSKAMDEYLKRFGPISA-GQYDGGPVWRWVENPWPWER.. 81
199 2.000e-23UniRef50_A0A1I5INN5 Spore coat associated protein JA (CotJA) n=4 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1I5INN5_9FIRM  ali  32  66IEREGLMTRITQLGFYLDDLTLYLDTHENDTQGIQLYHEISKEYAELRKQFAQNYYPLSPYCINDNETAFCWQEGPMPWEG.. 150
200 2.000e-23UniRef50_A0A2K9P576 Spore coat protein CotJB n=1 Tax=Monoglobus pectinilyticus TaxID=1981510 RepID=A0A2K9P576_9FIRM  ali  33  4..REELLKKLSAYSFAEKEWNLYLDTHPNDRDGLMMHRRMADKAKELSKEFEEKFGPLTTM-NVTNTECFDWIEEPWPWDN.. 81
201 2.000e-23UniRef50_R5Z992 Spore coat protein CotJB n=2 Tax=Roseburia TaxID=841 RepID=R5Z992_9FIRM  ali  25  13MNQKELYEWIMMLGFCAVDMMLYLDTHPDDEEALNYFNQCTALYNAAKQSYQEQFGQLNAFSEQERSS-WDWNTAPMPWEGG. 93
202 3.000e-23UniRef50_A0A1H8B842 Spore coat protein JB n=1 Tax=Hydrogenoanaerobacterium saccharovorans TaxID=474960 RepID=A0A1H8B842_9FIRM  ali  26  4.EQKVLSNRLKVSGFILLEVGLYLDTHPTDQDALAYYKKYNDIYDQTKKEYIEKYGPIMQTDY-NGGDRWDWVDGPWPWE... 81
203 4.000e-23UniRef50_R6E0U4 Spore coat protein CotJB n=2 Tax=environmental samples TaxID=2231195 RepID=R6E0U4_9FIRM  ali  34  1MTRAMLMQQIDAVQFAMWELHLYLDTHPDDLSALALYKKYEEKNEKLVSEFEENCGPL----YSNSDPGVSWLKNPWPWDLG. 78
204 4.000e-23UniRef50_R7FED2 Uncharacterized protein n=1 Tax=Ruminococcus sp. CAG:330 TaxID=1262954 RepID=R7FED2_9FIRM  ali  31  28.ERQKLMAMLRKYDFVLYELQLYLDTHPSCPHALRKWQEVSALRQKTASAYIRQFGPIQPRQTDGN-APWGWIEGPWPWEKE. 107
205 4.000e-23UniRef50_UPI0008F8EFD7 spore coat protein CotJB n=1 Tax=Angelakisella massiliensis TaxID=1871018 RepID=UPI0008F8EFD7  ali  29  6.ERECMMLRVQQTCFAVDETRLYLDTHPCDPKALAEMQRYQAQAAQAIAAYTEKFGPITSGSCGVVSGTWAWGEGPWPWERR. 86
206 5.000e-23UniRef50_A0A2K2TZH2 Spore coat protein CotJB n=3 Tax=Bacteria TaxID=2 RepID=A0A2K2TZH2_9CLOT  ali  29  3.DRMQLLKQINETSFVVDDLTLYLDTHPLDTDALDYFTQMSTKRKELLKTYAEDFEPLTNQSESYTKYPWTWSDGPVPWD... 94
207 7.000e-23UniRef50_A0A1I3HJS6 Spore coat protein JB n=1 Tax=Paenibacillus sp. UNC496MF TaxID=1502753 RepID=A0A1I3HJS6_9BACL  ali  35  12......LEQLQAVDFAIVELRLYLDTHPGDAEAQAQLDELASERLKLKEKVEADFGPLCHSEASRAGQAVSWSEGPWPWQ... 85
208 8.000e-23UniRef50_E7GD60 Uncharacterized protein n=10 Tax=Erysipelotrichaceae TaxID=128827 RepID=E7GD60_9FIRM  ali  35  47..RQQALLEVQMYGFVAHEINLYLDMHPNNQRMVELYTEYAKKTKEATAAYEKEFGPLSVQDT-PNKTPFEWVQGPWPWEYQ. 125
209 1.000e-22UniRef50_A0A1H9YRW4 Spore coat protein JB n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1H9YRW4_9FIRM  ali  27  3.DRKTLLQKINEASFAVNDITLYLDTHPADTEALQFFKKAMNERKAALEEFESQYEPLIVDCVNPKENHWTWGDGPIPWDN.. 95
210 1.000e-22UniRef50_UPI0003098F81 spore coat protein CotJB n=1 Tax=Sedimentibacter sp. B4 TaxID=304766 RepID=UPI0003098F81  ali  37  13.QQQAMLLDIQKLHFAALDLALYLDTHPNDPVALYRHHEYATHLKQYREAYEAEYGPMMNM-NTEMGDTWRYINSPWPWEM.. 91
211 1.000e-22UniRef50_A0A2N2BVQ3 Spore coat protein CotJB n=2 Tax=Firmicutes TaxID=1239 RepID=A0A2N2BVQ3_9FIRM  ali  32  4.ERVQSLRKVQIAAFAVNEAVLYLDGHPTNRKALEFYDKAKKDYKDSMEKYEATYGPLTFY--NAGGPSWTWIKGPWPWQNE. 82
212 1.000e-22UniRef50_R7HJ21 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=R7HJ21_9FIRM  ali  32  84.EREDLILQIDENRFAIIELGLYLDLYPNDTNILNKYNSYLKKEKELITIYESKYGPMTLNSPVQ-TNIWLWNNSPWPWEVQ. 163
213 1.000e-22UniRef50_A0A1M7FQN4 Spore coat protein JB n=1 Tax=Anaerosporobacter mobilis DSM 15930 TaxID=1120996 RepID=A0A1M7FQN4_9FIRM  ali  25  4INKEELFYKIQSVSFAMEDVRLYLDTHPDDIAACEYYDAYKKIRTKSVNQYNRFFDPLDAY-NIKREEYWSWCTKPWPWEGE. 84
214 2.000e-22UniRef50_R7HAR6 Uncharacterized protein n=1 Tax=Eubacterium sp. CAG:38 TaxID=1262889 RepID=R7HAR6_9FIRM  ali  28  91.NKSRYIADVYELGFVMVETALYLDTHPDDGEALAFYADMKHQYAEAVRLYNENVGPLS-FYHVTNENYWNWVATPMPWEME. 170
215 2.000e-22UniRef50_R7NIE7 Uncharacterized protein n=1 Tax=Mycoplasma sp. CAG:776 TaxID=1262906 RepID=R7NIE7_9MOLU  ali  25  60.EKERMLYQVMALSFAINDLNLYLDLHPDDKQVFELFKKYVKEEEDMCQSYVKKYGPLEV--TETMGGKFNWLNSPWPWDTK. 138
216 2.000e-22UniRef50_A0A1Y4WCT0 Spore coat protein CotJB n=2 Tax=unclassified Clostridiales TaxID=186813 RepID=A0A1Y4WCT0_9FIRM  ali  34  55......LAELQALEFVVLELGIYLDTHPNDTEAFTLFKQYSAMEKAAKAAYESKFGPITRAGAAAGESY-RWLQDPWPW.... 126
217 2.000e-22UniRef50_A0A1M7YKJ4 Spore coat protein JB n=4 Tax=Clostridiales TaxID=186802 RepID=A0A1M7YKJ4_9FIRM  ali  28  5..KCEAMKKLQEVSFALDEVRLFLDTHPFDKEALAYYENFRSEREKALSEYETAYGPIEQY-RVKENTMWYWVHCPWPWEG.. 82
218 2.000e-22UniRef50_U2CB36 CotJB domain protein n=11 Tax=Clostridia TaxID=186801 RepID=U2CB36_9CLOT  ali  26  69.EREQLLSKIDEAGFVVNDLTLYLDTHEEDEEALRMFEEYSNRKVQLTKEFAQKFYPLSEAAMVLCGKKFSWTDGPAPWEG.. 151
219 2.000e-22UniRef50_B2TPU6 CotJB protein n=8 Tax=Clostridium TaxID=1485 RepID=B2TPU6_CLOBB  ali  50  1MYEKDLLDSIRIYQFCGVELNLFLDNFPDNEDAKKDYDTVSAKLTCLINEYEKNFSPLTNFGTSFKEDPRSWIEKPWPWEND. 82
220 2.000e-22UniRef50_A0A174HUY6 CotJB protein n=9 Tax=Clostridiales TaxID=186802 RepID=A0A174HUY6_9FIRM  ali  24  65IKREDMMRKIAQVSFVLDDLTLYLDTHEEQEEAKELYQEKLKEREMLLKEYASAFNPLTIADCGSHDDRFCWQKGPMPWEGG. 149
221 3.000e-22UniRef50_R7NRJ8 Spore coat peptide assembly protein n=1 Tax=Eubacterium sp. CAG:581 TaxID=1262890 RepID=R7NRJ8_9FIRM  ali  34  4.ERDILLKKLSSVAFAMFEIRLFLDTHPDSTDAMAKFDDLNDKYVKLKEKFEDEYGPLMSKD---ADSPVQWIKGPWPWEVQ. 81
222 3.000e-22UniRef50_A0A252F4L4 Uncharacterized protein n=1 Tax=Butyricicoccus porcorum TaxID=1945634 RepID=A0A252F4L4_9CLOT  ali  25  27.EQQQAMQELRRREFAMIDAGMYLDGHPEDETALQYFRAMSKKHQQAEEMYQKHFGPLYL-SNAGTGKRWDWIDEPWPWEG.. 105
223 3.000e-22UniRef50_A0A0W7TQP1 Uncharacterized protein n=3 Tax=Ruminococcaceae TaxID=541000 RepID=A0A0W7TQP1_9FIRM  ali  28  13.......RELAQLSFAMDDLRLFLDTHPCDKAALAAHEEVRARRGIAVKQYERLIGPV-NFYDAGGTCTWNWTCAPWPWETE. 86
224 3.000e-22UniRef50_UPI000C1604FA spore coat associated protein CotJA n=1 Tax=Lachnospiraceae bacterium Marseille-P3773 TaxID=2002841 RepID=UPI000C1604FA  ali  25  67.EREQLMTKINQVSFFLDDLTLYLDTHEKDAQALQLYHEKSLECAELRKQFAQKFYPLTKLCVPFCGSSFCLQDGPMPWEG.. 149
225 3.000e-22UniRef50_R5J9Z6 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:1193 TaxID=1262771 RepID=R5J9Z6_9CLOT  ali  40  63.DRQKKLIEIMENGFYAHELNLYLDNFPNDKDKIDLYNKYNDKTDELITEYNRKYEPLNLSFNELKEVPWAWVESPWPWEG.. 142
226 4.000e-22UniRef50_A0A1I7GCA8 Spore coat protein JB n=2 Tax=Clostridium sp. DSM 8431 TaxID=1761781 RepID=A0A1I7GCA8_9CLOT  ali  42  1MDKDTLLNAIRKYLFYTLELNLYLDSFPNCSEAQKNFEIMSKKLNSLMNEYEEKYGQLQNFGLSCVSDSCSWTKDPWPWE... 80
227 4.000e-22UniRef50_U2CN76 Putative cotJB protein n=7 Tax=Clostridiales TaxID=186802 RepID=U2CN76_9CLOT  ali  25  13.EQERSLMNIGIASFVVVELTEYLDTHPHDREALNYFNYYNRMLNKMSAEFAAKFYPLNLATADSFNKEWKWGMAPLPWEG.. 92
228 4.000e-22UniRef50_UPI0009FBE036 spore coat associated protein CotJA n=2 Tax=Clostridiales TaxID=186802 RepID=UPI0009FBE036  ali  25  102.DRETLMTKISEVSFALNDLTLYLDTHCEDSQAIRLFAECAALRADLLKIFSERFYPLTQACLANCSCEFSWECGPAPWEG.. 191
229 4.000e-22UniRef50_UPI000786218B spore coat protein CotJB n=1 Tax=Massilibacterium senegalense TaxID=1632858 RepID=UPI000786218B  ali  36  1MQAFNWLYRLQAVQFALVELQLYLDTHPNDTVAKQQYTKYSDYIREFIPLYEKQFGPLFQYGLSDGKGNSPWVNEPWPWELEY 84
230 5.000e-22UniRef50_A0A2C6MDB1 Protein CotJB n=1 Tax=Desulfotomaculum profundi TaxID=1383067 RepID=A0A2C6MDB1_9FIRM  ali  34  18..............FATLELNLFLDTHPDDQQALAMFNKLHQDLMQCVRSYEQIYGPLLSYGFSPAQNTWRWAETPWPWELKY 87
231 7.000e-22UniRef50_A0A127VW42 Uncharacterized protein n=28 Tax=Bacillales TaxID=1385 RepID=A0A127VW42_SPOPS  ali  25  6.EERQMMLRVQQADFVVVELTLYTDTHPDEAEALDQWREAIKAAAHVRHQYENRYGPLSLASVPSEQAGWRWNSTPWPWQR.. 88
232 7.000e-22UniRef50_A0A174YVS0 CotJB protein n=3 Tax=Eubacterium TaxID=1730 RepID=A0A174YVS0_9FIRM  ali  31  10.EKAMIMKNIYELGFALVETMLYLDTHPDDAAAIEYYAEIKDKYVQFMKKYSDYYGPLSMEYMV-NDNYWMWVATPMPWEYK. 89
233 7.000e-22UniRef50_A0A2V2GJT1 Spore coat protein CotJB n=1 Tax=Ruminococcaceae bacterium TaxID=1898205 RepID=A0A2V2GJT1_9FIRM  ali  27  3.EKEKALRAVQEYDFQCIEAGLYLDSHPSDKDAMNYFNASREALAGAVENYEKCYGALSYSGNITADCGWNWDATPWPWE... 82
234 8.000e-22UniRef50_R6BZI9 Uncharacterized protein n=3 Tax=environmental samples TaxID=2231195 RepID=R6BZI9_9CLOT  ali  25  7.EMEQLLKDISILDFALVDFSEYLDTHPFDKQAIAYFNHYNKIRMDLTRQFSEKYYPL-QTSFSSDTAEWSWGLAPLPWKSNY 87
235 8.000e-22UniRef50_R5E3R5 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=R5E3R5_9FIRM  ali  31  36.NKNKGLMSIYELGFAMTEALLYLDTHPDDAEAIEYYNSIKPQYSEAVADYEECFGAIIATGTNGCG-YWNWQATPLPWEKE. 115
236 1.000e-21UniRef50_G4KP60 CotJB protein n=3 Tax=Firmicutes TaxID=1239 RepID=G4KP60_OSCVS  ali  28  72......LAELMALDFAVDELGLYLTTHPKDQEVLNLYWSYIKLLNEGREKYQKMYGPLFQTDI-TEKDGYTWLNDPWPWDEG. 146
237 1.000e-21UniRef50_A8RVA0 Uncharacterized protein n=11 Tax=Clostridiales TaxID=186802 RepID=A8RVA0_CLOBW  ali  27  3.DRCQLLQQINEISFVVNDLNLYLDTHPTDGQALDAFSQAMAQRKQLLDSFAKEYEPLTLNCVCPETNHFTWSDGPLPWD... 94
238 1.000e-21UniRef50_A0A1M5TH74 Spore coat associated protein JA (CotJA) (Fragment) n=1 Tax=Sporobacter termitidis DSM 10068 TaxID=1123282 RepID=A0A1M5TH74_9FIRM  ali  35  166......LGDFMALGFVIKELNLYLDTHPNDRDALDMFQQLNKLMREGREKIVKMYGPQTIMDI-MSGDKYTWIDNPWPWE... 238
239 1.000e-21UniRef50_R5QL10 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=R5QL10_9FIRM  ali  23  6.SKKALLEEITQVGFAVDEMTLYLDTHPYETEAIDYLTYYVRRKNQLMKEYAYQYGPLTIVTADHRQDVWNWALLPMPWNGG. 86
240 1.000e-21UniRef50_A0A2V2DWK7 Spore coat protein CotJB n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2DWK7_9FIRM  ali  27  3.EQEKMREAVYANGFAVDEARLFLDTHPSSKEAMDYFQKKMNMYQEALRRYEENYGPITPESGVMDGN-WAWATYPWPWEGG. 82
241 1.000e-21UniRef50_B8D197 Spore coat protein CotJB n=2 Tax=Clostridia TaxID=186801 RepID=B8D197_HALOH  ali  35  13....ELLMEIMEYQFGVVETTLYLNTHPRDERVLDLHNEFARGLQDLERQYQEEYGPLYA-AYPMADYPWAYIDEPWPWQINY 90
242 1.000e-21UniRef50_A0A1T4JK38 Spore coat protein JB n=3 Tax=Clostridia TaxID=186801 RepID=A0A1T4JK38_9FIRM  ali  37  1MTREQLLIEIMELQFTVHELVLFLDTHPQSREALEDHNKYANQLRDLKMEYQREYGPIVAYHPTQCGPLWEYISTPWPWQIDY 93
243 1.000e-21UniRef50_R6TRZ1 Spore coat protein CotJB n=1 Tax=Firmicutes bacterium CAG:272 TaxID=1263015 RepID=R6TRZ1_9FIRM  ali  28  13MSQGAMFEAIRQVSFVMDELRLFLDTHPKDRQALEMFLSNQEMRHRLIADYTEKYGPIDSY-FINTDGTWSWANPPMPW.... 90
244 2.000e-21UniRef50_R7I9C5 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:411 TaxID=1262802 RepID=R7I9C5_9CLOT  ali  21  85.EREEVMKALYEISFFLNDMLLYLDTHPDDQEAIDIFNVYNADRKKLLQRMEVDFYPLSPNCIVDNEDHFSWTDGALPWEG.. 167
245 2.000e-21UniRef50_A0A0D0SCD8 TWA4_scaffold00001, whole genome shotgun sequence n=2 Tax=Lachnospiraceae bacterium TWA4 TaxID=1392836 RepID=A0A0D0SCD8_9FIRM  ali  25  2MDQTNLMQKIYELGFAMDDMILYLDTHPEDNNALSYYHEVQKNYQKLWTEYNNQVRPLTNKTEVNTQ-IWNWNVGKMPWEGG. 82
246 2.000e-21UniRef50_A0A1C6BZC5 CotJB protein n=1 Tax=uncultured Roseburia sp. TaxID=512314 RepID=A0A1C6BZC5_9FIRM  ali  28  62......LKDIMETGFFLDDLTLYLDTHPDDKEALSLMNEYLKKKEQLVTEFSKSHFTLTKNCVPQSNKTFAWADGPAPWEG.. 139
247 2.000e-21UniRef50_A0A1I5MYC2 Spore coat protein JB n=2 Tax=Oscillibacter sp. PC13 TaxID=1855299 RepID=A0A1I5MYC2_9FIRM  ali  28  96......LVELMALDFAIDELGLYLVTHAQDQEALQLYWSYIKLANEGREKYQKMYGPLLQTDLTP-EDGYIWLKDPWPWDEG. 170
248 3.000e-21UniRef50_C5EKP2 Putative cotJB protein n=7 Tax=Clostridiales TaxID=186802 RepID=C5EKP2_9FIRM  ali  25  9.SQGAMLRQVDEAGFAVVDANLYLDTHPCDAAAIDYYNQMLAAYQSAAAAYEAQFGPLTA-SANKDTEYWSWVSDPWPWEG.. 87
249 3.000e-21UniRef50_H1C787 Uncharacterized protein n=24 Tax=Clostridiales TaxID=186802 RepID=H1C787_9FIRM  ali  36  72......LAELQALEFVLVELGLYLDTHQGDAEAFELYKQHAAMEKEAREKYEAMNGPVTQMATANAKTWAAWLSEPWPW.... 144
250 3.000e-21UniRef50_A0A1J0GLP1 Spore coat protein n=2 Tax=Clostridium TaxID=1485 RepID=A0A1J0GLP1_9CLOT  ali  29  2MNRTEVLKLVVASEFMKEDLALYLNTHPMDKEAIATYNFYVKESKRLKANYEMNYGMLS-EHDSLSPYPWQWINNPWPWE... 80
251 3.000e-21UniRef50_R6I1N0 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=R6I1N0_9FIRM  ali  34  68......LGEVMALDFVAQELALYLDTHSADEEAFELYKSILALSKTAKEKYVKLYGPLTHSDLLQAQSY-TWIKNPWPWD... 140
252 3.000e-21UniRef50_A0A1Q6QZH3 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:110_56_8 TaxID=1897027 RepID=A0A1Q6QZH3_9FIRM  ali  33  14........QMQALAFAVQELALYLDTHRDDREALELYRRYQQLLEKVRAEYQKRFGPL-NHGTPQTSESYQWLDDPWPWE... 84
253 3.000e-21UniRef50_UPI000C7A6384 spore coat protein CotJB n=1 Tax=Lachnoclostridium edouardi TaxID=1926283 RepID=UPI000C7A6384  ali  25  18....QLMTLIYQTGFALDDILLYLDTHPCDSDALNYYQYVKNIYNQAVNVYTVQCGHLRK-DQVKPGNYWDWITETWPWEGG. 94
254 3.000e-21UniRef50_U2SJU7 CotJB domain protein n=11 Tax=Firmicutes TaxID=1239 RepID=U2SJU7_9FIRM  ali  30  50......LVELMALDFAIDELGLYLTTHAQDQEALQLYWSYIKLAKEGREKYQKMYGPLLQTDLTP-EDGFAWLKDPWPWEEG. 124
255 4.000e-21UniRef50_A0A1Q6QAW0 Uncharacterized protein n=5 Tax=Firmicutes TaxID=1239 RepID=A0A1Q6QAW0_9FIRM  ali  31  12......LSELMALDFAIDELGLYLTTHPEDTEVLNLYWSYIKLGREGREAYEKQYGPILQTDVTPGS--FKWLDDPWPWDLE. 85
256 4.000e-21UniRef50_A0A1F8V1K8 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWF2_38_85 TaxID=1797683 RepID=A0A1F8V1K8_9FIRM  ali  24  3.EQKNMLKAIQALSFALLETGMFLDSHSNNQRALEYFRKNKQAYDTLKQQYTMRYGALTM--GEAAGDTWTWVNMPWPWQNE. 81
257 5.000e-21UniRef50_R6VXZ6 Uncharacterized protein n=1 Tax=Ruminococcus sp. CAG:382 TaxID=1262957 RepID=R6VXZ6_9FIRM  ali  30  5INRDNRLQRLRELEFALLETNLYLDTHPNSRKALDYYKKVKAARDIMYEDYVKNNGPM--FAADVRQDNWSWVDMPWPWQND. 84
258 6.000e-21UniRef50_R6LLJ7 Uncharacterized protein n=2 Tax=environmental samples TaxID=2231195 RepID=R6LLJ7_9FIRM  ali  28  79......LVQIQELGFALRELGLYLDTHQSDTEATALFNQYAERYEEAMQQYQQSGAALTQLESAQSG-TYTWLNDPWPWE... 151
259 7.000e-21UniRef50_J0N8F1 Protein CotJB n=19 Tax=Bacteria TaxID=2 RepID=J0N8F1_9CLOT  ali  34  3.DQERLMRQINAYRFMAWELHIFLDTHPNNCEAAKKLEDTRKKIDELTKNYEDAYGPM--GETSNQTSRWAWITGPWPWEIE. 81
260 9.000e-21UniRef50_R6I9Z5 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=R6I9Z5_9FIRM  ali  27  3.KRETMLRRLSAAQFTQWELHLYLDTHPSDLQALALFRKCDARYRALRSEYEAQFGALTALDATGAE----WLKDPWPWDTE. 79
261 1.000e-20UniRef50_UPI00047EF3C2 spore coat protein CotJB n=1 Tax=Dielma fastidiosa TaxID=1034346 RepID=UPI00047EF3C2  ali  32  1.....MKKRIQHLDFALQEVTLYLDMHPCDCRALRYYHRIKCELDKCMALYERHCAPISNKGN-ENQYEWEWAQSPWPWEGQ. 76
262 1.000e-20UniRef50_UPI00067950B4 spore coat associated protein CotJA n=1 Tax=Blautia schinkii TaxID=180164 RepID=UPI00067950B4  ali  21  76.EREALMSQIAAVSFALDDIVLFIDTHPNGAEAAALRMQLIEERKRLLKEFDEKFYPLTKDCEGM------WGEGPMPWEG.. 149
263 1.000e-20UniRef50_UPI000DE8C80A spore coat protein CotJB n=1 Tax=Alkalibaculum bacchi TaxID=645887 RepID=UPI000DE8C80A  ali  30  13......LVRIMQYQFAIYDIALYLDTHPNDTRALTTRQRLASELHEMTMAYEEKHGPMNLFSH--HGDYAKYVNEPWPWDIRF 87
264 1.000e-20UniRef50_R5AJ38 Uncharacterized protein n=5 Tax=Firmicutes TaxID=1239 RepID=R5AJ38_9CLOT  ali  40  6...KALLEKIREARFACIELRIYLDTHPDDAIAQADYLAYSEKLQLLITKYESQYGPLMNFGQSPTDVG-SWVYQKWPWD... 81
265 2.000e-20UniRef50_A0A1I3RNH1 Spore coat protein JB n=1 Tax=Ruminococcaceae bacterium D5 TaxID=1520815 RepID=A0A1I3RNH1_9FIRM  ali  26  20.......MQLAQAGFVIFDLLLYLDTHPTDQNALSYFAAKKSQYEQAKAAYVQQIGPVRISDVDPA-DGWTWGETPWPWEV.. 92
266 2.000e-20UniRef50_A0A1Q6QXQ0 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:321_26_22 TaxID=1897034 RepID=A0A1Q6QXQ0_9FIRM  ali  33  1......MLQIDENRFAIIELGLYLDLYPNDTNILNKYNSYLKKEKELITIYESKYGPMTLNSPVQ-TNIWLWNNSPWPWEVQ. 75
267 3.000e-20UniRef50_A0A2S4GNN1 Uncharacterized protein n=5 Tax=Blautia TaxID=572511 RepID=A0A2S4GNN1_9FIRM  ali  27  73.ERERLMKEISALSFALDDTVLYLDTHPESAEAMDLRKNLIEQRKGLLKEFDEKFYALTKDCIG------CWGEGPMPWEG.. 146
268 4.000e-20UniRef50_A0A1Y3TL40 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1Y3TL40_9FIRM  ali  24  70..RDKML-EVQKVSFMMDDLRLYLDTHPEDQDALAVFRDAVRQRKQTLSEFAEQFYPLTPDCMAPSSSCYCWQKGAAPWEG.. 153
269 4.000e-20UniRef50_UPI000D6B864C spore coat protein CotJB n=1 Tax=Murimonas intestini TaxID=1337051 RepID=UPI000D6B864C  ali  28  32.EQTQLLLQIMTVSFVLDDLRLYMDTHPADTAPADIKKELVTKRKQLLSQFAQNHYPLTPDCEG------CWQEGPMPWEG.. 105
270 5.000e-20UniRef50_A0A143ZXA1 CotJB protein n=1 Tax=Eubacteriaceae bacterium CHKCI005 TaxID=1780381 RepID=A0A143ZXA1_9FIRM  ali  23  3.DRMMLMRKRAAACFSMWETHLYLNTHPNDTQALQMLRQYEATCDKLTQEYESKYGPISASSADM-GCRWSWLTDPWPWDYD. 82
271 7.000e-20UniRef50_A0A135L2N8 Uncharacterized protein n=4 Tax=Bacillaceae TaxID=186817 RepID=A0A135L2N8_9BACI  ali  39  1MDKAALLRQYQELEFAAVEVRLYLDTHPFDQRAQCDFKRYTYQMMMLRPHLERHFGPLQQ--GFSYENPARWIDEPWPWELNY 82
272 7.000e-20UniRef50_H1AGH0 Uncharacterized protein n=12 Tax=Firmicutes TaxID=1239 RepID=H1AGH0_9FIRM  ali  24  1MKNDDLLMQIMMLDFAVQDSALFIDTHPCDKEAMNYFNEAATRLKAAKKEYQKQGHALVNREVGAYQN--DYLSAPWPW.... 77
273 1.000e-19UniRef50_R6SUC1 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=R6SUC1_9CLOT  ali  33  86.DQQKLYLDMAENAFAAHELNLYLDINPDNSSLLTLFNDYRERANALKEEYEANYGPISISSNVLINQPFLWEETSWPWEGG. 166
274 1.000e-19UniRef50_R8W543 Uncharacterized protein n=3 Tax=Butyricicoccus pullicaecorum TaxID=501571 RepID=R8W543_9CLOT  ali  26  3.ERQNMLRTVQMHDFALLEAAEYLDAYPQNADALAYFKTQQALYQAAVDAYTQKYGPL-QYKNGKYDNMWSWVSDPWPWEG.. 81
275 1.000e-19UniRef50_A6NUU9 Uncharacterized protein n=15 Tax=Firmicutes TaxID=1239 RepID=A6NUU9_9FIRM  ali  31  47......LAELQALEFVLLELGLYLDAHQDDSEAFELYRQYAAMEKASREQYEAAHGPLLQRSAAGEKTWASWLKDPWPW.... 119
276 1.000e-19UniRef50_R6EVD2 Uncharacterized protein n=5 Tax=Firmicutes TaxID=1239 RepID=R6EVD2_9FIRM  ali  28  5...EKKLHDIGIADFVLTDLMLYLDTHPSDQKAMEYFNHYARIKTQMEREFARDHYPLRK-DLAESSRDWRWGSAPLPWEGG. 82
277 2.000e-19UniRef50_R6TTA1 CotJB protein n=1 Tax=Staphylococcus sp. CAG:324 TaxID=1262969 RepID=R6TTA1_9STAP  ali  24  59......LNLLRAYQFALIDLQLYLDTHPNDVVTKELFDKYLDEYNQVKKLYEEKCGPLTLDSEANKGKVWKWQKG-WPFEG.. 132
278 2.000e-19UniRef50_A0A1U7M470 CotJB protein n=1 Tax=Tissierella creatinophila DSM 6911 TaxID=1123403 RepID=A0A1U7M470_TISCR  ali  28  1MDREELLVEISEANFVVLETALYLNINPTDENALYLHNNASRRYHQLLNIYETRYSLLRN--TSEDSCPWSYVDEPWPWDINF 83
279 4.000e-19UniRef50_R6GVZ5 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:582 TaxID=1262997 RepID=R6GVZ5_9FIRM  ali  26  50.EREALLIKIMMLDFAINDLNLYLALNPDCKEKYEMFTKYSLMYQKCLEEYEKKYQVLEVCHDTFGK--YTYNSNPWPWEGE. 128
280 5.000e-19UniRef50_A0A0S2W3Y1 Spore coat protein JB n=5 Tax=Firmicutes TaxID=1239 RepID=A0A0S2W3Y1_9FIRM  ali  29  73......MTELQALEFVLQELALYLDTHPSDGEAFELFRQYAALEETARADYVEIGGPIM-RGETARSKTYTWLQDPWPW.... 144
281 7.000e-19UniRef50_UPI000694E67F spore coat protein CotJB n=1 Tax=Beduini massiliensis TaxID=1585974 RepID=UPI000694E67F  ali  32  128.NQEQLLYQVLAFQFAAHELNLLLDNDPKNEKLIQLFNQYDEMYKKLLSQYTKQYRPLFV-DNCNPTNHWMWIHSPWPWENK. 208
282 8.000e-19UniRef50_R5ML17 Spore coat protein CotJB n=2 Tax=root TaxID=1 RepID=R5ML17_9FIRM  ali  32  4..RKAMLLKLGSLQFSLWELHLYLDTHPMDAAAEARYMGYKKAYDEVRAEFTKKYGPL----NPSEGNGEKWLKSPWPWEKQ. 79
283 4.000e-18UniRef50_A0A0J8Z2H7 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=A0A0J8Z2H7_9FIRM  ali  31  2...DETLMQISKLDFCIQEVTLFLDTHPNDQEAMKYYNEGMKRLLKMKETYLKNGGALTNRDGKNLKN---YINEPFPW.... 74
284 5.000e-18UniRef50_D9SUV9 Spore coat peptide assembly protein cotJB n=1 Tax=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) TaxID=57306  ali  46  1MERKELLDKIYDVGFYLVDLNLYLDTHVDXXXXXXXXXXXXXXXXXXXXXYEKKFGPLTNFGLQSAEDWEQWISSPWPWEKDF 83
285 7.000e-18UniRef50_UPI0005EBA138 hypothetical protein n=2 Tax=Clostridioides difficile TaxID=1496 RepID=UPI0005EBA138  ali  38  4.NRRELLERISEYQFACIELNLYLDNNPRDKKALDSYNRYCDKFTQAVCDYESRDGALTNFGH.................... 65
286 7.000e-18UniRef50_R7INL1 Uncharacterized protein n=1 Tax=Roseburia sp. CAG:303 TaxID=1262944 RepID=R7INL1_9FIRM  ali  23  61...KKLRKIIDQASFAMDDTRLYLDTHPDCKEAFIYYKKMEKIRNDAIKEYEIHCGSILSYANETGSENWNWNTGILPW.... 137
287 9.000e-18UniRef50_R5Y7U0 Uncharacterized protein n=1 Tax=Mycoplasma sp. CAG:611 TaxID=1262905 RepID=R5Y7U0_9MOLU  ali  23  55.EKDYMMLLLQIYDFNLVDLNLYLDIYPNDTNMLNLRDKYLKEYETAKKNYETKYGAITTYSETLNKTPWNW-DSSFPWEVN. 134
288 9.000e-18UniRef50_R7EV72 CotJB protein n=1 Tax=Anaerotruncus sp. CAG:390 TaxID=1262703 RepID=R7EV72_9FIRM  ali  31  22.NCPNLLEKIRQTDFAILDAVLYLDVYPDCSEAVKYIAKKNTERRELIDRYESTCGALTMFGIQSGVNT-----APWPWQ... 95
289 1.000e-17UniRef50_D4W5V4 CotJB family protein n=3 Tax=Turicibacter TaxID=191303 RepID=D4W5V4_9FIRM  ali  44  1MNKNELLRNIQAISLVAVDLRLFLDTHPGXXXXXXXXXXXXXXXXXXXXXYEKEYGPLLNFGHSDLTGKYNWIDEPWPWKNK. 82
290 1.000e-17UniRef50_R5MCB5 Uncharacterized protein n=1 Tax=Mycoplasma sp. CAG:956 TaxID=1262908 RepID=R5MCB5_9MOLU  ali  25  58.EEEALLLKINESEFALNDISLYLDLHPNDYDMYRKFREETNKYKEYLNRYERMYRPLEL--TSTYTDTYDYYKNPWPWDND. 136
291 1.000e-17UniRef50_R5G331 Uncharacterized protein n=2 Tax=Coprobacillus TaxID=100883 RepID=R5G331_9FIRM  ali  28  44.EKERLLLEVQKYAIMCHDLGLYLDVYPTDKEAVELRKNYLKLWEEAKNKYEEKYPPFAKNCKKIDVTPFPWSTTPFPW.... 121
292 2.000e-17UniRef50_R7KD23 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=R7KD23_9CLOT  ali  27  63.EQDDLFLRLSEQEFAAHDLNLYLDLNPQDGNMLEIFNQYRKEANNLLNEYEARYGVINISSEALKDSPFKWEMENFPWEGG. 144
293 2.000e-17UniRef50_R6YWZ5 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:345 TaxID=1263020 RepID=R6YWZ5_9FIRM  ali  28  77.EKEKLMGEIMIYSNAAHDLSLKLDIFPERIELLYKFDEYALKANNLIKEYESKYGPLKVNALVGPKNEYSWLKTPSVWEN.. 156
294 3.000e-17UniRef50_R7MDR7 CotJB protein n=1 Tax=Clostridium sp. CAG:628 TaxID=1262829 RepID=R7MDR7_9CLOT  ali  33  119.EKDELLLKIQELTFKMIDLNLYLDLNKDNTEIFNELKSTITELNKNKELYAKNYGPLCLKDNVNY-NSYMWSKNPWPW.... 195
295 3.000e-17UniRef50_R7HH14 Uncharacterized protein n=1 Tax=Mycoplasma sp. CAG:472 TaxID=1262904 RepID=R7HH14_9MOLU  ali  25  61.EKDKDLFKVMEASFAVNDYVLALDLNPNDENLFAKYKMWCEKLEKCSKEYESKYGPLC-YTKGNNYNSFKWVNGSWPWESE. 140
296 3.000e-17UniRef50_A0A176U9B4 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=A0A176U9B4_9FIRM  ali  20  4.......RNVYMHGFVCDDAALFLDTHPDCPHARHLYQENAVQYNQARKQYAAAGKPLFRTDAV-SDRGWIWTDEPWPWEGG. 77
297 3.000e-17UniRef50_R9L6D2 Uncharacterized protein n=2 Tax=Lachnospiraceae bacterium COE1 TaxID=1235793 RepID=R9L6D2_9FIRM  ali  22  68.EQEKAFIEICKIGFALNDLTLYLDMHPDCQNGINLMKDLLQQRLDALAEFAKNYYPLTQLSIVTGTTQYEWDEGPLPWD... 149
298 3.000e-17UniRef50_UPI00096A7FDA spore coat protein CotJB n=1 Tax=Merdibacter massiliensis TaxID=1871030 RepID=UPI00096A7FDA  ali  27  4.QRKKCLLEIMKLDFALQDSSLFLDLRPKDPAALAYYQRYLCLYDEKKSAYEGEYGPLSNRSLDAFAYS-KYACEPFPWERG. 83
299 5.000e-17UniRef50_UPI0009DCF062 spore coat protein CotJB n=1 Tax=Clostridiales bacterium DRI-13 TaxID=1449126 RepID=UPI0009DCF062  ali  45  3.ECMDLLRRIQEMEFVALELNLYLDTHPDDTRAXXXXXXXXXXXXXXXXXXXXXCGPILSYGHSNRGNTWLWVETPWPWEM.. 83
300 8.000e-17UniRef50_A0A0Q3WFX1 Spore coat protein CotJB n=3 Tax=Brevibacillus TaxID=55080 RepID=A0A0Q3WFX1_BRECH  ali  42  7......LRRLQEVQFALVELQLYLDMNPDDQRAXXXXXXXXXXXXXXXXXXXXXRGPLMHYGNSSSQDRWVWHKTPWPWEIEY 83
301 1.000e-16UniRef50_D4L9S0 Uncharacterized protein n=6 Tax=Ruminococcus TaxID=1263 RepID=D4L9S0_RUMC1  ali  38  3.ERVKLLRQVQQCDFTLYDLQLYLDTHPAXXXXXXXXXXXXXXXXXXXXXYVRRFGPLRAEQAAGSE-PWSWVENPWPWEGG. 82
302 1.000e-16UniRef50_R7FN02 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:288 TaxID=1262791 RepID=R7FN02_9CLOT  ali  20  67.EKEKIMLELMAYDIVAHDLGLYLDIYPNDKEAALEFEKYSKLASDKKKEYIDKYGPLTQAEGKYKDGYMDYVTKPSAW.... 144
303 1.000e-16UniRef50_UPI00094FAFD3 hypothetical protein n=1 Tax=Paenisporosarcina indica TaxID=650093 RepID=UPI00094FAFD3  ali  22  4.EQRKLMHELQIADFNVIEWDLYMHTHPDDLEGCQKLYEKTTYAKKIRKHYEALYGPLTNLTPRPCDQA---SCTPWPWQV.. 80
304 2.000e-16UniRef50_UPI0009E6A5DC hypothetical protein n=2 Tax=Clostridia TaxID=186801 RepID=UPI0009E6A5DC  ali  30  199..CRELKKRIQHLDFALQEVTLYLDMHPCDCRALRYYHRIKCELDKCMALYERHCAPISNKGN-ENQYEWEWAQS........ 270
305 4.000e-16UniRef50_A0A1I4KQ96 Spore coat protein JB n=1 Tax=Paenibacillus sp. 1_12 TaxID=1566278 RepID=A0A1I4KQ96_9BACL  ali  27  11....ELLEQLEAVDFALVDMILYLDVNPKDSNALTQHDELCEQRKEIRNQLALANG-IAFNYESNRKVAWPWGQSPWPW.... 84
306 7.000e-16UniRef50_A0A1W1VYZ8 Spore coat protein JB n=18 Tax=Firmicutes TaxID=1239 RepID=A0A1W1VYZ8_9THEO  ali  45  4.DRRKLLEQIMALEFTALEFNLYLDTHPQXXXXXXXXXXXXXXXXXXXXXXXXXYGPLTNYGSTPSPGSWRWVEDPWPWEITF 85
307 7.000e-16UniRef50_R6BG66 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:533 TaxID=1262818 RepID=R6BG66_9CLOT  ali  26  56.EKEKLMLKIRELSHAVGDLNLYLDLCPDDRDVYELFKKYMIELNELTCLYSEKYEVLELSKDVNGSYTWE--SGLWPWEVK. 134
308 1.000e-15UniRef50_B1C6I3 Uncharacterized protein n=1 Tax=Anaerofustis stercorihominis DSM 17244 TaxID=445971 RepID=B1C6I3_9FIRM  ali  33  34...QEIYHDIKMYTFATQDTALYLDTHPNDTVVLDRHNEYSKKLKEANEAYEKFNNPIDNTGISTGF--WHYIEGPW...... 105
309 1.000e-15UniRef50_D4W6U0 Uncharacterized protein n=5 Tax=Turicibacter TaxID=191303 RepID=D4W6U0_9FIRM  ali  40  1MSREEFLTSLQAVHIMAVDLQLFLDTHPEXXXXXXXXXXXXXXXXXXXXXYEQAFGPLTNFGYMTNFDQISWVNDPWPWER.. 81
310 1.000e-15UniRef50_A0A1Y4VI85 Uncharacterized protein n=1 Tax=Eubacterium sp. An11 TaxID=1965542 RepID=A0A1Y4VI85_9FIRM  ali  25  102..QQKKLKKLTEISFVVDDLNLYLCTHPEDEKAFEIFQEYAKQRKQLLAEMSEEHFPLCGEAAEELADR---KKEPCPWKG.. 177
311 3.000e-15UniRef50_UPI00030CCAA0 hypothetical protein n=2 Tax=Paenisporosarcina TaxID=651660 RepID=UPI00030CCAA0  ali  22  4.EQRKLLLSLQVADFNVIEWVLFMHTHPDDLVGCQQKKEAMKTAAKIRKSYEDLYGPLTHLVPISCSKK---NLTPWPWHV.. 80
312 4.000e-15UniRef50_D4JWC4 Uncharacterized protein n=8 Tax=Clostridiales TaxID=186802 RepID=D4JWC4_9FIRM  ali  30  11....QLLRQLSAADFYAQDLKLFLDTHTDDEKALELYREAVKQTEACRCAFENEFYPLRASC-AGKDCGWDWLSGQW...... 82
313 4.000e-15UniRef50_A0A1R1CD19 Uncharacterized protein n=1 Tax=Paenibacillus sp. FSL H7-0331 TaxID=1920421 RepID=A0A1R1CD19_9BACL  ali  24  11....ELLEQLEAVDFALVDMILYLDSHPQDANALTQHDELCEQRKEIRNQLAIANGAVYKY-EPTRKLEWPWGQSPWTW.... 84
314 7.000e-15UniRef50_A0A1C7GQU6 Spore coat protein CotJB n=6 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1C7GQU6_9FIRM  ali  36  6..RQALRRKISAMQFACWELHLFLDTHPNNCEAXXXXXXXXXXXXXXXXXXXXXFGPL--NELSRDTSRWDWINGPWPWERE. 83
315 3.000e-14UniRef50_UPI000C81E22A spore coat protein CotJB n=1 Tax=Clostridiales bacterium Marseille-P2846 TaxID=1852363 RepID=UPI000C81E22A  ali  30  8..........YALPFATWEVRLYLDTHPSDARALALYQQLCAQ-SQGMQNYAC------LPDGNCSSSRWAWIDNPWPWEPE. 72
316 6.000e-14UniRef50_UPI000D528052 hypothetical protein n=1 Tax=Gorillibacterium timonense TaxID=1689269 RepID=UPI000D528052  ali  25  52....TLLKDLQTADRSMLQLTLHLGQYPEDKVALDQYNELSQARQNTRTKAEAAFGPMRSYHTSLIDKHWDWHQ......... 121
317 2.000e-13UniRef50_A0A2G5WJU0 Spore coat protein CotJB n=1 Tax=Sporosarcina sp. P13 TaxID=2048263 RepID=A0A2G5WJU0_9BACL  ali  27  5.EQRAMLKEVQQADFVVVELTLYTNTHPNDEDGXXXXXXXXXXXXXXXXXXXXXYGPLSLHSIPSEQAGWRWNQAPWPWQM.. 87
318 9.000e-13UniRef50_R7P2Y2 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=R7P2Y2_9CLOT  ali  32  59.ERESDLLDIMALSLALNDLNLYLDLHPGDKEMLKKFNELVEVSCTKEMEFVKKYGPLEVNDGAYYE-KFEWINNPWPWENE. 138
319 9.000e-13UniRef50_R6XQ20 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:313 TaxID=1263017 RepID=R6XQ20_9FIRM  ali  27  64.........LKAYNFMLIDLQLYLDVHPEDENVKELFNEYVRRWHETKENVQKINGPLYLASTADSQNNWDWQKK-WPFEGK. 136
320 1.000e-12UniRef50_F2JK07 Uncharacterized protein n=1 Tax=Cellulosilyticum lentocellum (strain ATCC 49066 / DSM 5427 / NCIMB 11756 / RHM5) TaxID=642492 RepID=F  ali  38  5.NANELLDLIRILGFNMFDAVLFLDTHPRXXXXXXXXXXXXXXXXXXXXXYTTYFGPLTSDD-VNVTNGWTWGETPWPWERE. 84
321 3.000e-12UniRef50_A0A0C2QFF0 Uncharacterized protein n=2 Tax=Cohnella kolymensis TaxID=1590652 RepID=A0A0C2QFF0_9BACL  ali  24  6IKQLKILREPRPIDFAETELSPYLDKQRGDAKGFKQFKQTAEKRKEYKDRVDAGFGSLSKSAEPNSGHTSGWDAGPWPWQV.. 87
322 4.000e-12UniRef50_R5XD50 Spore coat protein CotJB n=4 Tax=Firmicutes TaxID=1239 RepID=R5XD50_9FIRM  ali  35  1MKKEQMLLKLSAAQFAMWEMRIYLDTHPGXXXXXXXXXXXXXXXXXXXXXYEKDFGPITLGDGNSDE----WLKDPWPWDN.. 77
323 4.000e-11UniRef50_R7DLZ2 Uncharacterized protein n=1 Tax=Coprobacillus sp. CAG:826 TaxID=1262857 RepID=R7DLZ2_9FIRM  ali  21  63.EKENLLLLMMVYSGILHDLELLLDVNPEDKTAMSLFKTYKGKYLEVEKTYLEKYAPLCPMHSYEKNGAFAYVKTASPW.... 140
324 1.000e-10UniRef50_A0A1Y4RM63 Uncharacterized protein n=1 Tax=Lachnoclostridium sp. An14 TaxID=1965562 RepID=A0A1Y4RM63_9FIRM  ali  30  78..QAELMQELCEVSFLLDDLTLYLDTHPEDKQAWDIYQENNQKRKELKETFAKRFYPLTRDCMAFCGDY-GWENGVPPWEGG. 156
325 5.000e-09UniRef50_R5T5Y6 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:710 TaxID=1262833 RepID=R5T5Y6_9CLOT  ali  33  80.EEEEALLNLNQMQFAMHEINLYLDVYPNDNNMXXXXXXXXXXXXXXXXXXXXXYGSLLVNSDSLNQIPFGWEEEVWPWDRR. 160
326 1.000e-08UniRef50_A0A2P2BR48 CotJB protein n=1 Tax=Romboutsia sp. Frifi TaxID=1507512 RepID=A0A2P2BR48_9FIRM  ali  39  4.SRRDLLDKVLEYSFACIELNLYLYNNPEDKNALNSYNQYSDKY....................................... 46
327 2.000e-08UniRef50_C0BAW8 Uncharacterized protein n=1 Tax=Coprococcus comes ATCC 27758 TaxID=470146 RepID=C0BAW8_9FIRM  ali  27  1.......MQIGHASFAVDDVKLYLDTHPRDQEALDFFYEYNKK........................................ 36
328 5.000e-08UniRef50_B1HYL9 Spore coat peptide assembly protein cotJB n=1 Tax=Lysinibacillus sphaericus (strain C3-41) TaxID=444177 RepID=B1HYL9_LYSSC  ali  36  1............................................MKLKVNYEQKFGPLMNFGRSYSDYPFKWIDTPWQWQVQ. 38
329 6.000e-08UniRef50_UPI0004AC91E6 hypothetical protein n=1 Tax=Clostridiales bacterium VE202-14 TaxID=1232452 RepID=UPI0004AC91E6  ali  32  1.......MEIQKVSFVMDDLRLYLDTHPDDLDALAMLKRVHPRY....................................... 37
330 3.000e-07UniRef50_A0A0K2SML3 Uncharacterized protein n=1 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SML3_9FIRM  ali  30  12...EELMLELQTEEFQAVDWMLFADTH---EEGMEEYRRHAARTRELMETYVSRYGPL......................... 63
331 2.000e-06UniRef50_R7GIV0 Uncharacterized protein n=2 Tax=Clostridium TaxID=1485 RepID=R7GIV0_9CLOT  ali  18  1..........MSYRFNLIDMSYLLDINPNDLELLNYYNTVKKDFYNLLSYYEEKYNALSNI-PLKDFNKYCYLKKPW...... 66
332 5.000e-06UniRef50_A0A1N7KIN0 Spore coat protein JB n=3 Tax=Bacillales TaxID=1385 RepID=A0A1N7KIN0_9BACL  ali  28  1MTQDRLLGELQTIDFFLSEINMYLDSHPQDATALERQQQYQRIRQELDREYQ............................... 54
333 5.000e-05UniRef50_A0A0D5NKR8 Uncharacterized protein n=1 Tax=Paenibacillus beijingensis TaxID=1126833 RepID=A0A0D5NKR8_9BACL  ali  19  16......LSELHEIDFALTELRIYLNRTPEDDMAIRQLKQLTEKREQIASKLASDCKSLQQAAVNEADVP.............. 78
334 1.000e-04UniRef50_A0A2N2CS89 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-16 TaxID=2013777 RepID=A0A2N2CS89_9FIRM  ali  28  4............................................KQLREEYNARYGMLLAN-NCTSKMPWQWIDNPWPWQKSF 41
335 1.000e-03UniRef50_R5W0Z4 Uncharacterized protein n=1 Tax=Coprobacillus sp. CAG:605 TaxID=1262855 RepID=R5W0Z4_9FIRM  ali  23  4.................................FNKFKEYTSEYKRYLNEFEKNYRPLVLS--SINKDSYEYYKNPWPWDND. 50

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.