current user: public

If you have questions about the server, please let us know.

Query: IDP05411 putative chitin binding protein [Bacillus anthracis str. Ames] BA_2793 [Bacillus anthracis str. Ames], from CSGID

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .
# E-value Template Links and tools%idFirst MNNRLLKQLQNMKMNKKSLGAVALTAGIIGTTLIPQNTYAHGFVEKPGSRSALCSPTYGALNVNCGSVMYEPQSLEAPKGFPQGGPVDGQIASAGGKFGGILDQQTADRWFKNTITGGENTFTWKYTAPHLTSKWHYYITKKGWNPNKALTRADFEPIGTVQHDGSAASNHLTHKINVPTDRSGYHVILAVWDVADTANAFYNVIDVTLINDVKPDTEAPSIPNGIQAQKVTANSIELAWTASTDNVGVKGYQIFRNGEMIDTVPGTHFIDKKLQPSTEYSYTVKAIDAAGNASKESAKLTVKTTVEAPDTEAPTQPKGLHSMGTTTSSVDLMWSPSDDNIGVGHYDIYRETEGSMKKIATSNTTSYMDKNLLPNTTYKYVVKAVDVAGNESVQSDIFTITTKTEGVSYEEWDAKKAYEKGDKVLHEGKVYEAVQSYKGNGDPNWIYALSLWKTVLast
1 0.000e+00UniRef50_R7ZEN5 Chitin binding protein n=30 Tax=Bacillales TaxID=1385 RepID=R7ZEN5_LYSSH  ali  71  3........TKFTKLSKKGITAALLAAGIMG-ISMAPNASAHGFVEKPASRSALCSQNYGALNLNCGNIMYEPQSLEAPKGFPQGGPVDGKIASAGGLFGGILDQQTANRWFKNTITGGSNTFTWKYTAAHLTSKWHYYITKKGWDPNKPLTRADLEPIGTVEHNGSAASNNLTHTINVPTDRSGYHVILAVWDVADTTNAFYNVIDVNLLNNGDVDKEAPTQPNGLNATKVTSNSVELKWNPSTDNVGVKEYQILRDGKAIGTVPGTTFTDKNLKANTKYTYTVKAVDAAGNVSKESESAVIETMNAVPDTEAPTQPTALHTMGVTSSSVDLMWSASEDNVAVDHYVIYRGTVGQMTVVGTSKTTSFMDMNLQSNTTYKYAVTAVDAAGNESIKSSILTVTTKEQGASYEQWNPNKAYTKGDKVEHQGKIYEAVQSYQGNGDPNWIFALSLWKEI 449
2 0.000e+00UniRef50_Q4V1H9 Chitin-binding protein n=500 Tax=Bacilli TaxID=91061 RepID=Q4V1H9_BACCZ  ali  72  1MNKKILGQFRKMATNKKGLSAAAVAMGIMSTTLIPQNAYAHGFVEKPGSRAALCSQNYGALNSNCGNIMYEPQSLEAPKGFPQGGPADGKIASAGGLFGGILDQQTANRWFKNTIKGGENTFTWKYTAPHSTSQWHYYITKKGWDPNKPLARADFELIGTVKHDGSKASNNLSHKINVPTDRSGYNVILAVWDVADTVNAFYNVIDVNLINDEKPDKEAPTKPSELQVIKATSNSVEFNWKPATDNEGVKEYQVLRNGELINTVVGTSVIDKKLNLNTEYTYTVSAVDAAGNISEKSEALVIKTTEEKPDTEAPTQPKGLHSMGTTTSSIDLMWSPSEDNVDVSHYIVYREVGGAMKEIGTANTTSFMDKDLRANTTYKYVVSAVDTSGNESMKSDAIKVTTKGQENSYEQWDAHKAYKAGDRVVHEDKVYEAVQSYQGNGDPNWIFALSLWEEI 455
3 0.000e+00UniRef50_A0A0T8JJR2 GlcNAc-binding protein A n=513 Tax=Bacteria TaxID=2 RepID=A0A0T8JJR2_STREE  ali  93  1MNNRFLKQLQNMKMNKKSLGAVALTAGIISTTLIPQNAYAHGFVEKPGSRSALCSSTYGALNVNCGSVMYEPQSLEAPKGFPQGGPVDGQIASAGGKFGGILDQQTANRWFKNTITGGENTFTWKYTAPHLTSKWHYYITKKGWNPNKALTRADFEPIGTVQHDGSAASNNLTHKINVPTDRSGYHVILAVWDVADTANAFYNVIDVNLINDVKPDIEAPSIPNGLQTQKVTANSVELTWNASTDNVGVKGYQIFRNGEMIDTVIGTHFIDKKLQPSTEYSYTVKAIDAAGNVSKGSTALTVKTTVEIPDTEAPTQPKGLHSMGTTASSVDLMWSPSDDNIGVDHYDIYRETEGSMKKIATSNTTSYMDKNLLANTTYKYVVKAVDVAGNESVQSDIFTITTKTESASYEAWDAKKAYKKGDRVLHEGKVYEAVQSYQGNGDPNWIYALSLWKTV 455
4 0.000e+00UniRef50_A9VF14 Chitin-binding domain 3 protein n=31 Tax=Bacilli TaxID=91061 RepID=A9VF14_BACWK  ali  87  1MNNRILKHLQNMKMNKKSLGAVALTAGIIGTTLIPQNAYAHGFVEKPGSRSALCSPTYGVLNMNCGSVMYEPQSLEAPKGFPQGGPVDGQIASAGGKFGGILDQQTADRWFKNTITGGENTFTWKYTAPHLTSQWHYYITKKNWNPNKPLTRADFEPIGTVQHDGSAASNNLNHKINVPTDRSGYHVILAVWDVADTANAFYNVIDVNLVNNEKPDTEAPSNPNGLEARKVTANSVELAWNASTDNVGVKGYQVLRNGEIIDTVPGTHFIDKQLQPSTEYSYTVKAIDAAGNVSKVSTAVKVKTSVATLDTEAPTQPKGLHSMGTTASSVDLMWSPSDDNDGVDHYDIYREISGVMKKIGISNTTSHMDKNLLANTTYKYTVKAVDVAGNESAQSDVFTVTTKTESASYEAWDSKKAYKKGDRVVHEGKVYEAVQNYQGNGDPNWIYALSLWKTV 455
5 7.000e-82UniRef50_W2E8P6 GlcNAc-binding protein A n=63 Tax=Bacillales TaxID=1385 RepID=W2E8P6_9BACL  ali  50  34......................................YAHGYIESPASRAYMCTL---GKNVNCGPVQYEPQSIEALGGFPKTGPLDGQIASGGISNFKPLDVQTPDRWNKVTIKGGKNTFQWYLTAPHSTAEWKYYITKKDWDPNKPITRADLELIGQIDEGGKKPSSTVTHEINVPTDRNGYHVILGVWEIADTANAFYQVVDVNLVNEGTTPPETIAPPTSLVSSGQTSHSIELRWNASSSN--VAKYEIFRDGQLIGETAGTSYADHGLQADTTYTYTVRAVDAAGNISPASDALNVKTNKDEGTTPPETPPTSLVSSGQTFHSIELRWNASSSN--VVKYEIFRDGQ----LIGETAGTSYADHGLQADTTYTYTVRAVDAAGNISPASDALNVKTKKSDTSAVEWDPNKVYTEGMTVLYKGLEYKAKYWTKG................ 426
6 1.000e-72UniRef50_A0A2E6WP96 Chitin-binding protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2E6WP96_9MICO  ali  49  12....................AASAVALVGTGILTSAPASAHGYVDGPISRSAACAA---GLNTNCGSIVYEPQSLEAPKGFPETGPADGQIASAGGLFGGVLDEQSEGRWFKNEVATGPLLMDWKYTAPHSTAKWHYYMTKPGWDPNDPLDRNDLELISEIQHDGSKANSNPDHTLTIPGNRSGYHVILAVWDIADTVNAFYNVIDVDVVGEGISDTIPPTNTVNLQTTSVSATSVNFTWTGPTDDSGVVRYDVYRDGRLVGSSSIAEFSNTGLSPSMDYQFTVVAVDASGNRSIPSDILTVTTDASEVDDQAPIAPGYLHSMGETTQSVSLMWNASDDNSGDVRYQVFRDG----VQFANTEMTMLMDTNREPGTTYLYLVVAVDETGNRSAASNQLAVTTDSQPVESGTWDRFASYTVGDTVTHADSIYEAVQSHTGNGDPNWIYAPSLWVAV 456
7 3.000e-71UniRef50_A0A2W0CGB3 Chitin-binding domain 3 protein n=2 Tax=Paenibacillus TaxID=44249 RepID=A0A2W0CGB3_9BACL  ali  42  40........................................HGYLESPASRAYLCQQN---LNSNCGQVQYEPQSVEAKGNFPIGGPSDGEITGGGI--FPELYTQTAERWTKLDMQTGSQTFTWKLTAAHATKEWKYYITKKDWNPNAPIERKDLELFCTYSDGGKLPEKSVSHQCEIPADRTGYHVILGVWEIADTGNAFYQALDVNLTKPSNTDEIAPTAPTDLKASNITTKSLTLRWHPSTDNVSVMSYEIYQNGHKITTITSVSYDVSGLSQGTTYIYALKAIDAAGNESPLSSEITVTTSATIPDTSAPTAPSNLHAHTVSAASVSLMWSSSTDNVAVNSYDIYQGSERVAT--VNGTMTSYEVTGLKSSSTYTFSIKAKDSAGNVSAASNVITVTTLESSPPPKAWAENTPYHIGDRVLYKEVIYICRQAHTSIYTWTPSEVLALW... 458
8 2.000e-68UniRef50_UPI0004681C0B hypothetical protein n=1 Tax=Leucobacter sp. PH1c TaxID=1397278 RepID=UPI0004681C0B  ali  51  2..............................GLAAATPALAHGYVGSDSS--DLVSRAALKANTGLGSVRYEPQSLEAPKGFPAGGPADGKLASAGGLFGGALDEQSATRWVKNEIQPGANAIGWRFTAPHKTAQWSYYITKSGWDPNAPLDRGDFELISTVAHDGSAASTNPTHIVDIPADRTGYHVIYAVWDIADTSNAFYNVIDVNISGDPVEDVEAPSAPGAPQAGSVTEHSATLSWAASTDDIGVNGYEILRDGAVIGRTSALSYTDTGLAPATSYVYAVRALDGSGKVSPLSGTTTVTTASEPADTEAPSAPEHLHSMATTATSVDLMWTPSTDNVGVTGYTVLRDGTAVATTTAA----RYVDSGLRPATSYRYQVVANDAAGNT-AVSETFTVTTKAAVGGA-AWDPRGSYATGDRVIHNGRAYVAVQTYRGYGDPNWINAPSLWK.. 447
9 3.000e-66UniRef50_A0A0H3GIZ6 Chitin-binding protein n=116 Tax=Listeria TaxID=1637 RepID=A0A0H3GIZ6_LISM4  ali  43  1.............MKKMTKIGMFFAVFTLAVVLFQTTASAHGYISKPASRVYLAN---KGINVGVGSAQYEPQSVEAPKGFPISGPADGSI--AGGGKYSLLDEQSASRWAKVDIESGPLTVEWTLTAPHKTSSWQYFITKKGWDPNKPLTRSSLEPLATIEADGSVPNALAKQEINIPNDRSGYYLILGVWNIADTGNAFYQVIDANIINSDITPDTEEPTKPTNLAATTTTKTVSLAWNASTDNVGIKGYEILRDGVVIGESQTASYEDTTVESNTAYTYTVRAKDFAGNKSTLSNSINVTTKEPAVDNEAPTAPKSLMSHGQTDTTIALCWQASTDNVEVKNYEIYRNN----TKIATSTKTMFEDTKLASNTSYNYKVYAVDTSGNRSLVSNEITIKTKTLDP-LNTWKSDQIYNAGDQVYYNGVAYTAKWWTKGNTPDTSDVWQTASTDI 435
10 1.000e-65UniRef50_R2RGP0 Uncharacterized protein n=48 Tax=cellular organisms TaxID=131567 RepID=R2RGP0_9ENTE  ali  45  1...........MKKKIVGLALVSAISLGGAALLNAEEGNAHGYVEKPAARGYQGSLDWTAAMEKYGIVITNPQSLEFDKGFPQAGPADGRIASAQGGKGQVMDSTGANRWTKQEISTGSNTFTWHYTAPHSTTKWHYYMTKVGWNPEKPLTRADFDFLGEVKHDGSAASNNKSHQIVVPENRSGYHVILAVWDVADTSNAFYNVIDVNVNGSGEITPPIEVAPEKPANVKTSEVTMSSLKLTWDTVANAKEYNVYRNGKKVATIGGTQFNDASLAENTTYSYQVEAVGTNGKVSEKSTEVNVTTQSSAVDNQKPTVPTNVHSMGTTESSVALMWTKSTHFLGVKNYEVYRDG----KKIETTEKTSFTDTGLKANTTYDYTVKAVSLGGNVSEASAVFSVKTKEASNGHSTWEADKVYTAGNKVLFDDLEYEAKWWTKGDR.............. 436
11 3.000e-65UniRef50_D1BKC6 Uncharacterized conserved protein n=1 Tax=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) TaxID=446469 RepI  ali  46  1...........MSRTHRSIRAGLTSLVLVGALAVTAPASAHGYVGGEG--ADMVARAALRENVNLGAVQFEPQSLEGPKGFPEGGPADGQLASAGGLFGGNLDEQTSDRWVKNEITPGPNIITWHYTAPHRTSKWTYYITKEGWDQNAPLTRAVLEELTTIEHDGTPATTNPVHTIDVPADHHGYHVIYAVWDVADTANAFYNAIDVDIQGDGPEADVPDAPTGLAAMSSSSTVDLTWQASAS---DGIDHYDVYRDGAKVGSTPTTTFQDSGLRASTSYGYTVRAVDVDGAVSRHSEALSVATTGPDGADG-PTAPSSLHSMATTSTSVDLMWTGSTGPAAVTHYTVLRAGSGQPVEVGTTSDVRYLDEGLAPSTTYHYTVVAHDATG-ASSASDPFSVTTQGDGPLYPVWDPFAAYTVGDRVTHDGLVYEAVQSYQGHGDPGWIHALSLWRVV 441
12 7.000e-63UniRef50_A0ALF2 Chitin-binding protein/carbohydrate-binding protein n=20 Tax=Listeriaceae TaxID=186820 RepID=A0ALF2_LISW6  ali  40  1.............MKKFSKIGMFFAVVVLAVVLFETSVSAHGYISKPASRVYLANQ---GINTGVGAAEYEPQSIEAAKGFPTNGPQDGNI--AGGGKYPLLDEQTQDRWTKVDIKSGPLNVEWTLTAPHRTSNWEYFITKKGWDPNKPLTRAEFEPLAQITADGSTPDQLTKQQITIPNDRSGYYVILGVWSIADTGNAFYQVIDANIINSDVTPDKESPTAPTNLIGTTTANKVSLKWNAATDNVGINGYEILRDGKVVGESQTTTYEDNTVNANTTYTYTVRAKDFAGNKSALGNISVTTKEAPAADKEAPTAPTSLMSHAQTDRAIDLCWQASSDNVAVKNYEIYRNNTKITTTTST----MFQDINLINNTSYKYKIYAVDIAGNRSLASNEITVKTKPLDIS-NTWKPDQIYNAGNQVVYNGIAYTAQWWTDNSPDTSDVWKTASSTT. 435
13 3.000e-59UniRef50_W0LAZ6 Fibronectin n=6 Tax=Enterobacterales TaxID=91347 RepID=W0LAZ6_9GAMM  ali  36  21........................................HGHVFSPASRAFFAWQEGR---LNTGQL----NQREAGKFFPAVNPPDGKIASANQGDGEFLDEP-GTHWQKHDVLSGDITMSWHYTAPHLTRRWNYFITQPNWNPNQPLSRAQFEEQPFWSNGQALTPPQPTIHDLVLPQRTGYHVLLAVWEVADTGNAFYQVVDLNFVGTGGGGGEQPQPPRGLRITEVNSHTISLAWEASVSN--VSHYLIYRNGSFIAQSTGLNFTDSGLQADTTFEYSVRAVNHAGNESALSASVSARTLPENNYENPPTPPVNLHSMGETENSISLMWGPSTSSNGIMGYLIYRDD--IEIARVQPSQLTFLDTGLQPNTGYYYFVIAQDNQGRISAQSNILHVKTSGGGSTYPQWELYTFYPVGARVSYRGSNWLCIQAHTAWTVPGGLDYQTLWKII 457
14 4.000e-59UniRef50_A0A0D7KGZ9 Chitin-binding protein n=7 Tax=Paenibacillaceae TaxID=186822 RepID=A0A0D7KGZ9_9BACL  ali  42  5.......CTWNAGMRKXXXXXXXXXXXXXXXXXXXXTVLAHGYIDSPSSRADLCA---KKVNKNCGFIIYEPQSLEAYKGFPAAGPADGKIASANGA-FPELDQQSATRWSKVNITPGTTTFHWTIEANHATTSWKYYITKQDWNPNAPLSRASFTPFCNVDYKGKQPPHSYSDTCNVPS-RTGYQVILAVWEIADTANAFYNVIDVNFGGGSPVDPTPPTAPSNLAVSNVTAYTAKLSWNASTDNVGVTGYNIYKDSTLVGSTTTLTYALTGLTPNTTYSYTVRAVDAAGNESTSSNAVSFKTSAPQPDTDPPTAPSQLTASNITATSVKLSWTASTDNVGVAGYRVYNGS----TLVANTNGVTYTVTGLTANTAYTFTVIAYDAAGNVSPSSNAVSVT-TAPAPTATPWAANTSYAAGALVTYNGKTYAALVAHTSLVGWEPPNVPALW... 443
15 2.000e-58UniRef50_A0A2W1ZT63 Chitin-binding protein n=1 Tax=Curtobacterium sp. MCSS17_008 TaxID=2175647 RepID=A0A2W1ZT63_9MICO  ali  47  31........................................HGFVDSGDPTHTLTARVAMQANGDMGGAQYDPQSLEAPKGFPAAGPADGHLASAGHTEWSVLDEQGEDRWQKNVVEQGDVTVNWTYTAPHKTSQWRYYMTKDGWDPNDALDRDDLELIETVEHDGSEASNNPSHEITIPSDREGYHVIYAVWDVADTANAFYNVIDVDETPEPVEDTEAPGLVPDAAGRAVSSTEAEITWGAASDDRGVARYQVVRLGATEGSATGRSARLTGLQPGEVYSFGVRAVDAAGNVGLAHTILTVRM---PEQAAAPAAPKHLHDMGTTESTVALMWTAGDDTEGV-RYEVFRDGD----KVGETGATDFVDVGLRAGSRHEYTVRAVNLDGIASAMSNRHVTTTKDAASEYPTWDAHAAYTKGDRVTHGGSVYEAVQSYQGHGDPNWITAPSLWKPV 454
16 2.000e-57UniRef50_A0A0Q4H5G9 Uncharacterized protein n=7 Tax=Micrococcales TaxID=85006 RepID=A0A0Q4H5G9_9MICO  ali  47  1.....................MLATATALAMLGVAAPAFAHGWIGGSGS--ELTARQVMPGNTGLGAVAYEPQSLEAPGGFPETGPADGRIASAGIAQFSELDAQTATRWAKNEITPGPHRFGWTYTAPHNTDQWRYYITKNGWNPNEPLKRSSFELLQVVAHDHSAANTYPVHTITIPSDHSGYHVILAVWEVWDTTNAFYNVVDNISGSPGSADTQAPTAPTSVRSTATGSSSVGLAWTASTDDRGVSGYRVERATATVAQATGASHLDTGLSASTAYRYRVAAVDAAGNVSAYSAVFSVTTGSGSPDTQAPTAPTGVHSMATTATSVDLMWTASTDDRGVAAYRVERATTGAFAQVGQGAGTSLVDSGLTAATAYRYRVAAVDAAGNVSAFSTVFQVTTVASGGTAPAWNPSGAYTKGDRVSHGGAVYEAVQTHQGVGDPSWITARSLWTPV 441
17 3.000e-57UniRef50_A0A1Y3AZE0 Uncharacterized protein n=1 Tax=Euroglyphus maynei TaxID=6958 RepID=A0A1Y3AZE0_EURMA  ali  30  379..............NRKGKITVEKCSSDKISTGKSGPQPRHGHVFSPASRAYIAWQEGK---IDTGML----NQRECGKFFPAQDSGLTDIVSYANQGNGNFLDDAGTHWSKHNVMSAEMKISWYYSAPHSTRRWNYFITRKDWNPNLPLSRVELTEQPYWSHGAALTPPQPTEHNVMLPQRSGYHVLLAVWEVANTGNAFYHVIDLDFSDNNNDSDVDPVAPDGLRANSVTASSITLKWNASV--TPAFAYRLYRDGNPIGQVTELTFIDSGLSKNTAYSYAVSTLNEEGTESALSQAIIVRTSDVIIPGTPPTQPSHLHSMGVTVDTVKLMWGGATSNGTLAGYIIYRDG--HEIARTSVAQLTYDDSAIKAGTIYRYFVVAFDTQAQLSVPSNVLSVKTSSGSSQYPEWKLGTYYPTGKKVSYQGDKASDVGRGDDIAVQYPIPTYRFIVTL 823
18 3.000e-57UniRef50_UPI0009F4CD41 T9SS C-terminal target domain-containing protein n=5 Tax=Aquimarina TaxID=290174 RepID=UPI0009F4CD41  ali  29  526......................................................SLSWRASTDNVGVTGYDVTSVSGTSYNVTGLTANTTYEFRVKAKDAAGNTSGFSNTVSVTTKEATDTEAPSVPTNLSASNVEQTSLSLSWRASTDNVGVTGYDVYQGDVKIT-SVSGTSYNVTGLTANTTYEFRVKAKDAAGNTSGFSNTVSVTTKE--ATDTEAPSVPTNLSASNVEQTSLSLSWRASTDNVGVTVYDVYQGNVKITSVSGTSYNVTGLTANTTYEFRVKAKDAAGNTSGFSNTVSVTT-KEATDTEAPSVPTNLSASNVEQTSLSLSWGASTDNVGVTVYDVYQGN----VKITSVSSTSYNVTGLTANTTYEFKVKARDAAGNTSGFSNTVSVTTKEGSTTDITWVSGVSYAIGDRVIYRGYVYE....................... 907
19 1.000e-56UniRef50_R2S951 Uncharacterized protein n=28 Tax=Enterococcus TaxID=1350 RepID=R2S951_9ENTE  ali  41  1.............MKKQLLTTLLCSTAIFSTLMINQNASAHGFVESPPSRGYQGRLDYDAAFAKYGNVITNQQSLEARKGFPQAGPADGRIASAGQINDFVLDNQTSSRWTKQEVTQGPMNIVWNYTAPHSTAKWHYYITKADWNPDAPLARDSFELISTIDHDASPATNNPNQLINIPNDRLGYHVVLAVWDIADTPNAFYNVIDVNVKGSTGLPVAPTAPQNVRT-TNVTASSVSLAWN---GQANTASYNIYRDGVLVGNSVNASFEDKNLNEETTYRYEIEAVGQGGLTSNKTAISVTTTAQASE--EKPTAPQNLHSMGTTSSSVSLMWGRSSHTQGIKQYDIYRDG----KKIASTSNATYNDTNFSANTTYSYTVKAISNSNEVSDFSNTLRITTAEKSEGETEVFAPQTYTENEVVVHQGKRYTTLQTHVNYGDSTWAPDQAAS... 449
20 3.000e-56UniRef50_A0A1M7JXA7 Por secretion system C-terminal sorting domain-containing protein n=11 Tax=Chryseobacterium TaxID=59732 RepID=A0A1M7JXA7_9FLAO :_  ali  41  1...........MIKLRNFFSAVLFLCTLV---FSSTHLSAHGYVISPASRGYLGSLDKTTLGYNYGTVINEPGSLEAKKGFPALGPADGMIASANGSIGTILDLQTADRWKKTNITTGVNTFIWKYLAYHATAKWHYYMTKPGWNPNQPLARQDLELIGEVVHNGTPPQDNTPHHITIPANRQGYHVILAVWDVADTANAFYNVIDVNVQSSVTPTQ--PSIPTGLAKISVTSSSAKIGWAAQADA---ASYNVFRNGQALQNVSVPEFQDQGLAANTSYTYEIQAKGSTGLTSQKSAPLIVKTDDQNT-PEKPVAPSNLHSMGATENSVSLMWMPSTHTQGIKNYQVFENGA----QVAETTQTSFVRSGLIHDTEYRYTVKAVAQNDQISDASNELTIRTKKIEGGNGQTPANAYPTAQTTVFYNCKIWKNKWYANPNEIPG........... 435
21 1.000e-54UniRef50_A0A2K2XBV1 Carbohydrate-binding protein n=28 Tax=Chryseobacterium TaxID=59732 RepID=A0A2K2XBV1_9FLAO  ali  41  1...........MIKCKFFFPVLLMLATLVPSLV---HVSAHGYVVSPASRGYQGSLDYSAALGIYGSVINEPASLEAPKGFPTYGPADGKIASANGSIGTTLDLQTADRWKKTNITTGVNAFIWKYTAYHATAKWHYYITKQGWDPNQPLTRQNLELIGTIMHNGTPPQDNVSHQITVPANRTGYHVILAVWDVADTTNAFYNVIDVNVT--SGTGVSAPATPTGLAQIGITSSSVKIGWNPQSDAV---SYNIFRNGQNIQQVSGVTFQDTGLTANTVYTYEIQAKGSSGLISGKSTPLNVKTNNEGT-LEKPTATSNLHSMTVTENSVSLMWMASTHSQGIKNYQIFENG----IKVGETVQTNFLRTGLAQDTEYHYTVRSVAMNDQISDMSNELKVKTRITSGNGQTYCASERYNIANAYPTAGT.......................... 412
22 4.000e-54UniRef50_A0A168R5H0 Chitin-binding protein n=141 Tax=Bacillales TaxID=1385 RepID=A0A168R5H0_9BACL  ali  41  11............KIKSLVASSIMTLLALAMFFVFEGNASAHGYVSNPSSRAALCA---SGVNTNCGLIIYEPYSLEALKGFPAAGPTDGKIASAN-GQFAPLDQQSATRWSKVNLSAGPTTFNWNIKVPHATSSWKYYITKQDWDPNAPLTRASFDLTPFCNVSYSGTPGNSYSDTCNVPSRTGYQVILAVWSISDTANAFYNVIDVNFPGNL--DTAAPTAPASVAVSNIATTSATVTWSAATDNVGVTGYKIFNGSTQIASTTGASYNLTGLTSNTTYNITVKAVDAAGNVSPVSNAAFTTLTVVGPDIEAPSAPTSLHVMSTTSTTVPLMWNASSDNVAVTGYRVFSGTTLVTNLSG--STLDYLVSNLSPNTAYTFTVKAVDAAGNVSAASNTLNVTTPAAPTTYPAWNSSTAYVGGNKVTYNGVNYEAKWWTQG................ 432
23 2.000e-52UniRef50_A2WG26 Chitin binding domain protein n=23 Tax=Proteobacteria TaxID=1224 RepID=A2WG26_9BURK  ali  35  10.......................................RHGHVFSPESRATFAYLDGKLG-------YYDTNSLEAGKFFPATAPADGEIASAGFPAALFLDEP-GTHWKKHTVRGGDAIFSWNYSARHASRRYNYFITKHDWNPHEKLSRSQFEQPYWEHEDGLWPPAPTTHEI-VLPERVGYHVVLAVWEVANTGNAFYQVVD---LEFGESGGHRPQPPRELQAVDVTTSSIELSWQAPPTEVPIDFYSVYRNDLPLVKVDAASYVDRGLEPDTEYAYYVRATDTEGGQSERSATIVVRTLGNGEPAQ-PKPPQHLHSMGETADSVHLMWGKSTGSYPISAYRVYRNG--IQVDETGPSRTEFVDTGLSPDTEYRYFVAAVDTRGWLSLPSNVLIVRTAAENGGTPEWAAGVAYAVGDEVSYQGVRYRCLQAHTSIPTWTPVDTINV.... 437
24 9.000e-52UniRef50_UPI00054C329E hypothetical protein n=1 Tax=Pseudomonas fluorescens TaxID=294 RepID=UPI00054C329E  ali  32  8...............................TISRSNNPRHAHVFSPSSRAHFEWLAGR---LDEGAL----NQRESGKFFPLTAPPDGKIASANQLTGAWLDEP-GSHWQKHDVRSGEIDFSWFFSAKHSSRRWNYFLTKDGWNPDEVLSRAQFEPFYTVQINLQPHWASPTIHSVPLPKRDGYHVCLAVWEVANTSMAFYQVVDLNFVPPDGGGERPETPTGLAAET-VTDKQVVLKWNAAAGPHPIVAYRISRNGGFFVEVPNLTFTDNSVAPETLYNYAVSAVDDLGNVSAQSRPIQV--HTLPEGGTGPTAPTNLHSMRQTERSISLMWGASTGSARIMDYLIYRDG--VEVRSVGASQTTYDDSGLTPDTAYRYSVRARDLNGRLSAQSNVLSVSTQGEGGAKPAWKLDTLYEVGAEVRHSEKKWSCKQRHTSYT-TDWAPGVG..... 442
25 1.000e-51UniRef50_A0A0E8XMY9 Fibronectin type III domain-containing protein/ chitin binding domain-containing protein n=26 Tax=Gammaproteobacteria TaxID=1236  ali  35  14.................................SNGISSFHGHVFSPASRAYFAWLAHE---IDEGAL----NQREAGKFFPETAPLDGKIASAGEETGQFLDEP-GTHWQKHDVLAGDIEISWHYSMKHKARRWKYFMTRTDWNPNLPLSRAQFEPFYMVQLNEQPHWSDPTIHELILPLRSGYHVLLAVWEVANTGNAFYHVIDLDFVGEGGSDQ--PLPPANLRATSITKNSVSLAWNASVSD--VAHYQIYRDGVFLAQTTTLNWIDSNLKAGTKYIYTVSTIDTTGIASSLSTPLLVETLAENSDNAPPSAPKSLHSMNVTENSLELMWGTSTSSTGLKSYLVYREGEKIAEVL--VPQYTFQETGLSPDTTYRYFVAAQDTQGRLSVPSNVHSVTTHAKSDGGPAWELGATYNVGDKVSNFSKDWVCISSHTAYDAPGSIDYHTLWTLI 463
26 3.000e-51UniRef50_UPI00041F1346 chitin-binding protein n=1 Tax=Bacillus TaxID=55087 RepID=UPI00041F1346  ali  70  1...........MQLFQKRSAAVIAAALWSGLLFIPQQAFAHGFVEKPESRAALCSESYGLLNLNCGSVMYEPQSLEAKKGFPQDGPADGQIASAGGLFGGILDQQSENRWFKHIMTGGVHTFTWTYTAPHKTSQWHYYITKKDWDPNQPLKRADFEAIGTIEHDGSPASNHLSHQIEVPQDRQGYHVILAVWDVADTENAFYQAID......................................................................................................................................................................................................................................................... 195
27 4.000e-50UniRef50_UPI000A0191F0 T9SS C-terminal target domain-containing protein n=3 Tax=Aquimarina TaxID=290174 RepID=UPI000A0191F0  ali  29  805......................................................SLSWGASTDNVGVTGYDVTSVSGTSYNVTGLTANTTYEFRVKAKDAAGNTSGFSNTVSVTTKEATDTEAPSVPTNLSASNVEQTSLSLSWVASTDNVGVTGYDVYQGNVKIT-SVSGTSYSVTGLTANTTYEFRVKAKDAAGNTSGFSNTVSVTTKE--ATDTEAPSVPTNLSASNVEQTSLSLSWVASTDNVGVTGYDVYQGNVKITSVSGTSYSVTGLTANTTYEFRVKAKDAAGNTSGFSNTVSVTT-KEATDTEAPSVPTNLSASNVEQTSLSLSWVASTDNVGVTGYDVYQGN----VKITSVSGTSYNVTGLTANTTYEFRVNAKDAAGNTSEFSNTVSVTTKEGSTTDIVWVSGVNYAVGDRVIYRSYVYE....................... 1186
28 2.000e-49UniRef50_Q665Z3 Uncharacterized protein n=8 Tax=Yersinia pseudotuberculosis complex TaxID=1649845 RepID=Q665Z3_YERPS  ali  34  15.................................SNGISSFHGHVFSPASRAYFAWLAGE---IDEGAL----NQRESGKFFPETAPLDGKIASAGESTGQMLDNPGSHWTKHDVLAGDVLDVSWNYSMKHKTRRWKYFMTRTDWNPNLPLSRAQFEPFFMVQLNEQPHWSDPTIHELILPQRSGYHVLLAVWEVANTGNAFYHVIDLDFVGEGGSDQ--PLPPANLRATNITKDSVSLAWNASVSD--VAHYQIYRDGVFLAQTTTLNWIDSNLKAGTKYIYTVSTIDTTGIASSLSSPLLVETLAENSDNAPPSAPKSLHSMNVTENSLELMWGTSTSSTGLKSYLVYREGEEIAEVLA--PQYTFQETGLSPDTTYRYFVAAQDTQGRLSVPSNVHSVTTXXXXSIHPAWELGATYNAGDKVNNLGRDWVCLAAHEPTWAPGDTDYHTLWTLI 468
29 4.000e-49UniRef50_S0AGM0 Chitinase A1 n=5 Tax=Proteobacteria TaxID=1224 RepID=S0AGM0_SERPL  ali  33  7....................................NQPRHGHVFSPESRAIFAYQEGKLTDTD-------PSSLEAGKFFPATAAADGQIASGGWPGALFLDEP-GTQWRKHEVKAGPLTVSWAYHALHLTRRWNYFITKADWDPSTPFYKAELSAQPHWEHQAALTPPEPTIHQMTLPERHGYHVLLAIWEVANTGNAFYQVIDLNFTDAGGNERPTPPGGLHATH--VTANSLELAWSASTGTHPITSYSVFCNGDLLVDAPALGYTHKNLAPDTDYTYFVSATDSENNQSLPGNSIVVRTLSEGGEDNPPTAPGNLHSMGVTADTVCLMWSASTGGHALKHYYVYRDG--IQVGTTSPTQHEYTDAGLSGSTEYRYFVAAIDVRDYLSLPSNVLILKT-SGGGNIPEWALNTRYEVDDKVRYQGKTYQCIQAHTSNEGWDPTQTVNLWKEI 443
30 1.000e-48UniRef50_A0A2U1FGZ7 Chitinase n=2 Tax=Pseudomonas TaxID=286 RepID=A0A2U1FGZ7_9PSED  ali  33  424......................................PAHGGVFLPKSRAVRAWERGVA-----GMDASIPYSLEAGKFFPAYQPADGQIASAGHPQARLLDEVASETGAPWPTHRQSLRFEWHYSAIHAARRWNYFITRPDWDPSKKLSRAQFEPFTTVQFDLVPTWPDPTVHEITLPYREGYHVLLAVWEVADTGMAFYQVVD---LSFEAGSTGEPGSPSNLRVATRTTSSIGLAWQASTSGTAAAGYEIARDGQPAAYAHDLEWLDEGLQPGTAYAYEVVAVDREGHRSQPARVSAATLPLEEG--VKPTEPLALHAMGVTARSASLMWGAATGQAGVDGYRLYRDGALLEQL--SPPALTYTAEGLSEGVEYEFFVTAYNASG-ESVPSNVLRVTPQGEEGTRPWSSAGVSYRVGDQVSYKGAGYRCIQAHVSNSAWSPEQAPTLWSPL 862
31 2.000e-48UniRef50_UPI00099A874F chitin-binding protein n=1 Tax=Elizabethkingia anophelis TaxID=1117645 RepID=UPI00099A874F  ali  35  18......................................LRHGHIFSPESRPYFAWKEGK---IDKGAL----NQIEAGKFFPAIQPKDGQIASGGQVPSLLLD-QPGTHWKKHKVKSGTLAVSWDYTAAHTTRRWNYFITKSTWNPNQVLSRAQFEPFYQVQLNHEPFWAHTTIHNVPLPLRDGYHVLLAVWEVADTGNAFYQVIDLDFVNDGNGEQKPERPTGLQVL-NIHERSITLGWDPLVIKSKIAKYRITRNRVTTIDIPEASWEDKGLLPNTEYTYQISAIDTNGNESFPSNSVKATTLSENGSDAPPFPPIDLHLMGISDSYVNLMWGKSAGNNPITTYVICREG--LEIARIPADKESYIDKNVAPNTSYRYFIAAIDSEGLWSVPSNVCSVRTKSVTSSDAEWKINTHYVTNTKVSYQNKIYRCLQSHTSNTGWTPVDTLNVLWT. 453
32 2.000e-47UniRef50_A0A290N1Q3 Chitin-binding protein n=3 Tax=Elizabethkingia TaxID=308865 RepID=A0A290N1Q3_9FLAO  ali  37  3.....................................................................................PRDGQIASGGQIPSLILD-QPGTHWKKHQVKSREVSVCWDYTAAHTTRRWNYFITKANWNPNQVLSRVQFEPFYQVQLNYAPFPPVPTIHNVPMPAREGYHVLLAVWEVADTGNAFYQVIDLDFANEGSAQERPERPKGLRVL-GTTERSIKLCWDASVDNEKIEKYRITRDGLTTIDVVSSEWEDEGLKPNTKYVYQISAIDTNGNESLPSPSVNAMTLSEGGNETPPFAPNNLHLMGVSDSYVNLMWGRSVANNPVEVYIIYRDG--LELARVESNLESYIDRSVKPNSSYRYFVAAQDREGLLSVPSNVLSVHTKDVGGSDSEWKINTHYSVNTKVSFQNKIYRCLQAHTSNIGWNPIDTLNV.... 378
33 2.000e-46UniRef50_A0A0T9UNB3 Fibronectin type III domain-containing protein n=5 Tax=Yersinia TaxID=444888 RepID=A0A0T9UNB3_YERIN  ali  34  14......................................LRHGHVFSPKSRAYFAWEKGQ---IDTGMVSGLTDTLAATDTLSSLPPRDGEIASANQMNGNVLD-QPGTHWEKHNVESSQLPISWSYSAQHATRRWNYFITRKDWNPNLPLSRVQLSEQPFWSYGEALNPPNPTEHKIMLPERVGYHVILAVWEIANTGNAFYHVIDLNFVGGDVTP--APVAPAGLRCTGVTTSSVSLAWSAP--SVPTASYRIYRNGTLISSQTATAFTDSALTENTRFDYQLSSVDASGVESALSEVLSITTLSTDAVDAPPSAPANLHSMEVTTKSVSLMWGGAQFGDRVQAYIIYREGD--EVARVELSQLTYKDKELQANTRYRYFVAAVDVQGRLSVPSNVLTITTDVTPEDYRTWALGRMYVTAEVVKHNGLLWSCLQSHTAWVD-NWAPGASESATL 451
34 2.000e-45UniRef50_UPI0009FAE79D hypothetical protein n=1 Tax=Thermoactinomyces vulgaris TaxID=2026 RepID=UPI0009FAE79D  ali  42  1MAQQPIRKKLLCRGSQLLTAFGMLLLTGAGMLLFAESAFAHGYIEAPASRSYLCKQ---GQNVNCGQIQYEPQSIEAPKGFPNGGPADNKIASGGVGDFAELDVQAPDRWTKVNLNGGEQTFKWMLTAAHATSNWKYYITKKGWKPEMGLTRANLELFCTHDFGGKRPSAIEEHKCNVPTDRSGYHLILGVWEIADTSNAFYQVIDVNLNNNGTQDNHKDQTNKPDEKKDTTTDSVKTDWKAYHDYK--VGDIVTFNGTTYECIQAHS........................................................................................................................................................................................... 280
35 7.000e-44UniRef50_A0A094TF25 Cbp21 n=40 Tax=cellular organisms TaxID=131567 RepID=A0A094TF25_PROVU  ali  46  1...........MKKNKLMVFTATLLLSSAISTASADVTLKHGYIDTPPSRAFLCSAKGKNLNKDCGPIQYEPQSIEGGKGFPKDGPADGQIASGGKEAFSALNAQSADRWHKVEMKSGENMFKWTLTAKHSTESWRFFITKPGWDVNKPLTRADFTPFCQQDDNGKIPTETVEINCNIPE-RSGYQIILGVWDIADTGNAFYQVID......................................................................................................................................................................................................................................................... 198
36 6.000e-42UniRef50_A0A1Y2SS76 N-acetylglucosamine-binding protein A n=3 Tax=Enterobacterales TaxID=91347 RepID=A0A1Y2SS76_9GAMM  ali  48  1...........MNIKKSLLLVGLTAFSTIPFFSSAESGSRHGYIDSPPSRALLCS---KNINKNCGPVMYEPQSVEGPKGFPQGGPPDGQIASGGVGQFKQLNEQSADRWHHVNINKGMNEFTWTLTARHSTASWQFFMTKPDWNPNQPLTRAQFDPFCERFDGGKIPTQKVALKCDVPE-RSGYHVILGVWTIADTNNAFYQVID......................................................................................................................................................................................................................................................... 193
37 4.000e-41UniRef50_A0A0T8K0K8 GlcNAc-binding protein A n=392 Tax=Bacilli TaxID=91061 RepID=A0A0T8K0K8_STREE  ali  53  2.......KKNSLQKMKKVILSGGVLLTGLLTFGFSEKASAHGYVESPASRSYLCKQ---GVNVNCGPIQYEPQSVEGIGGFPQLGPSDGQIAGAG--HFPALDVQTVDRWKKVTLNGGTNIFKWKLTAPHSTKEWKYYITKKGWNPNKPLTRSDLDPFYVKNDGGARPGTTVTHEANVPTDRSGYHLILAVWEIADTGNAFYQVID......................................................................................................................................................................................................................................................... 197
38 3.000e-40UniRef50_UPI0009A4FD4D N-acetylglucosamine-binding protein GbpA n=1 Tax=Serratia marcescens TaxID=615 RepID=UPI0009A4FD4D  ali  43  1...........MKLKKIAL--------MVATLAVSSGALAHGYIEFPESRAFKCKLNK---NSECGAVQWEPQSVEQQSGFPKGTPPDNKLASGGIASFAPLDVQNENRWAKNTIRAGKNQFKWFHTAPHKTNNWRYYITKSNWEPNKPLTRESFEPFCQIEGHGDAPPKSVTHECMV-PERNGYQVIYGVWEINDTVNSFYQVVDVNFAGGEVVDDW............................................................................................................................................................................................................................................. 198
39 7.000e-40UniRef50_A0A0G0W6P0 Fibronectin type III domain protein n=4 Tax=candidate division WWE3 TaxID=422282 RepID=A0A0G0W6P0_9BACT  ali  27  754.................................................................................................................................NGAGGIGHYAISSSDVHNIFFASTNDVAYGFSKFTVAPTGITSTYVDNASTTPFTDTFSITASGVTN------------PPPPPVSDTTPPSVPSNLAATAASSSQINLSWSASTDNVGVTGYEVYRNNVKVATVTSTSYNNSGLTSSTSYSFYVKAFDAASNYSAASNTATATTLTVAD-TSAPSTPANLTASVVSATQINLSWSASTDNVGVTGYEVYRNN----VKVATVTATSYSNTGLSSSTTYSFYVKAIDAASNVSAASNTVSATTQATSAPTAPPTLNVALITSTQVNLVWTASTDNVGVTGYDVYRNNIKVATVTSL 1065
40 2.000e-39UniRef50_B2Q0Q0 Chitin binding domain protein n=15 Tax=cellular organisms TaxID=131567 RepID=B2Q0Q0_PROST  ali  45  1.............MRTTFIAISMLFLSMSA--LADNNVLRHGYIDNPPSRAFLCSSMGGNLNKMCGAVQYEPQSVEGPKGFPERGPKDGQIASGGNANFSQLNEQSNSRWHKVNVSSGKNVFSWTLTASHRTTSWQFFITKQNWDPNKPLTRNDFDPFCEQQDRGNVPKNNVRIECNIP-KRTGYQIILGVWTIADTANAFYQVIDANM...................................................................................................................................................................................................................................................... 195
41 4.000e-39UniRef50_A0A0T9R0C8 N-acetylglucosamine-binding protein A n=67 Tax=Bacteria TaxID=2 RepID=A0A0T9R0C8_YERKR  ali  49  2................KIKFLLASITLISSTNIMAQPEPRHGFIESPPSRAFLCSKQGGELNKDCGPAQYEPQSIEGLKGFPQAGPPDGTIASAGNQTFQQLNAQTPYRWHKVNINPGENIFKWSLSAPHSTTSWEFFITKPDWNPNKPLTRADFTPFCSQFDGGANPAKVVAIKCNVPQ-REGYNIILGVWTIANTANAFYQVID......................................................................................................................................................................................................................................................... 192
42 4.000e-39UniRef50_A0A261GH13 N-acetylglucosamine-binding protein GbpA n=2 Tax=Hahella sp. CCB-MM4 TaxID=1926491 RepID=A0A261GH13_9GAMM  ali  44  7..QYTERGFTVNKLNTKKLVLG----CLITLPFIAQDVLAHGYISSPASRSYQCKL---GDNVNCGAVQWEPQSVEGPDRYPETGPSDGKIASAGVSHFSELDEQSVNRWNKLPMQAGSNTFQWHFTANHATRDWRYYITKEGWNPNAPLTRSSFEPFCSYQGNNQRPPTDLTHNCDVPSRN-GYQVILGVWDVGDTVNSFYQVVDVDFGGDNPTDPSPWQ.......................................................................................................................................................................................................................................... 219
43 4.000e-39UniRef50_W0I2T7 Chitin binding protein n=1 Tax=Sodalis praecaptivus TaxID=1239307 RepID=W0I2T7_9GAMM  ali  45  2.................SVLIAMISDTALAANLPVTPARAHGIIDEPKCRAFLCTAEGGALNINCGQVEWEPQSLEGPKGFPDGGPVDGAIASAGNERFAPLDEQSADRWHKEPLKTGNNVLHWRIEVQHRTESWQLYITREDWDPNQPLSRADLRPLYDKSADDDIPPESVTIEYTIPENYSGYHVLLAVWNVADTGNAFYQVIDT........................................................................................................................................................................................................................................................ 197
44 5.000e-39UniRef50_Q2SF82 Uncharacterized protein conserved in bacteria n=3 Tax=Hahellaceae TaxID=224379 RepID=Q2SF82_HAHCH  ali  45  9......................LVLGCLVTLPFIAQNVLAHGYISKPASRSYQCKL---GENLNCGAIQWEPQSVEGPDRYPEGGPADGKIASAGVSHFSELDEQSVNRWKKTPIQAGSNTFMWRFTANHATRDWRYYITKEGWNPNAPLTRNSFEPFCSYDGNNQRPPTELSHECNVPS-RSGYQVILGVWDVGDTVNSFYQVVDVDFGGGGGDPSEPQEW......................................................................................................................................................................................................................................... 206
45 1.000e-38UniRef50_A0A2N0WUB5 N-acetylglucosamine-binding protein GbpA n=2 Tax=Alteromonadales TaxID=135622 RepID=A0A2N0WUB5_9GAMM  ali  45  3............KLHKKLLALSPIAASLL--LPISSTSLAHGYISKPESRGYLCRLN---ENSACGSVVYEPQSIEGRDGFPSAGPADGWLASAGHRAFSQLNQQSINRWTKRHVKAGATEFSWTFTAPHSTKDWRYFITKPDWNPNQVLSRDQFEPFCEYSGHFKQPPRQLTHLCNIPADRNGYHVVLGVWDVGDTPMSFYN............................................................................................................................................................................................................................................................ 190
46 1.000e-38UniRef50_UPI00047E47FD DUF4038 domain-containing protein n=1 Tax=Cohnella panacarvi TaxID=400776 RepID=UPI00047E47FD  ali  24  714.......................................................................................................................................TSFTVNMGRISGTTVTAYWYNPRTGANTLIGDFANTGTRAFTPPSTGVNNDWVLVLDDKA-----KAYPPPGESDVPVPGDTTPPTAPSNLTVISKTNNSVTFGWTASTDASGIDVYDIYRDGVWIAYTQNFQYTDTGLSPNTTYSFTVKAKDAQNWGPLSSPLVVTTNGAPGNDTTPPTAPSNLTAVSKTANSVTFRWNASTDASGIDVYDIYRDGVWIA-YTQNFANLEYTATGLSPNTTYSFTVKAKDKAQNWGPLSSPLVVTTNAASPPTAPSNLTVVSKTATSVTFRWAASTDPSGIDVYDIYRNGVWIAYT... 1033
47 2.000e-38UniRef50_K8WRJ6 Uncharacterized protein n=1 Tax=Providencia burhodogranariea DSM 19968 TaxID=1141662 RepID=K8WRJ6_9GAMM  ali  44  13.................................FSNTIWAHGYVEVPNSRAYLCKL---TANIDCGDIQYEPQSIEGAKGFPALGPEDGEIASAGISSFANLDVQNEKRWIKNIITNSQIMFNWRITARHKTTKWEYFITKSNWNPNQPLTRSQLVEPFCQFHKVEFPNPVVEQHCKLPSENKGYHIVLAVWTIEDTPNAFYQVV.......................................................................................................................................................................................................................................................... 182
48 3.000e-38UniRef50_R1F197 N-acetylglucosamine-binding protein A n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=R1F197_9GAMM  ali  37  10.........................LAVITALLASGGALAHGYISSPEARNTLCK---NGGNIGCGAIQWEPQSLEAPSGFPDGGPADGEIAAAGHAQFAELNAQTSDRWTKRSVSAGPIDISWTFTANHVTRNWRYYLTRQDWDPNQPISRNSFTPFCVIDGGMVQPPKQMTHSCT-LPERTGYQLILGVWEVGDTPNSFYNLIDARFQEGDLPPLTWSQSGTIYP.................................................................................................................................................................................................................................... 209
49 3.000e-38UniRef50_A8GJP3 Chitin-binding domain 3 protein n=4 Tax=Serratia TaxID=613 RepID=A8GJP3_SERP5  ali  45  1...........MELKKIALAVAALTL--------SSGALAHGYVESPQSRAYKCNLQ---ENTDCGAVQYEPQSVEKDSGFPTGPPRDGELASASIPHYSPLDKQSMNMWAKNPIKAGMNTFTWFHTAMHKTNNWRYYITKQNWDANQPLTRAAFEPFCQAEGHGQMPAQRAVHECNVPQ-RSGYQVIYGVWEIADTVNSFYQVIDVDFGGGEGITSPW............................................................................................................................................................................................................................................ 199
50 3.000e-38UniRef50_A0A1J7C690 Chitin-binding protein n=1 Tax=Sodalis sp. TME1 TaxID=1912097 RepID=A0A1J7C690_9GAMM  ali  41  1.............MKKLFIPALALLFSASTFAASYEITPRHGYIQNPQSRAYLCYTMK---NKDCGNVPKDYQSIEGPKGFPAAGPKDGEIASGGNALFDVLNQQSSDRWHHVKLNSGKNKFTWTITKQHATTAMRFFITQENWDPNSPLARADFTPFCQKEFEGALPGDVVKLECDVPS-RSGYHVILGVWDIADTTKAFYQVI.......................................................................................................................................................................................................................................................... 191
51 4.000e-38UniRef50_R2SH15 Uncharacterized protein n=6 Tax=Enterococcaceae TaxID=81852 RepID=R2SH15_9ENTE  ali  28  44..............................................................................NGEFNDGLNDWVVSNPDANNPSLVTDENGNNYVK--ASNGESILQYVQLKPNMTYKFTYYVIGTPGFPAVVEFGTLNHDEGFKSLKEEKTWKQHEFTFVTPEEENTYAIRFA---SSGNGTAYFDNIQATSL-----DLEAPTVPLHLKVESVTTDSVSLSWEPSTDNVGVTGYLIYRDQEEIGQVDGDTYINEGLTADTEYTYEVRAVDQAGNKSEASNAVKA-RTSVAEDTEAPSAPLNLKVTGVTTDSVSLSWEPSTDNVGVTGYLIYRDQEEVGQVDGDT--LTYINEGLTADTEYTYEVRAIDQAGNKSEASNAVKARTSVDTVPMPPTALRAAKVMEDKVVLMWDAPSDPLEISTYQIYRNG......... 407
52 4.000e-38UniRef50_A0A2D1TD73 N-acetylglucosamine-binding protein GbpA n=4 Tax=Pseudomonas TaxID=286 RepID=A0A2D1TD73_PSEPU  ali  43  2..........NTRNKLRTLVASSVWVAIAGAGLHAQLANAHGYTSNPPSRAYACQS---GLNSGCGPAMYEPQSVEGPKGFPQRGPADGKIASGELTSFALLDEQTAGRWHLTPIRDRQVAFDWYYAVGHKTTKWEYFITKPDWNPNVALSREAFEPFCEVDGQGKPAPALEKHQCTLPADRTGHHVILGLWTIDDTAAAFHDVMDVDIQAEGGPAPEWPQ.......................................................................................................................................................................................................................................... 221
53 5.000e-38UniRef50_A0A075R6S4 GlcNAc-binding protein n=15 Tax=Bacillales TaxID=1385 RepID=A0A075R6S4_BRELA  ali  50  1....MTEQCVISKMAKVCVAFGLLVVMIAGAMFIAERVSAHGYVESPTSRAYMCKQ---GKNMNCGPIQYEPQSVEGEGSFPQSGPPDGQITGAG--RYPELYTQTADRWKKVTMHSGENTFQWRLTASHSTREWKYYITKNGWNPNKPLARSDVVPFCYYYDGGNRPGTTVTHTCNVPTDHSGYHLILAVWEIADTTNAFYQVID......................................................................................................................................................................................................................................................... 200
54 2.000e-37UniRef50_A0A090ZSC5 CBP21 domain protein n=6 Tax=Paenibacillus TaxID=44249 RepID=A0A090ZSC5_PAEMA  ali  38  1MTARTFVYRHKSLMKWFVASAGTLFLMLAGSFVFADSASAHGYLTD--SRAHLCS---IGQNSDCGPVKWEPFSVEGRGDFPEFGVPDGQIASGG--KFFELDEQTADRWTKVDMVGGEHTFHWKLTANHSTNTWDYYITKKDWDPDSPLKRADLELFCRYIDDGAIPPIDVYNDCFVPNDREGYHVIVAVWDIADTPNAFYQVMDVNLSINPSAPTTPEPGFP----GDPNRFGKYLIWNPIR--VYNEGEIVVHNGQFWQALWWTR----GQEPGTTGEWGPW.......................................................................................................................................................................... 268
55 2.000e-37UniRef50_A0A2A4DN95 Chitin-binding protein n=20 Tax=Enterococcaceae TaxID=81852 RepID=A0A2A4DN95_ENTHR  ali  24  44..............................................................................NGEFNDGLNHWIVSNPGSNNPALVTDESGNHYVM--ASNGENILQYVQLKPKTTYQFTYYVIGDPSFPALVEFGTLNHGEGFISLKYNDAWKQHEFSFTTPEGENTYIIRFA---SSGNGTAYFDNVQATAL-----DLEAPTNPKNLKVNDVSSDSVSLSWEAATDNVGVMGYLVYRDNQLIQTVTDLAYTDNGLTEDTTYTYEVRAVDQAGNVSVASNA--VTARTKLASSSPPAVPLNLKVTSVTTDSVSLSWESATDSIDVIGYIIYRDNQLIQGVIG-AEEVAYTDMGLMEDTMYTYQVRAVDQAGNISEMSNTVTARTKPTEPPAAPLNLRIDDVTTNSVSLSWQEAIDNVDVASYNVYRDDQVQTLTGT. 416
56 5.000e-37UniRef50_A0A1S1HR84 Aminopeptidase n=4 Tax=Enterobacterales TaxID=91347 RepID=A0A1S1HR84_PROST  ali  48  6..........................LLSVLFCFSTTVFAHGYVENPESRAYLCKLKK---NTSCGAVEYEPQSLEGPKGFPQNGPKDGEIASAGIQGFNALNAQTPSRWIKNTITHPQLTFKWHLTARHATKKWEYFITKPNWNPSQLLARDQLVSTPFCEYNPTHPQTIVTHNCKLPVENKGYHVILAVWSIADTANAFYQVID......................................................................................................................................................................................................................................................... 183
57 6.000e-37UniRef50_A4C6Y6 Chitin-binding protein, putative n=6 Tax=Pseudoalteromonas TaxID=53246 RepID=A4C6Y6_9GAMM  ali  45  1...........MKKLNKLFLAMAPLATLV-SLPFAQTAVAHGYISKPESRGYLCRLT---QNTNCGNVVYEPQSLEGPDRFPESGPADGHIASAGHGAFSQLNAQTISRWTKRPIKAGPNEFTWTFTANHSTRDWRYFITKTTWDPNSPLTRDQFEPFCEYSGHYKQPPRQVTHLCNVPADRNGYHIVLGVWDVGDTGMSFYNVVDLMIDNGDTSNVYWQ........................................................................................................................................................................................................................................... 207
58 6.000e-37UniRef50_UPI00036309DF hypothetical protein n=1 Tax=Spirosoma spitsbergense TaxID=431554 RepID=UPI00036309DF  ali  29 1521..............................................................................TTYSLTGLTAATSYSVYIVAVDAAGNATSSSKLTLTTLATPDTQAPTAPTSLTASDIKTTSSTISWTASTDNVGVKEYRI-SVDAVIRYTTTATTYSLTGLTPATTYTVYVTAADAAGNQTASTAIKITTLA---DSDTQAPTAPTNLTATAITTTGTTISWTASTDNVGITGYKVYLDGNQIATSTATTYSLTGLTPATAYSIYVVAVDAAGNASAASTTFKVTTSAAVADTQAPTAPTNLTTSATTTNSAKLTWTAATDNIGVTQYRIYLNSALK----GTTTETTYSLTGLTPATVYSTYVVAADAAGN................................................................. 1825
59 6.000e-37UniRef50_J2XXE1 Chitin binding domain protein n=80 Tax=cellular organisms TaxID=131567 RepID=J2XXE1_9PSED  ali  45  9.................AMRKLPLAITLGLASLASQQAFAHGYVESPKSRAFMCSATGGNLNRDCGPVTYEPQSVECSGDFTKCGPANGTIPAGGITSFSQLNEQTATRWQKTTIKPGMNEFTWHYSAGHASAYYQFYITKKDWNPNQPLTRDSFEMTPLLNENAGPAGGKTKHKVNIPADRSGYHVILATWKIADTAATFYQAIDVNIDNDGAPIPDW............................................................................................................................................................................................................................................ 227
60 8.000e-37UniRef50_A0A1Y6BF18 Chitin binding domain-containing protein n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6BF18_9PROT  ali  43  5........................ILTALLSGIASQTAFSHGYVAEPFSRGLACRE---GLNEDCGAIVWEPQSIEGEDGFPQFGPQDGSIASAGLQSFAPLNEQSLERWYKTEIEH-HINFRWHFTAPHASKDWRYFITKDHWNPDQPLTRASFDPFCVYEGAMKRPPKSLTHHCMIPESKAGYHVVLAIWDVGDTVNSFYNTIDV........................................................................................................................................................................................................................................................ 185
61 1.000e-36UniRef50_A0A1B8YD51 GlcNAc-binding protein A n=25 Tax=Morganellaceae TaxID=1903414 RepID=A0A1B8YD51_9GAMM  ali  47  1.............MYKHKVKAMTLATTIITALF--NGAWAHGYIDSPGSRVFLCSAQGNEQNTDCGLVKYEPQSLEAKKGFPQAGPEDGHIASAGIGHFGELDIQTEDRWKKIPITAGDIAFQWEIVIQHKTSSWEYFITKPDWDPNKPLTRFNSTPFCFEDYQEKMPGSRVINKCTLPEGYKGYHVILGVWTISDTLNAFYQVIDTT....................................................................................................................................................................................................................................................... 195
62 1.000e-36UniRef50_A0A0U0JK63 GlcNAc-binding protein A n=7 Tax=Bacilli TaxID=91061 RepID=A0A0U0JK63_STREE  ali  95  1MNNRFLKQLQNMKMNKKSLGAVALTAGIISTTLIPQNAYAHGFVEKPGSRSALCSPTYGALNVNCGSVMYEPQSLEAPKGFPQGGPVDGQIASAGGKFGSILDQQTANRWFKN...................................................................................................................................................................................................................................................................................................................................................... 113
63 1.000e-36UniRef50_A0A0Q4NDD7 Multidrug transporter n=2 Tax=Pseudomonas sp. Leaf58 TaxID=1736226 RepID=A0A0Q4NDD7_9PSED  ali  44  1.........................MAITGVGIHAQVANAHGYASEPPSRAYACRL---GLNTECGQPMYEPNSVEAPKGFPLLGPEDGKIASGGRPDFALLDEQSANRWHLTPIRDRVIDFDWFYTTGHKTTKWEYFVTKSGWNPNAPLSRDAFEPFCSVDGHGKPATGGEEHRCTLPADRTGHHAILGLWTVADTAAAFHNIIDVDIQAEGGPAPEWPP.......................................................................................................................................................................................................................................... 206
64 1.000e-36UniRef50_A0A1B1KM66 GlcNAc-binding protein A n=66 Tax=Enterobacterales TaxID=91347 RepID=A0A1B1KM66_SERPL  ali  38  1...........MKLSKIAL--------MMATLTVSSAAWAHGYIEVPESRAYKCKL---GSNTDCGRAQWEPQSVEQISGFPNDTPLDGELASGSVGGFEPLDRQGTNQWALNTIQAGPQSFTWFNKARHKTTNWRYYITKQGWDVNKPLSRESLEPFCVIDGHGLLPDERVVHQC-VVPERTGYQVIYGVWEIADTVNSFYQAVDVNFEDGG.................................................................................................................................................................................................................................................. 193
65 2.000e-36UniRef50_A0A1V0L376 Uncharacterized protein n=4 Tax=Sporosarcina TaxID=1569 RepID=A0A1V0L376_9BACL  ali  48  14....................LLGVMFIMVLTFSFSSQASAHGYVSQPESRALLCKQ---GQNKNCGRIIYEPQSLEAPGNFPAGGPADGKIASANI--FFELDAQSRLRWEKVPMKSGDYQFKWKFTAPHVTGSWEYYITRIGWDTNQPLQRADFQKFCTVDGKKQRPPSEVTHTCKVPE-RTGYHVILAVWNIGDTKNAFYNVID......................................................................................................................................................................................................................................................... 193
66 3.000e-36UniRef50_C7BK22 Chitin-binding protein cbpd viral capsid n=34 Tax=Enterobacterales TaxID=91347 RepID=C7BK22_PHOAA  ali  47  1.............MYKHKVRMMTLATTVTAALF--NGVWAHGYIDSPGSRAFLCSAQGNKQNTDCGLVEYEPQSLEAKKGFPQAGPEDGHIASAGIGHFGALDVQTAERWKKIPITTGDIEFKWEIVIQHKTSSWEYFITKLDWDPNKPLTRFNSTPFCFEDYQEKMPGNKVINKCTLPEGYQGYHVILGVWTVADTLNAFYQVIDTT....................................................................................................................................................................................................................................................... 195
67 3.000e-36UniRef50_A0A1D2XFD2 N-acetylglucosamine-binding protein A n=8 Tax=Vibrionales TaxID=135623 RepID=A0A1D2XFD2_9VIBR  ali  42  1...........MKLFKKSVIAVMLSTL-------SGGALAHGYVSLSEGRAALCQSEGLTINTNCDGVEWEPQSVEGPDGFPEVGPADGKIANAGMARFLNLNEQTAQRWVKQPIQSGSQQFEWTYTAPHPTASWKYYITKQDWDVNSPLTRDSFDPFCEVQGNGELPAGASTAHECSVPDRDGYQVILAVWDVSDTPASFYNVMDVEFEDNGPQLPDWERAGQIIPTM.................................................................................................................................................................................................................................. 222
68 3.000e-36UniRef50_A0A0J7D2U5 Uncharacterized protein n=4 Tax=Bacillus cereus TaxID=1396 RepID=A0A0J7D2U5_BACCE  ali  77  5..................................................................................................................................................................................................................................................................................................................................................................SMKKIATSKTTSYMDKHLVANTTYKYLVKAVDVAGNESEQSETFTTTTQTESALYGAWDAKKAYKKGDKVLYEGKVYEAVQNYQGYGDINWIYALSVWKAV 105
69 5.000e-36UniRef50_A0A2D8RBA4 Chitin-binding protein n=1 Tax=Hahellaceae bacterium TaxID=2048971 RepID=A0A2D8RBA4_9GAMM  ali  49  1.............MTSTTRLTALAFATAVPLLGIAQQVLAHGYVTSPTSRNYACKL---GDNTNCGAIIWEPQSLEAPKGFPQSGPADGKIASAGLAQFSPLDAQSANRWSKQSMRPGQNTFSWTFTANHSTSNWRYFITKPGWNVNAALSRQSFDPFCSVSGNQQQPPKQVNHNCNVPDRN-GYHVILAVWDIGDTTNAFYNVID......................................................................................................................................................................................................................................................... 191
70 5.000e-36UniRef50_UPI0002E88BD0 hypothetical protein n=1 Tax=Bacillus thuringiensis TaxID=1428 RepID=UPI0002E88BD0  ali  68  1MNLKLTSKLERLRKSKKGIGACLLAAGVTAITMIPQSAYAHGFVEKPSSRAALCSQNYGALNLNCGNVMYEPQSLEAPKGFPDGGPIDGKIASAGGLFGGTLDQQTTNRWFKNTIKG.................................................................................................................................................................................................................................................................................................................................................. 117
71 7.000e-36UniRef50_A0A1V0NQD0 Uncharacterized protein n=1 Tax=Lactococcus lactis subsp. lactis TaxID=1360 RepID=A0A1V0NQD0_LACLL  ali  59  2...................................................................................SGPADGRIASANGGLGQVLDNQTSTRWKKTSISTGSNIFTWKYTAPHKTTKWHYYMTKTGWDQNAPLKRSELELIGTINHDGSPATNNLSHTINIPTDRSGYHIVLAVWDVADTSNAFYNVIDVNVNNKNSSSQVFGPF......................................................................................................................................................................................................................................... 144
72 8.000e-36UniRef50_A0A0N9W1S2 Chitin-binding protein n=23 Tax=Moraxellaceae TaxID=468 RepID=A0A0N9W1S2_9GAMM  ali  45  2.............KNNSTLKPYIMTLGMLTSMFSSTQLFAHGYMLQPESRAYACKL---QTNYQCGSIIWEPQSLEGTNNFPQSGPANGKIASAGLAQFSELNSQSQTRWVKRRMPTGENNFTWQFTAPHVTKGWRYFITKPNWNPNAPLTRQSFEPFCTVDGLYQRPQSRVTHRCSIPSDHKGYHVILAVWDIGDTTNSFYNVID......................................................................................................................................................................................................................................................... 193
73 9.000e-36UniRef50_A0A0T9T0H4 N-acetylglucosamine-binding protein A n=24 Tax=Proteobacteria TaxID=1224 RepID=A0A0T9T0H4_YEREN  ali  42  1.............MKYIHANILILTGTLTLSSYFSSLAQAHGYIQSPPSRAYLCYQ---GINHYCGAVQYEPQSVEGYKNFPYSGPEDGRIASAGMYPFSALDTQSPTRWHKTNVHSGTMNLQWQLTATHSTTHWRYYLTKQGWNSSQPLTRASFDPFCQYNDNGRVPNTRVVHQCSLPLDRSGYHVILAAWDIADTNHAFYQVVDINLPH.................................................................................................................................................................................................................................................... 197
74 1.000e-35UniRef50_A0A222FKV7 N-acetylglucosamine-binding protein GbpA n=1 Tax=Bacterioplanes sanyensis TaxID=1249553 RepID=A0A222FKV7_9GAMM  ali  39  2....LLGRRPSMTRSRHWLSSISAGSAIFLSIFSSNNIFAHGYISEPVSRSKLCAT---GVNSNCGAIQWEPQSVEGPDRYPLTGPKDGEIASGGNAGFSPLNVQTSSRWSKTAISGGPIDVEWTFTAPHVSRDFRYFITKPGWNPNEPLTRQSFDPFCSHDGKQQRPANPLRHSCYLPENLSGYHVMLGVWDVGDTVNSFYQVVDLNILKGEQPQW.............................................................................................................................................................................................................................................. 214
75 2.000e-35UniRef50_F5LRG4 Bacillolysin n=11 Tax=Paenibacillus TaxID=44249 RepID=F5LRG4_9BACL  ali  36  507.............................................................................................................................................................................................GANSAQVNSVKAAYAAVGIGSPPPAQDTQAPTAPANLVSTGKTSSSVTLSWSASTDNVGVTGYDVYRGSVLAASVSGTSATVSGLSPSTAYTFTVKAKDAAGNVSPASSPVTVTTSSSPTDTQPPTAPGNLVSTAKTSSSVSLSWSASTDNVGVAGYDVYNGS----TLAATVTGTSATVSGLQGGTSYTFTVKARDAAGNVSPASNAVTVVT-DTGSGAAAWAAYTTYQVNDLVTYQGKTYRALQGHTAMPGWEPANVPALWAVV 769
76 2.000e-35UniRef50_Q8EHY2 GlcNAc-binding protein A n=191 Tax=Proteobacteria TaxID=1224 RepID=GBPA_SHEON  ali  44  1.............MPKLTQLSLVTLALTAGSTLVSQTASAHGYVVSPESRSYACKT---GSNVNCGAVQWEPQSVEGASGFPESGPADGKIASAANGAFSPLDEQSPSRWSKRDIKSGWNDFSWQFTANHVTRNWRYYLTRQGWDQNQPLSRASFDPFCVIDGGMVQPPKLVTHNCYVPEDRSGYQVILAVWEVGDTTNSFYNAIDVNFSSGAVVPGEW............................................................................................................................................................................................................................................ 205
77 2.000e-35UniRef50_A0A0N9IAH0 Uncharacterized protein n=4 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A0N9IAH0_9PSEU  ali  24  571.....................................................IALSWDASTDNVGVTGYEVATVTGASATVDGLTADTEYTFTVLAKDAVGNKSAQSAPVSGKTLASPDREAPSVPQNLKAGNATTASINLTWDASTDNVGVTGYEVF-VNGQSATSVTGAAATIEGLAEDTEFTFTVLAKDAAGNKSAQSAAVKARTLKK--PDITPPSAPTGVRATAVTETSIKLAWDASTDNVGVTGYEVLVNGTPKASGPGTEATIDGLTRGTAYAITVKAKDAAGNVSDPSAEIKVT--TTSKDTEAPTVPGNVRATGTTETAITLAWDASTDNVAVVGYELYNGAANTSVTGTSTTVGG-----LTPDTEYTFTVKAKDAAGNLSAASAPVKAKTKPRTNNEIPYAYTINGKSRIKAANGTVALNGGISV.................. 951
78 3.000e-35UniRef50_A0A0U3EPF0 N-acetylglucosamine-binding protein A n=48 Tax=Proteobacteria TaxID=1224 RepID=A0A0U3EPF0_9BURK  ali  42  8........................ILALIAGLALSAQAFAHGYISAPESRNALCR---SGGNSACGAIQWEPQSLEAPSGYPDRGPADGQIASAGLVQFSALDEQTASRWSKRAVSAGPMSFSWTFTANHVTKGWRYYITKPGWNPNVRLSRASFEPFCQADGGMRQPPKLVTHQCQ-LPARTGYQLVLGVWEVGDTPNSFYNLVDLMFADGGGNPTPPASVW........................................................................................................................................................................................................................................ 204
79 3.000e-35UniRef50_Q0BFT6 Chitin-binding, domain 3 protein n=71 Tax=Burkholderia TaxID=32008 RepID=Q0BFT6_BURCM  ali  39  1...........MRTRTANKTLFTLSPLVAASMFFAQAAFAHGYLSEPPSRSLLCSSAGKIENFNCGSVTYEPQSVEGKQGFPAAGAPDGQIASGGVTQFSELDEQTVDRWKITDIKPGAQKFKWTFTAPHVTKEFKYYLTKQGWNPNAKLTREDLTPFCTIDGGMKKADEIGPHNCTIPSDKKGHHVMLTTWHVGDTAGMFYNVADLNITDDGGATDPGKPSWSNVGS................................................................................................................................................................................................................................... 221
80 4.000e-35UniRef50_A0A244CU14 N-acetylglucosamine-binding protein GbpA n=1 Tax=Pseudoalteromonas ulvae TaxID=107327 RepID=A0A244CU14_9GAMM  ali  42  3.........FRSKMKHINKTLLAMTIAAALLMPLSQTVSAHGYISKPESRGYLCRL---GENTSCGNVVYEPQSLEGPDRFPETGPADGHIASAGHRAFSQLNAQTISRWTKRPIKAGPNEFTWTFTANHSTRDWRYFITKTTWDPNSPLTRDQFEPFCEYSGHYKQPPRNVTHLCNVPADRNGYHIVLGVWDVGDTGMSFYNTVDLMIDNGDTNQVYWQ........................................................................................................................................................................................................................................... 213
81 4.000e-35UniRef50_UPI000D6B7153 N-acetylglucosamine-binding protein GbpA n=1 Tax=Pleionea mediterranea TaxID=523701 RepID=UPI000D6B7153  ali  29  25.......................................AHGYVSSPESRSLLCHER---VNSNCGPIQWEPQSVEGLDRFPETGPADGEIASAGLEQFSQLNEQTISRWSKVDIASGQQSFSWRFTANHASRDWRYYITKANWNPNQPLTRASFDPFCTVDGNYQRPPKQMTHQCYVPE-RSGYHVILSVWDVGDTVNSFYQVIDVMFAGDQPPPEWNDIGDINPVMDLQVGDSVGARFFSEQGEQ--TDLRVDTNIETAQQGDKNSWTHSHLKAGIKNNNGDIVPSNGVFAAVGSNIVRAEIEISPATQQPEFTVTGLASSDIENGSATLSFTASADNV-ISLSAVLYNSSSAEVVSDTAEATSSHSFTLTAAGDYTLVIIAENSDGQREQQSFALVLTEVGDQPFDFVYPQNIQYEAGTRVASDGSIYQCKYPYDGWRVYSPNAN....... 455
82 5.000e-35UniRef50_A0A127Q5Y5 CBP21 n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A127Q5Y5_9BURK  ali  45  4.....................LSSGLAVMLAMAAPLLAQAHGYIDAPKSRAFMCKT---QENAACGAIQYEPQSVEGPKGFPAAGPADGVIAAAGLAQFSELNAQTPTRWKKVALKAGVNDFSWYFTAGHMTQDWRYYITKQGWNPNQKLSRFDLQPFCIVKGGFAPSSNSHTHRCTIPADRGGYHVILSTWNIADTGNAFYQVID......................................................................................................................................................................................................................................................... 188
83 6.000e-35UniRef50_A0A1F9IUU3 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_43_16 TaxID=1797889 RepID=A0A1F9IUU3_9DELT  ali  27 1398.............................................................................TNNYSDTRLIPGTSYSYRVRAMDIAGNYSA--YSSATAMTQADLEVPSTPSNLSATATGASQIALSWSASTDNAGSPGYKIERCTYAQVGTTTTTSYNDTGLMPLTAYNYRVRAHDAAGNNSGYSNIASATT----PADIEPPTAPSGLSAMAASESQINLSWTPSTDNVGVAEYRIERNFTEIATSPTTSYSNTGLVMG-IYSYRVRAYDAAGNTSGYSNTASYTL-----DTQAPTAPTNLTATAVSNSRIDLTWTASTDNLGVDGYYIERSTCTNFIFIGISTTASFNDTGLTARKTYRYRVMAFDAAGYYSTYSNIASATTP.................................................... 1726
84 7.000e-35UniRef50_UPI000A1A245D N-acetylglucosamine-binding protein GbpA n=1 Tax=Burkholderia pseudomallei TaxID=28450 RepID=UPI000A1A245D  ali  44  16.........................LVACASMFFAQHAFAHGYLADPPSRNLLCSSKSGKINFNCGPVTYEPQSIEGKQGFPQAGAPDGQIASGGVKQFSELDEQSVDRWKINDFKPGAHQFKWVFTAPHVTKDFKYYLTKQGWNPNKPLTRDDLTPFCTIDGAGKKADQVGPHNCTVPSDRTGHHVMLATWHVGDTAGMFYNVADLNITSDGGPTDPGKPSWSPVGS................................................................................................................................................................................................................................... 221
85 1.000e-34UniRef50_A0A1X1A722 N-acetylglucosamine-binding protein GbpA n=1 Tax=Pseudomonas putida TaxID=303 RepID=A0A1X1A722_PSEPU  ali  42  3................KGFALSGLWVAVLGAGLHAQVVNAHGHLADPPSRAALCHAKYQHQNVDCGQVQYEPWAVEVVGSFPGAGPADGVIASGGVRDFAALDEQSANRWHLTPIVDRNVQFAWHYEAPHPVKNWEYFITKADWNPNQKLTRASFTPFCRVEGHNQIPNPGTTHSCTLPADRSGQHVILAMWDVGDTDKTFHSVADVDIQLDGGPAPEWPR.......................................................................................................................................................................................................................................... 215
86 2.000e-34UniRef50_UPI000837BB0D chitin-binding protein n=4 Tax=Paenibacillus TaxID=44249 RepID=UPI000837BB0D  ali  38  1MTVQAFAGTHFSRLKMLYVTAGTLFLIFACSLIFANSASAHGYVVD--SRAHLCST---GQNTNCGAIVYEPFSVEGRGDFPEFGVPDGNIASAG--KFLELDAQTSTRWSKVNMTGGEHTFHWKIVANHSTNTWDYYITKKGWDPNSPLKRSDLELFCRYVDDGAIPPDDVYNDCFVPNDREGYYVIVAVWDIADTPNAFYQVMDVNLSKNPSAPTTPAPGFPGDPD----RFGEYLVWNNVR--VYTEGEIVLHNGQLWEALWWTQ........................................................................................................................................................................................... 255
87 2.000e-34UniRef50_A0A268NUK8 Chitin-binding protein n=8 Tax=Bacillaceae TaxID=186817 RepID=A0A268NUK8_BACCS  ali  39  1....MVKEKKWMKCCRAVLLQTVVFGLFAIAG--TEAASAHGYIESPSSRALLCQQ---GTNQDCGAIVWEPQSLEAPKGFPGPSVPDGQIASAG-GLFPKLDEQCSTRWSKVPLTSGTHTFTWHLTAMHSTAKWHYYVTKPDWNPDQPLTRDQFEPFYERHDNGARPGEKVTHEVTIPE-RTGYHVILGVWDVADTANAFYNVIDIDFGPNDGTPGEPSPPDPAPAYPEWNAGTVYLGGDRVTYEGRAYEARWWTQGERPGTAEVW............................................................................................................................................................................................ 259
88 2.000e-34UniRef50_A0A1F9IVW8 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_43_16 TaxID=1797889 RepID=A0A1F9IVW8_9DELT  ali  26 1011..................................................ANQIDISWTASTDNVGVAFYDVEACYGATGVTETNYSMWWLNPSTTYQFRVSATDVDGNVSRYSNIATATTPPPTPPTNLTATTAGMTQIYLSWIISTDDVGVAQYAITYFPITEWSSNYYDNYSDMGLIPRTSYSYRVQAMDAAGNKSDFSNVASATTQ----PDPESPTAPTGLVASPISSSQINLAWNASTDNVGVTGYSIERCYAQIGTATETGYSDTGLPPGTDYSYRVRAYDVSVNNSDYSAPASAT--TLIVDTQAPTTPTNLTATAVSKSQVNLTWTASTDDVGVTGYEIERCTGLTCTLLTTVTGTSYSNTGLTGLTAYRYHVRAFDAAGNKSDFSSIATVSTP.................................................... 1388
89 3.000e-34UniRef50_A0A2X2C7G2 Chitin binding protein n=1 Tax=Proteus mirabilis TaxID=584 RepID=A0A2X2C7G2_PROMI  ali  48  1...........MKKNKLMLFTATLLLSSAISTASADVTLKHGYIDIPPSRAFLCSSKGGNLNKNCGPIQYEPQSIEGDKGFPKGGPADGEIASGGKATFSALNAQSADRWHKVAMKSGENTFKWTLTAKHSTESWRFFITKPGWDVNKPLTRADFDLT......................................................................................................................................................................................................................................................................................................... 149
90 3.000e-34UniRef50_E6TYG9 Chitin-binding domain 3 protein n=2 Tax=Bacillales TaxID=1385 RepID=E6TYG9_BACCJ  ali  39  36...................................ESASAHGYVEN--SRAHLCAE---GVNTDCGRVIYEPFSVEGRGDFPHEGVPDGQLASAGL--FLELDEQSYDRWEKVDMQGGPFTFEWHIHANHSTNTWDYYITREGWNPNEPLARADLELFCTYRDYGALPPDHVTNDCVIPNDRDGYHVILAVWDIDDTMNAFYQAIDVNLSINPS-EPSTPEPGFPGDPDRFGEYDYWNTIKAYT-----EGDIVIHNGQLWEARWYSRNDEPGTNPNGPW............................................................................................................................................................................... 267
91 4.000e-34UniRef50_A0A193D2K6 Uncharacterized protein n=1 Tax=Bacillus thuringiensis serovar coreanensis TaxID=180843 RepID=A0A193D2K6_BACTU  ali  47  21...................................GPSLQHGLVESPLSRAAKCECSYENAYNRCGDVINNSGGLEAEKGFPERGPRNGQIASAGREFARVLDEQTAERWWKNPLSTGEQEFIWHLHAPHSTDKFEYFITNPNWDPNQPLARSSFTPIKTEYYYGAVPPTRISHTVPIPNYYCGYHIMLAVWTVADTPNAFYNVIDLC....................................................................................................................................................................................................................................................... 200
92 4.000e-34UniRef50_UPI0009F95F30 hypothetical protein n=1 Tax=Bradyrhizobium manausense TaxID=989370 RepID=UPI0009F95F30  ali  37  90......................SALLGGAASLFVVASALAQGRLTEPASRVVLCAEHR---NKDCPIDLQRASSMESGKFFPAAPPEDGHIAGSSVRGDVPLNEQTPTRWEKIVLRPGKQKFKWEYGAVHLTRRWNYFITRMGWNPSSPLTRAQFEPFCTVQNPGQPPPEPTEHMCDLP-KRTGYQVILAVWEIASSPMAFYQIVD......................................................................................................................................................................................................................................................... 299
93 5.000e-34UniRef50_A0A0M9GJG5 Uncharacterized protein n=24 Tax=Pseudomonas TaxID=286 RepID=A0A0M9GJG5_9PSED  ali  38  2...........MRKRSGSVAAGMSSLAMLTALVASQQAAAHGYLSNPPSRAYACQQ---GLNKDCGNAQYEPQSVAGSGGGPLQGPIDGKIASGGSASFSALDAQSATRWSLSEIKDRDIEFTWDYTAAHPATKHEYFITRAGWNPNQPLTRASFDPFCEVDGRNELPVSGARHACSIPSDRTGQHVILGIWTVGDTAAAFYNVADVNILPEAVTPDGWH........................................................................................................................................................................................................................................... 217
94 6.000e-34UniRef50_I6T6Q6 Chitin binding protein n=118 Tax=Terrabacteria group TaxID=1783272 RepID=I6T6Q6_ENTHA  ali  53  2.............KKSLVVGLGLVLATTGLTALSTVNVDAHGYVEKPISRAYQGELDWHAALEKYGEIITEPQSLEAPKGFPNGGPADGKIASANGAKGFELDKQTATIWTKQNLSTGPTKFTWSYTAAHKTAKWHYYITKNNWNPNKPLSRDEFQFIGEVDGHGKDADTNLTHTITIPSDHLGYHVILAVWDVNDTSNAFYNVID......................................................................................................................................................................................................................................................... 198
95 6.000e-34UniRef50_D2U1F1 N-acetylglucosamine-binding protein A n=2 Tax=Arsenophonus TaxID=637 RepID=D2U1F1_9GAMM  ali  41  1...........MKNN-FLLILFILIVVTAFSSVSSNRESMHGFIYTPKSRSVLC---WIEQNKDCGSASSDPMSIEGTSGFPQYGAKDGRIASGDNFWFNQLDQQNIDRWQKNNIKVGKNIFEWFLTQPNHTISWEFYITKQDWDPNAPLTRNSFEPFCLRSNDGKRLTVDEMKIECHVPKRSGYQIILGLWTIADTDSAFYQVIDVN....................................................................................................................................................................................................................................................... 195
96 6.000e-34UniRef50_A0A193QKF1 GlcNAc-binding protein A n=16 Tax=Bacteria TaxID=2 RepID=A0A193QKF1_SODGM  ali  44  16........................................HGQIANPESRAAKTH-QWWANALESGKFFPEIQSKYAPTDIPNQKPPDGKIASAGLAGAEKLDEYGENRWEKNEIKSGAIDFTWTYTAVHRTRRWNYFITKDNWKPNEPLSRAQFEPFFMVQNDKQPPNNPTIHKVKMPN-KKGYHIILGVWEIADTGNAFYQVVDVNF...................................................................................................................................................................................................................................................... 197
97 7.000e-34UniRef50_A0A2C8F1H6 GlcNAc-binding protein A n=25 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A2C8F1H6_9PSED  ali  38  12...................TGCVSSLTLMAAMFASQQVAAHGYMDSPPSRAYACQQK---LNADCGPAEYEPQTVEAPKGFPALGPADGKIASGENALFAAMDAQSPDRWHLTEINDRNTAFSWFFTAAHKTTKWEYFITKTGWNPNLPLARDAFEPFCTVEGGGAVPIDGAAHACTIPGDRSGHHVILGTWTIDDTGATFYDVVDVNITAESEYEPDPDGWKR....................................................................................................................................................................................................................................... 225
98 9.000e-34UniRef50_UPI00099D354D N-acetylglucosamine-binding protein GbpA n=1 Tax=Pseudomonas synxantha TaxID=47883 RepID=UPI00099D354D  ali  45  12....................LLPLTLTVGITALCSQLAFAHGYIETPKSRAYLCNAAGGLQNTGCGPVAYEPQSLECTGDFSLCGPADGAIPSGGVTRFSQLNEQTANRWHKVDITPGPHEFVWKYEASHATRYWQFFITKKDWNPNEPLTRAAFEMQPTQNWNGSVPGGTTRHVVNIPDDHSGYHVILATWKVDDTDATFYQVVDLNIQNAQIPVSAW............................................................................................................................................................................................................................................ 234
99 1.000e-33UniRef50_UPI000B539F4B hypothetical protein n=2 Tax=Enterococcus hirae TaxID=1354 RepID=UPI000B539F4B  ali  24  178..........................................................................................................................APTNPKNLKVNDVSSDSVSLSWEAATDNVGVMGYLVYRDNQIQTVTDADLAYTDNGLTEDTTYTYEVRAVDQAGNVSVASNAVT---ARTKLASSSPPAVPLNLKVTSVTTDSVSLSWESATDSIDVIGYIIYRDNQLIQGVEEVAYTDIGLMEDTMYTYQVRAVDQAGNISEMSNTVTA-KTKPTEEILPPAAPLNLRIDDVTTNSVSLSWQEAIDNVDVASYNVYRDDQLVQTLTGT--DLTYIDTGLMEDTTYTY........................................................................... 433
100 1.000e-33UniRef50_A0A135W7T9 Uncharacterized protein n=1 Tax=Chryseobacterium kwangjuense TaxID=267125 RepID=A0A135W7T9_9FLAO  ali  23  209..........................................................................................................................APATPTGLAAHNITSTTAQITWTAQPDAASY----IVFRNNQQVQEVNGTSFQDQGLTPNTAYSYKVQAKSASGLASSAQSAALNIQTSAANTIEKPTAPTHLHSMGA-TAHSVSLMWGPSTHSQGIQHYEIFQHGVKVAQTTTTQYNVTGLSADTQYKFTVKAVSQNNISSDPSNELTVKTNQDTGTAEKPTAPTNLHAMGTTVNSVSLMWSSSTHPQGIQRYEIFQHG----VKVAQTTATQYNVTGLSADTQYKFTVKAVSQNNISSDPSNELTVKTNQNTGTGQIYCGSEVYNAANA................................ 500
101 1.000e-33UniRef50_UPI0008A2981E chitin-binding protein n=1 Tax=Morganella sp. HMSC11D09 TaxID=1581087 RepID=UPI0008A2981E  ali  43  1.............MMKKTAFAGILFC------LLTSQAFAHGYITEPASRAANCKTGKNPAHM-CGAVQWEPQSIEALSGYPEGYPPDGQLASGGIERFLPLDVPR-DNWHQMTVKPGTTMFTWKITAAHKTRNWRYYITRPDWQPGTPLTRASFEPFCSYDDKNQVPPQTVTHQCTI-PERSGYQVIYGVWEFADTANSFYQVIDVRF...................................................................................................................................................................................................................................................... 190
102 1.000e-33UniRef50_A0A1S6HWI3 Uncharacterized protein n=1 Tax=Shewanella psychrophila TaxID=225848 RepID=A0A1S6HWI3_9GAMM  ali  43  7......................LIRLVTVSSLLASTGVMAHAYISTPGARGYMCQL---GKNSDCGPVQYEPQSLEAPKGFPQLGPVDGKIASAAQGNFSELDEQTPLRWTKNKMEAGPMTMTWHYKAKHKNQGFEYYMTKQSWDPSKPLTRDSFTPFCSIAGDGQLTQDDMSHECTV-PERSGYQIILGIWSVADTANAFYNVVDVTFDDATPADWSQAGTIY....................................................................................................................................................................................................................................... 208
103 2.000e-33UniRef50_UPI0008270B3C hypothetical protein n=1 Tax=Formosa haliotis TaxID=1555194 RepID=UPI0008270B3C  ali  23  24....................................................................QSNAASITNEANTTTGWVGAGNITSSSNNPHSGNFSLSVSRTGVNGRDAGYTF------NAVIGQIYTISIWARLGDSNFQPAFANWVGLNGFNTTLINSNNWTEYTWTVTATNSNPQIRVYAAPYSGGQIGNEVLLDNVNIQLL--DETPPSIPAGLVSSNITSNSLDLSWSVSTDNVGVTDYEVFMDGISQGSSGLLTQSITGLSPNTSYSFTVLAVDGSGNRSGQSTGLTVTTLELL-DEVPPSIPTGLVSSNITSNSLDLSWSASTDNVGVTDYEVFMDGISQGLSSG---LLTQSITGLSPNTSYSFTVLAVDGSGNRSGQSTGLTVATLDETPPSIPIGLVSSNITSNSLDLSWSASTDNVGVTDYEVFMDGISQGLSG.. 400
104 2.000e-33UniRef50_Q9KLD5 GlcNAc-binding protein A n=570 Tax=Vibrionales TaxID=135623 RepID=GBPA_VIBCH  ali  39  1...........MKKQPKMTAIALILSGISGL------AYGHGYVSAAEGRVTLCKFAANGTNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDDLNPFCVVEGNMVQPPKRVSHEC-IVPEREGYQVILAVWDVGDTAASFYNVIDVKFDGNGPVLPDWNPAGQIIPSMDLSIGD--TVYTRVFDNDG............................................................................................................................................................................................................... 238
105 2.000e-33UniRef50_A0A1C5EDF1 Chitin-binding protein n=2 Tax=Streptomyces TaxID=1883 RepID=A0A1C5EDF1_9ACTN  ali  40  1.............MRKKASAAVIGLAIAGVSVLATTSASGHGYTDSPISRQKLCA---NGTVTNCGNIQWEPQSVEGPKGFPAAGPADGKICSGGNGQFAQLDDPRGGNWPATQVTGGQYNFRWQFTARHSTSDFRYYITKDGWDSTKPLTRAALEPFMTVPYGNQQPPATLTHQGTIPTH.................................................................................................................................................................................................................................................................................. 168
106 2.000e-33UniRef50_A0A1H8K2D8 Chitin-binding protein n=7 Tax=Pseudomonas TaxID=286 RepID=A0A1H8K2D8_9PSED  ali  41  1...........MKTNHKVLTGFACSLVMLSTVGTSQGAFAHGYLEVPPSRALLCQR---GENKNCGGAQYEPQSTNGAGGAPLQGPVDGKIASGGNPLFSALDAQSATRWNLTELRERNIAFQWQYTAAHPATRHEYFITRDDWKPNEPLKRVSFTPFCTVEGAHQLPEAGAKHHCVIPDSKSGHHVILAVWTVGDTDNAFYDPADVN....................................................................................................................................................................................................................................................... 207
107 2.000e-33UniRef50_A0A1L5PZC0 N-acetylglucosamine-binding protein GbpA n=17 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A1L5PZC0_PSEPU  ali  42  1........MNTRKTLRKSVVATGVWMAIVGAGLQAQIANAHGYLADPPSRAALCHAGFKNLNVNCGGAQYEPWSVEVIGRFPSQGPENGKIASGGRSDFAALDEQSANRWHLTPVVDRNMQFDWHYEAPHPVRSWEYFITKADWNPNAALTRDSFDSTPFCALDGSGTGTNPRHSCTLPADRSGQHVILAVWKVGDTDKAFHSVADVDIQLDGGPVPEWPR.......................................................................................................................................................................................................................................... 221
108 2.000e-33UniRef50_A0A0Q4N2S2 Uncharacterized protein n=2 Tax=Erwinia TaxID=551 RepID=A0A0Q4N2S2_9GAMM  ali  39  15....LQRMFFIMKLSKVALA--------VSALLISGSALAHGYISNPPSRDYMCKLNND---QSCGGVINEPQSVESEKGFPKPGPPDGQLPSGGKYLGQPLDVQTPVRWEKNSMHAGKNNFTWTFTAEHNTTDFKYFITKQDWDQSSPLTRDSFEPFCVVPMGGQLPGTEVTHECDV-PERSGYQVIYASWEVDNTAMSFYKTIDADFGNEVPSIWEN............................................................................................................................................................................................................................................ 228
109 3.000e-33UniRef50_A0A1B7KA53 Chitin binding protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1B7KA53_9GAMM  ali  48  1.............MNRKLQALISTSVLTAGVMFYCQASYAHGFVTSPPSRSYQCQL---GVNSNCGPVQYEPQSIEGPQGFPSGGPADGHLASGGKANFSALDSQSPTRWVKTSIKSGENTFVWNLTAQHKTTSWKYYLTKSGWNNTKPLTRADFNPFCEFNDGGALPPQTVTHKCTIPTGNTGDQVILAVWNIADTSNAFYQAID......................................................................................................................................................................................................................................................... 192
110 4.000e-33UniRef50_A0A0A1MW80 GlcNAc-binding protein A n=13 Tax=Bacillaceae TaxID=186817 RepID=A0A0A1MW80_9BACI  ali  48  34........................................HGYIEQPKSRGLLCNE---QVNTNCGGVQWEPQSLEAPKGFPGVSISDGEIASAG-GVFPELDEQTSDRWEKVDLNSGVNTFTWHLTAMHATTKWHYYITKPDWNPNEPLTRDQFEPFYEVYDGGARPGEKVTHQVTIPE-RTGYHVILGVWDVDDTANAFYNVIDVDFDGDGTEQDPEESEPEVPNYPVWEANAVYLGGDKVIYNGKVFQAKWWTSGET................................................................................................................................................................................................... 250
111 5.000e-33UniRef50_A0A1B2M1P0 Uncharacterized protein n=1 Tax=Acinetobacter larvae TaxID=1789224 RepID=A0A1B2M1P0_9GAMM  ali  45  12........................IMGVLAFALIPSETLAHGYVMKPESRSYACKLNK---NAQCGTIIYEPQSLEGGNNFPQAGPADGKIASAGLSQFAQLNQQSPTRWSKSNITNGSYDFVWYNTTMHATKSWRYFITKNGWNPNVPLARSAFEPFCLVNGYGRQPASQVTHRCQIPGDRSGHHVILAIWDVADTVNAFYNTIDVNIGSSTSVPPSTAVPTIWTDIGDI................................................................................................................................................................................................................................ 217
112 8.000e-33UniRef50_A0A172ZD68 Chitin-binding protein n=9 Tax=Bacilli TaxID=91061 RepID=A0A172ZD68_9BACL  ali  49  1...........MKLRKTLTAVVAASTCMMIL---STSVFAHGYISQPASRAYKGSNA-VGLNTNVGSAQYEPQSIEAPKGFPNAGPGDGKIASGALAGFAPLDDQTATRWHKTDIKTGALNITWNLTAQHATSGWQYYMTKPGWNPNQPLTRSSLERIAYIDDKGAKPAKTVSHTINVPSDRSGYHVILGVWDIYDTGNAFYQVID......................................................................................................................................................................................................................................................... 191
113 1.000e-32UniRef50_A1JQE6 GlcNAc-binding protein A n=25 Tax=Yersinia TaxID=444888 RepID=GBPA_YERE8  ali  45  1...........MKLNKIMLAMVV--------MSISGTAMAHGYIENPPSRNFLCNAQGGSLNKDCGGVQYEPQSSETADGFPQQGPVDGKLASGDNWVSVNLNQQTAERWTKVKMKAGPQEFKWKFTAAHPIADFKYYMTKQDWNPNQPLTRDDLTPFCVIPGGPASTTGSTTHTCNIPE-RTGYQVIYGAWDVSDTPGTFYNMID......................................................................................................................................................................................................................................................... 189
114 1.000e-32UniRef50_A0A2D7MSN9 Uncharacterized protein (Fragment) n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2D7MSN9_9FLAO  ali  24  12...................................................WTASTDNVGVTGYNVYVGGTLDGTTTATSYSLTGLDPATTYSVAVEATDAAENTSTQASIDVTTLSPPDEEDPSAPADVSASNVTDSSADITWTASTDNVGVTGYDVY-VDGTIDGTTTSTSYSLSGLSPETSYSVAVRAKDAAGNESVEGSTSFTTGAF---VDSEAPTQPTNLSSSNETTTSADITWTASTDNVGVTGYNVYVGGTLDGTTASTSYSLTGLDAATTYSVAVEATDAAGNASTQASIDVTT--STPPDEEDPSAPTDVAASNVTDSSADITWTASTDNVGVTGYDVYVDG----TIDGSTTSTSYSLSGLSPETSYSVGVRAKDAAGNESVEGST-SFTTNQTQNCQEQLIDSEDFESGWGIWNDGGS......................... 379
115 1.000e-32UniRef50_A0A1K3L328 GlcNAc-binding protein A n=18 Tax=Bacteria TaxID=2 RepID=A0A1K3L328_MYCTX  ali  41  1.............MMKKTVFAFTLSC------LLASPAFSHGYITEPASRAANCKTGKNPAHM-CGAVQWEPQSIEALSGYPEGYPPDGQLASGGIERFLPLDVPR-DNWHQMTVKPGTTMFTWKITAAHKTRNWRYYITRPDWHPGESLTRASFEPFCFYDGKNQIPPQSVTHQCNI-PERKGAQIIYGVWEIADTANSFYQVIDVRF...................................................................................................................................................................................................................................................... 190
116 1.000e-32UniRef50_D2TZP8 Chitin-binding protein n=1 Tax=Arsenophonus nasoniae TaxID=638 RepID=D2TZP8_9GAMM  ali  51  34........................................HGYIDFPSSRAYLCSL---GKNGNCGQVMVEPQSVEGRKGFPRRGPADGKIASAGHRWFGELDEQSATRWTKVDVSPGKNTFHWTLTAPHRTTGWEYFITKQDWDPNAPLVAIINYH.......................................................................................................................................................................................................................................................................................................... 147
117 1.000e-32UniRef50_UPI000A1E1222 hypothetical protein n=1 Tax=Pseudomonas TaxID=286 RepID=UPI000A1E1222  ali  33  23........................................HGAVASPASRAYFAEKQGLIE----GNLQY---GIEWGKFFPAAPPVDGKIASGERPMAAYLDR-TDIDWQKHKVYGGELDFVWEFSARHKYRRFNYFITRVGWDPSQPLSRAQFEPHWAYTDEEMWPANPTTHTLTLPM-REGYYVLLGVWEIAETDKAFYQVIDLDFLPG-GEQPEGPEAPTELHDMGTTETSVDLMWAHPANSAAIVGYFIYRDGNQVGCVPVTTFTDDNLTPDSSYRYTVKAFDAEHRLSASSNVHNARTKPSEGGGEYEDWKLN........................................................................................................................................ 323
118 1.000e-32UniRef50_Q39P41 Chitin-binding protein n=67 Tax=Bacteria TaxID=2 RepID=Q39P41_BURL3  ali  41  35...........................................LTEPPSRIVLC---TQGQNPDCPVDAWHANAMENGKFFPAAPPIDGEIAGASTNGPPVLNEQSPGRWQKIPLRPGAQNFKWEFSAVHKTRRWNYFITRADWNPSEKLTRAQFEPFCTIQNPGQPPQQPTIHQCRLPM-RSGYHVILAVWEVADTAMAFYQVVDATFTH.................................................................................................................................................................................................................................................... 228
119 2.000e-32UniRef50_A0A024Q7M2 GlcNAc-binding protein A n=13 Tax=Bacillaceae TaxID=186817 RepID=A0A024Q7M2_9BACI  ali  41  9...............KTLKITLGALIMLLCSVAFANSVSAHGYVNNPESRNLLCA---DGANYDCGAVIYEPQSLEAPGNYPEGGPPDGKIASANI--FHELDAQSEDRWAKVPMSSGAFTFEWTLTAAHATDKWEYYITKEDWDPNDPLERSDFERFCSIDDNGDRPPFTVNH-DCVIPDRIGYHVILAYWEVADTANAFYNVIDANFDGEYVEPGDPGTGEPDP-----GEPSDAPAWDANETYLG--GDQVTYNGNIYEAKWWTQ........................................................................................................................................................................................... 248
120 2.000e-32UniRef50_A0A2R3INH9 GlcNAc-binding protein A n=33 Tax=Pseudomonas TaxID=286 RepID=A0A2R3INH9_PSEAI  ali  44  25.................................SSQQAFSHGYVESPKSRAYMCNAKGGNLNANCGAVTYEPQSIECPGDFTQCGPADGTIPAGGLNNFAPLNEQTATRWQKTTLKPGLNEFRWRFTAGHASAYYQFYITKKDWNPNQPLTRDSFELKPLLNQDAGGSGSSKSFNVNIPGDRSGYHVILATWRIANTSATFYQAIDVNIDNNAVPPSEWT........................................................................................................................................................................................................................................... 228
121 4.000e-32UniRef50_A0A2G5X8R1 Chitin-binding protein n=2 Tax=Sporosarcina TaxID=1569 RepID=A0A2G5X8R1_9BACL  ali  30  29...................................NQASAHGYVSQPESRALLCKQ---GDNKNCGKIIYEPQSLEAPGNFPIGGPADGKIASANI--FFELDTQTRLRWQKVPMKKGPNQFKWKFTAPHVTASWEYYITRTGWDTNQPLKRADLQKFCTVDGKKQRPLSEVKHTCNIPE-RTGYHVILAVWNIGDTKNAFYNVIDADFGGKQALPTEPDKTVDMIPLTP-SKPSLAPETQPSPDKDKPTQPAVKWDQGIVYVEGDQARFEGSLYEAKWWTRGDLPGDSAVWKLLESSTSEIRDWKMKNVYTV--GNQVLHEGIVYEAQWWTSGDTPGENADVKKWEVYLVGNQV----------------LYNNDLYEAK---WWTRGDLPGDSAVWTLV-KSAATGVPQWRTTNVYVTGDHVMYNGNLYEAKWWTRANV.............. 418
122 4.000e-32UniRef50_UPI0009946C74 hypothetical protein n=1 Tax=Bacillus cereus TaxID=1396 RepID=UPI0009946C74  ali  71  1MNNQILNCFKTISKRKKGLSVAILAIGILSTTLIPQNAYTHGFVEKPGSRAALCSPDYGALNVNCGDIMYEPQSLEAPKGFPQGGPIDGEIASAGGKF..................................................................................................................................................................................................................................................................................................................................................................... 98
123 5.000e-32UniRef50_A0A1L4BQJ0 Chitin-binding protein n=1 Tax=Francisella sp. TX077310 TaxID=573570 RepID=A0A1L4BQJ0_9GAMM  ali  37  1...........MKLKKITILTGL-------ALLATSQAYSHAYVQTPKGRPLLCNER---VNQGCGNILYEPQSFEVADGSFENGSMGDQVGGAGLS--ASLSEQTSSRWAKTVVKSGPTTFRWHFTAQHWTASFRFWITKPDWNPNMPLSRSDFNPIPNFANSMPGDSNSFTVTCDLP-DRSGYQVIAAEWNVGDTAASFLNVIDVDFTSDHP................................................................................................................................................................................................................................................. 203
124 6.000e-32UniRef50_A0A0A3YP12 Uncharacterized protein n=1 Tax=Erwinia typographi TaxID=371042 RepID=A0A0A3YP12_9GAMM  ali  40  3......................LKILALAVSALTVTGAWAHGYIQEPASRAYQCKL---GQNLDCGNVTWEPQSVEQGSGFPSTLPLDGELASASIPTFSQLNRQSMDAWAKTPIKAGKQKFTWNHTAPHKTTSWTYYITKQDWDANKPLTRGAFEPFCTVQGNNKVPEHITTQECNVPE-RTGYQVIYGVWRIADTANSFYQVIDVDFGGKDNDQNQAPVENEWKQVDGVIY.............................................................................................................................................................................................................................. 212
125 6.000e-32UniRef50_A0A1V1ZHN5 Uncharacterized protein n=2 Tax=Mangrovimonas TaxID=1211036 RepID=A0A1V1ZHN5_9FLAO  ali  21  26...........................................................................NAASILNEADATTGWNSNANITSSTDNPFSGNFCLRVVATGLSARDMSYTFNA-VVGQQYQISIWARQGDFSFSPAFANWTGFQGFSTTVITGTTWTEYNWTLTATNTSPLIRVYTAPISG--WQVGHEVFVDNVSILLLDSESPSSPTNLNSSNVTATGLDLGWTAATDNIGVVDYEVFQDGQSIGSGGALSFSVGSLTANTQYGFTVVALDAAGNASSESTELLVTTLSS-SDSTAPTAPTNLNSSNITASGLDLGWSASTDNVGVVNYEVFQDGQSIGF---SGGALSFSVGNLTANTQYGFMVVALDAAGNASSASTELLVTTSDSTAPTAPTNLNSSNITASGLDLGWSASTDNVGVVNYEVFQDGQSIGFSG.. 400
126 6.000e-32UniRef50_UPI0007C1D22C LPXTG cell wall anchor domain-containing protein n=1 Tax=Enterococcus hirae TaxID=1354 RepID=UPI0007C1D22C  ali  28  1..................................................................................................................................................................................................................................................................................MEDTMYTYQVRAVDQAGNISEMSNTVTA-KTKPTEEILPPAAPLNLRIDDVTTNSVSLSWQEAIDNVDVASYNVYRDDQLVQTLTGT--DLTYIDTGLMEDTTYTYIVKAVDPSGNLSEASNAVTARTKSATPPTPPLNLRIDDVTTNSVSLSWEAAIDDVGITGYHVYRDDQVQTLSGT. 181
127 7.000e-32UniRef50_A0A2A7V127 Uncharacterized protein n=1 Tax=Enterobacter agglomerans TaxID=549 RepID=A0A2A7V127_ENTAG  ali  31  1...........MKITKIAFA--------VATLMVSAGSWAHGFVMDPPSRAFLCQDIKGELNKGCGSIQYEPQSLEAPKGYPASGPKDGQIASANQTRGPEMDETGASRWVKTEISAGQNQFKWYFTSPHATNKYEYYITKNDWNPAQALTRASFESTPFCTANGERPGMGASVVHTCNVPREGYQEILAIWTVEDTTNAFYNIIDVEFAGHNQTPDDDSGIVTPPPVVPDEPGDD----TPPGDNE-------EEHAAPVIHVAQSHIVVEKSAVNAGYAMDASATEGATMF----KWERITGGDAFQMQTHSGAPTFTTPQQGKDLNTMRAWVRA-NATGVAQYRVTASNAHGSVSKVI-----------------TLEVKNTDNGG--------------VQDPSVPAFTIRTAYKIGDKVSYKGHIYVCLNAHTSFEHWNPAEAHSLWRKV 400
128 8.000e-32UniRef50_UPI000A065D5A hypothetical protein n=1 Tax=Desulforegula conservatrix TaxID=153026 RepID=UPI000A065D5A  ali  29  98......................................................................................................................................................................................................................................VSPGRVALSWPAASDNTGVARYRIYRNGSMMAESGGTSYIDTAIPDPGNYCYAVSAIDEAGNESEQSRSTCV-DVPPQPDTEPPSVPSGVSAS-VTDSGVKITWAASIDNKTVAGYRVFRNG----VKISEATDTSLSDSSVLPETRYCYTVSSFDASGNESAKSVESCVDSPAARDVQPPSVPANLRLVSSASSLSWSASSDNVAVAGYKIYKNGAHHATVTS. 317
129 9.000e-32UniRef50_V5AVX3 CBP21 domain protein n=4 Tax=Enterobacteriaceae TaxID=543 RepID=V5AVX3_ENTCL  ali  38  6........................IGLAVITLCMAGGALAHGYVSLPASRAYMCNANMGYQNKECGSPLYEMQSVEGPDGFPVAGPADGHLASAGLASMGRLDEQNETRWAKHPINAGKHAFTWTYTAPHKTKSWDYYLTKSDWDPAKPLTRASFEPFCHIDGKNIQPSTGPDLHECTVPEREGYHVILAAWDVADTGATFYNVIDVDFGGHNAPAPAPDEDPQSDLPAQWHNDTVYVGGDRVTFNGKEYQARWWTKGNL................................................................................................................................................................................................... 247
130 9.000e-32UniRef50_UPI00037D4912 N-acetylglucosamine-binding protein GbpA n=2 Tax=Psychromonas TaxID=67572 RepID=UPI00037D4912  ali  46  13...............HRVTSLGLCKLGPVLLLVSSAGVSAHGFIDGTESRADLCAGWDNPPNGNCGAIRDEPQSLEAIDGFPNGGPVDGQIASANQVRGGELDVQTADRWVKNPITAGQNSFEWKKTAAHTTAEWRYYITNQDWNVNEALSRDSFTPFCTVDGGMVQPPTRVVH-DCGVPQRTGYQVILAVWEVGDTVNSFYNVIDVQFEDSPAPPVP............................................................................................................................................................................................................................................. 222
131 1.000e-31UniRef50_UPI0003551119 N-acetylglucosamine-binding protein A n=1 Tax=Pseudomonas sp. CF161 TaxID=911241 RepID=UPI0003551119  ali  45  1....................................................................MYDAQSVEYGKAFSVCGPQNGHIASGGIQTYNQLDEQTSTRWTKTTIKPGMNDFSWRYRAGHATGFHQFYITKKDWNPNKPLTRESFELTPLLHQEGNPTNKTSTHKVNIPADRAGYHIVLAVWHVSDTYATFYQPIDVIIDNDGVPVSQWNQIGNVEAALEVGDTVSTRVFTASGD.................................................................................................................................................................................................................. 196
132 2.000e-31UniRef50_A0A1S8YQH9 Uncharacterized protein n=2 Tax=Izhakiella australiensis TaxID=1926881 RepID=A0A1S8YQH9_9ENTR  ali  47  1...........MRINKVAVA--------VATLLVSTAAWSHGFVMDPPARALLCKNVSQALNKGCGNIQYEPQSLEAPKGYPADGPKDGQIASANQTRGGEMDATGMNRWVKTDISAGKHQFKWFFTAPHPTTKYEYFITKNNWNPNQPLTRASFEPFCTIQENGGRPGVGASVVHTCDVPREGYQEILAVWTVNDTSNAFYNVIDV........................................................................................................................................................................................................................................................ 198
133 2.000e-31UniRef50_A0A0M3UEY4 Multidrug transporter n=7 Tax=Pseudomonas TaxID=286 RepID=A0A0M3UEY4_9PSED  ali  40  1........MKRAHSTSRVMMGCASSLTLMATLFASQQAAAHGYMSEPPSRAYACRL---ALNTGCGAAEYEPQSVEGPKGFPAQGPVDGKLASGGLTQFAAVDAQSATRWHLTDITERNIQFSWFYTAAHKTTKWEYFITKAGWNPNLPLSRASFTPFCSVEGGGSVPPGAVKHDCVIPADRNGQHIILGAWTIDNTAAAFYNVVDVNIVAAAPDPDGW............................................................................................................................................................................................................................................ 220
134 3.000e-31UniRef50_UPI000C9A82C1 N-acetylglucosamine-binding protein GbpA n=2 Tax=Pseudomonas protegens TaxID=380021 RepID=UPI000C9A82C1  ali  45  8................RTHLKLPLVIAMGMAALASQQAGAHGYIESPKSRAFLCSNAGGNLNKDCGSATYEPQSIEYLTGFTQCGPANGTIAAGGLAAFAKLNEQTSTRWKKVTVKPGLNTFDWRYTAAHATRNWQFYITKKNWNPNQPLTRDSFESTTWNNTMPAKAGGKTSHKVNIPADRSGYHIVLATWMVADNSNTFYQ............................................................................................................................................................................................................................................................ 215
135 3.000e-31UniRef50_UPI000A03EB7D hypothetical protein n=1 Tax=Deinococcus misasensis TaxID=392413 RepID=UPI000A03EB7D  ali  26  140...............................................................................................................................................................SWNGTVTGPDAQGFYTAVSPDWGVGGSYDVGFAASGSFTGGSGFVTEVNGQPVVAPDTTPPTVPGTLTQTGLTYNSVTLTWGAATDAVGVAKYEIYNGTTLLTTVSAPATTVTTLKPSTAYNLKVRAVDAAGNASAFGNTVTFTTPAAPVDTTAPTVPGTLSYTTLTYNGVTLRYTASTDNVGVAKYEIYNGTTLLTSVAGSVTSPKLT---LTPSTTYNLKVRAVDAAGNASAFGNTVTFTTPATPADTVPASLRSTASTTTSISLAWNPSTDNVGVTKYEVYRGTTLLATVSS. 443
136 3.000e-31UniRef50_Q9S164 ORF4 n=57 Tax=Actinobacteria TaxID=201174 RepID=Q9S164_STRGR  ali  38  2.............RRKITSLLLGLGIAGVSLLATSGSAQGHGYTDSPVSRQQLC---GNGTVRNCGQIQWEPPSVEGPKGFPARGPRDGLICAGGNQRFAELDDPRGGAWPASAVSAGSHTFRWRITARHATTDFRYYVTKDGYDPSKPLTRADLQPFLTVPFGGRQPGATVTHAGNLPQ-KSGKHLILGVWTIADTGNAFYACSDVTF...................................................................................................................................................................................................................................................... 196
137 3.000e-31UniRef50_A0A1W2FYL2 Chitin-binding protein n=1 Tax=Kibdelosporangium aridum TaxID=2030 RepID=A0A1W2FYL2_KIBAR  ali  35  1.............MRRLVISVIALVTMVSATTV----ASAHGFQHTLPSRAYLCNIGRIP----CGDIKYEPQSVEGPNQFPQAGPADGELCSGGLPQFGELNKTRVSKWPTADVGPGSHRFGWTLTAGHKTTTFRYYITRDGWQPDQLLTRAQLEPFAVIGYNGQLLQGAVSHEVKLPV-KQGRHTVLGIWDHADQPKAVYACSDVFFP..................................................................................................................................................................................................................................................... 194
138 4.000e-31UniRef50_UPI000D323514 chitin-binding protein n=1 Tax=Lysinibacillus meyeri TaxID=1071052 RepID=UPI000D323514  ali  50  10...................WLFIVFAMLIVTFSFAYKASAHGYVKSPESRALLCAQ---KVNHDCGSIIYEPQSLEASGNFPSGGPTDGKIASAG-GTFPKLDEQSAKRWAKVPMKSGANMFTWKFTAAHATDKFEYYITKEGWNPNKPLKRVDLELFCTVKSNGKRPSEEMSHRC-IVPEREGYHIIVAYWEIGDTPNAFYNVID......................................................................................................................................................................................................................................................... 191
139 4.000e-31UniRef50_B6EQB6 GlcNAc-binding protein A n=51 Tax=Gammaproteobacteria TaxID=1236 RepID=B6EQB6_ALISL  ali  43  2.............MNKCSTKTLLALSLIAA----SSGVAAHGYVSETGSRAALCKSDTQEKNTNCGSVQWEPQSVEGDEGFPEFGPADGQIASAGLSQFSELNEQTSDRWVKRPITAGKQTFEWTFRANHVTKTWTYYMTKQNWNQNAVLTRDSFTPFCELGYNMNQPPPETFSHECVVPEREGYQVILAVWDVGDTSKAFYNVIDVKFSGDGGVVDPTW........................................................................................................................................................................................................................................... 216
140 4.000e-31UniRef50_UPI0006916101 hypothetical protein n=1 Tax=Arsenophonus endosymbiont of Nilaparvata lugens TaxID=1247023 RepID=UPI0006916101  ali  31  1...........MKLKKFIIMFLILT--------VSSNLLAHGYIKSPASRAYKCKNEIKALNENCGDIKYEPQSVEQRTGFPDNFPKDGKLASGGIARFSKLDEAGKDRWHKTEMQVGNNDFLWHLTARHSTANWRYYITKNGWNSSVPLERFDLEPFCSQYDYGAIPKSDVTMTCKVPEDRTGYHVIYGVWQIADTSNSFYQVADVVFSDNDNKQPTEPVITESTATGTNQPGEPVVTEPTVTATSQPTKPVVSQPTETATTQPTATGTNQPGEPVVT-EPTVTATSQPTKPVVSQPTETATTQPTVTGTNQPGEPVVTEPTVTATNQPT............................................................................................................................ 318
141 6.000e-31UniRef50_A0A060M0F6 GlcNAc-binding protein A n=8 Tax=Bacillaceae TaxID=186817 RepID=A0A060M0F6_9BACI  ali  42  17......................TVLASALFVFANAESASAHGYIESPKSRALLCAER---VNTDCGGVIYEPQSLEAPKGFPGASIPDGQIASAG-GVFPQLDAQSSNRWSKVNMNSGYQTFGWHLTAMHSTAKWHYYITKPNWNPNQPLTRNQFEPFYEKFDGGARPGQKVSHQLTVPE-RSGYHVILGVWDVADTANAFYQVIDAQFSGGSNPTPNPDPGSPPPAYPAWTSTATYVGGDYVTHNGQVYRAKWWTRGET................................................................................................................................................................................................... 253
142 8.000e-31UniRef50_A0A2N3T3H0 Putative secreted protein (Por secretion system target) n=4 Tax=Aquimarina TaxID=290174 RepID=A0A2N3T3H0_9FLAO  ali  20  526...........................................................................................................TTNVTITYNGGSTTCTATVPTGVSSSAIGSDTATINWTAVAGATYDVRYRQTGASSWTTVAASGTSNAITGLSATTAYEAQVRSKCADGTTSDYSTSVNFTTTDVQLNYCASNGKKTNDSKGGANTITITPTWPGTTYDEGYTGEQVWTKAASKTTPVSGSFTVPATAKDGNTRMRVSMKYNGTPNPCESDYTVVIGGSGGTDTQAPSAPAGLTASNVAQTTLTLSWNAATDNVGVTGYDVYQGT----TNLGSVTATTRNITGLTANTAYQFTVKAKDAAGNVSAASNTLDVTTTGGSSDPCPYNSSVNYQVGDRVTFQGSLYE....................... 903
143 8.000e-31UniRef50_A0A1Y6CMF1 Chitin binding domain-containing protein n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6CMF1_9PROT  ali  45  1..................MKTLFNTLCILIFLSYPILALAHGYMSEPKSRSLLCKE---GSNQNCGAVQYEPQSVEGPDGFPEAGAADGQIAAAASASWSPLNEQSPGRWNKVAIKSGTNTFSWHFTAPHVTKDWRYFLTKPDWNPSEPLSRQDLEPFCVVDGAMAKPPADISHDCQ-LPERSGYHVILALWDVGDTAATFYQVID......................................................................................................................................................................................................................................................... 186
144 1.000e-30UniRef50_H7F1W4 Chitin-binding protein/carbohydrate-binding protein n=10 Tax=Listeriaceae TaxID=186820 RepID=H7F1W4_9LIST  ali  45  2.............MKNVGKSAVFLGALALTLSVTTVGASAHGYISKPESRAYLAKL---GVNQNAGPIQYEPQSVEATGNFPASGPADGHI--AGGGKFNDMDVQTAIRWHKVDVSGGANTIEWTLTANHRTSEWKYFITKKDWNPNEPITRASLEHLTTIDGNNAVPPSKVTQTVNLPTDRSGYYVLLGVWEIADTGNAFYQ............................................................................................................................................................................................................................................................ 186
145 1.000e-30UniRef50_A0A2T6F6Y1 Uncharacterized protein n=1 Tax=Glaciimonas sp. PCH181 TaxID=2133943 RepID=A0A2T6F6Y1_9BURK  ali  45  2..........SSSVNTKTLGKLSLGLTLVLGSLVAQQAVAHGYVESPPSRSLACY---VGQNTGCIEP-YEPQGVEWGGGFPIGGPKDGDIAAGGTDKYGSLNEQTANRWSKTKVKPGINTFKWKYTADHITAYWQFFITKKDWNPNMPLSRASFETIATQEHNGTKPNGGIMHSDNIPADRSGYHVILAAWKTSDTSASFYQVIDVDIQNDIAVAPSKW........................................................................................................................................................................................................................................... 226
146 2.000e-30UniRef50_D4E1I3 Chitin binding domain protein n=4 Tax=Enterobacterales TaxID=91347 RepID=D4E1I3_SEROD  ali  39  1...........MKLNKIMLA--------IAAMTVSGGAFAHGYIEKPESRAYLCKM---GQNSDCGQAQYEPQSTEGPDGFPAAGPRDGELASATNWIGVKLNEQTADRWTKRKMQSGPNEFTWRFLAAHPIADFKYYITKENWNPNQPLTRDSLEPFCVIPGGPASTTGTSTHTCDVPE-RSGYHVIYGTWDVSDTAATFHHMIDAEFEQDYEGVPSPWSNTIGNIMPTIDLLPGSTVKSRVFDANG............................................................................................................................................................................................................... 231
147 2.000e-30UniRef50_UPI00054F9F8D N-acetylglucosamine-binding protein GbpA n=1 Tax=Andreprevotia chitinilytica TaxID=396808 RepID=UPI00054F9F8D  ali  30  1...........MKRSMKKAWLALSPLLACTAILLSQPAMAHGYMSAPKSRNLLCKE---GVNVQCGAVQYEPQSVEGPDRYPETGPADGTLAAAGNSTWAALNEQTVDRWKRTDLNVGPNTFGWTFTAPHRSRDIRYFITKNGWNPNMPLTRAQFEPFCTIEMNNAVPDRSVTHTCNVPADHSGYHVILGAWDVADTAATFYNVADVNIKGGGGGVDPTPIPVPTWTAAGSIKPSENL-------GSGDKIYTRVFTASGENTGLSTSLTLTNATDGNKDRWAVTGQNTVFAKADSGIVRVETAIDKAAQSGDALIPDDLKVTPKAQYTI-VNGKAVIDGKADVSVEVYNSNAMVGTQSVTVDGTAKLDVTVASDGTYTLVVKARDGSLVQKSFSTLLTGN-PAPTPSAPAYVAGTVYKAGDLVSNGGKVYQC...................... 450
148 2.000e-30UniRef50_A0A085JEN2 Chitin binding protein n=3 Tax=Enterobacterales TaxID=91347 RepID=A0A085JEN2_9GAMM  ali  55  2.............................................................NKDCGSIQYEPQSLEAAKGFPESGPADGHIASAGHENYSELDEQTTTRWHHVTLSTGDNTFTWHLTAPHKTERWRFYITKKDWDPNSKLTRAQFDPICEQDDNGKLPDTSTIKDCKIPADYTGYHVILGIWDVADTANAFYQVIDAN....................................................................................................................................................................................................................................................... 153
149 2.000e-30UniRef50_A0A068Z2U4 Chitodextrinase (Modular protein) n=2 Tax=Serratia symbiotica TaxID=138074 RepID=A0A068Z2U4_9GAMM  ali  30  352.......................................................................................................................................................................................................................DNSVKPSAPTELKATVENGTISLSWHAPIGK-DVVGYQIYRDGVNYSSASSTHWVEQSAQPNVEYRYLVKARDAAGNLSDASNEVVEKIQQSAEQI-KPNTPVGLHVVSAAKNSLSIKWEPVT-NVTIRHYHVWRDS----VELRTVTDNQFLDTGLAAGKTYTYHIIAESDTGVMSLASSTLRVKTHNDPVIPSDWKVGVNYKRGDFVTYQGKKYVCLQSHMAMAHWNPGVAQSLWQTV 588
150 3.000e-30UniRef50_UPI00068FA9D2 hypothetical protein n=1 Tax=Andreprevotia chitinilytica TaxID=396808 RepID=UPI00068FA9D2  ali  39  33FNQHIGEVMTHLSMKKTWLALSPVLACTAILL--SQQAMAHGYMSSPQSRNLLCN---KGVNVQCGPVQYEPQSVEGPDRYPETGPADGQLGNAGRGAWSSLNEQTVGRWKRTDINVGPNTFGWTFTAPHRSRDIRYFITKNGWNPNMPLTRAQFEPFCTIDMANAIPPKTVSHTCNVPSDHSGYHVILGAWDVADTSATFYNVADVNIKGGGGGVDPTPTPVPTWASAGSINPSENL......................................................................................................................................................................................................................... 268
151 3.000e-30UniRef50_A0A181XHW2 Chitin binding protein n=290 Tax=Bacteria TaxID=2 RepID=A0A181XHW2_KLEOX  ali  50  1...........MKVKKISLYT--------ATLLFTSSALAHGYVESPPSRAYQCHL---GKNTDCGSVQWEPQSVEQASGFPEGAPPDGKLASAGKSNFSQLDSQSPTRWAKTTIKSGKNNFVWHHSAPHRTANWRYYITKQNWDQNKPLTRSDFEPFCQIDGNGATPAVQVTHSCNVP-DRTGYQVIYAVWEIADTANSFYQAID......................................................................................................................................................................................................................................................... 186
152 3.000e-30UniRef50_A0A242K2Y8 Uncharacterized protein n=3 Tax=Enterococcus TaxID=1350 RepID=A0A242K2Y8_9ENTE  ali  52  2.............KKQTLVGLGMILATTGLTALSSVDVSAHGYVSEPISRGYQGNLDWNAAFQKYGKVIDEPQSLEAPKGFPAAGPADGKIASANGAVGDLLDQQTSALWTKQNLTTGANTFTWTFTANHVTTKWHYYITKNGWDQNKPLTRDELEPIGEIQGNGAFASTNPTHTVNIPNDHFGYHVILAVWDIDDTAYAFYNVID......................................................................................................................................................................................................................................................... 199
153 3.000e-30UniRef50_A0A061H9C6 Uncharacterized protein n=1 Tax=Anthracocystis flocculosa PF-1 TaxID=1277687 RepID=A0A061H9C6_9BASI  ali  38  17.................................YAVQVTAHGYLASPPSRAALCKAD--GSPTACGAIQYEPQSVEAPKGLPFARTGDGHLCSAGVDRFPELDRQGPNAWKHQQPSD---TFKWNILVPHSTTDFKYFITKDGWNSAKSASDLESTPFLQVKMDGKEPTGSVVHKANQMPKKSGYHMVYAVWTIADTGNAFYQC........................................................................................................................................................................................................................................................... 186
154 3.000e-30UniRef50_A0A1J0KW27 Chitin binding domain protein n=1 Tax=Francisella sp. CA97-1460 TaxID=1542390 RepID=A0A1J0KW27_9GAMM  ali  36  1...........MKLNKITLFMGL-------SLLVANQAYSHGYVESPASRGYFCKL---GENKDCGRAQWEPQSIERTKGYFNSGSLNNNMGSAGVSGFEPLDEQSKNRWAKTVIRPNPHKFTWFFTANHKSNAFDFYITKADFDPNKPLTRDSFEKHCYNPTPYWIAPNQPSFTCDL-PERSGYQIIMSEWEVNDTVNSFYN............................................................................................................................................................................................................................................................ 190
155 4.000e-30UniRef50_Q9CE94 Chitin binding protein n=82 Tax=Terrabacteria group TaxID=1783272 RepID=Q9CE94_LACLA  ali  54  1.............MKKLLTGLLVAAGLLSVSLLITDTVSAHGYVQSPPARGYQGQLDWTAAFNIYGNVISNPQSLEAPKGFPECGPADGRIASANGGLGQVLDNQTSSRWKKTSISTGSNIFTWKYTAPHKTTKWHYYMTKTGWDQNAPLKHSELELIGTINHDGSPATNNLSHTINIPTDRSGYHIVLAVWDVADTSNAFYNVID......................................................................................................................................................................................................................................................... 203
156 4.000e-30UniRef50_UPI000C2FC1BB hypothetical protein n=1 Tax=Pseudomonas plecoglossicida TaxID=70775 RepID=UPI000C2FC1BB  ali  35  12...................................SITLRHGHVFTPPSRAYL---AWQAGEIDEGAL----NQRESGKFFPHSAPPDGKIASANQATGALLD-QPGDHWTKHEVRSGELDISWYFSANHVTRRWNYFITRPGWDSAQVLSRDQFEPFHTVQIDLQPPVSPTTHEVTLPE-REGYHVLLAVWEVANSPNAFYHVVDLQFEAGQ--GVERPSTPAGLTADEVSDSRVTLSWQPSSGPQPIERYRLIRNGTDTFEVPATRWHDSTVVADATYHYSIIAIDVEGAASLPATPIVV......................................................................................................................................................... 298
157 4.000e-30UniRef50_A0A0L8LSE6 Chitin-binding protein n=8 Tax=Bacteria TaxID=2 RepID=A0A0L8LSE6_9ACTN  ali  42  1...........................................MTRPKSRAQLHLADWQAAGLEAGKFFPATESPYAPDDVANFEPPDGRIASAGKDFAAKLDEDSQQDWHKHPVSAGKLDITWNYHAEHKTRRWNYFLTKSGWDPGARLTRADLEPIATYQNSGQPPENPTVHSVTLPSDRHGYHVLLSVWEVADTGNAFYQVID......................................................................................................................................................................................................................................................... 180
158 5.000e-30UniRef50_A0A1X4H0N9 Uncharacterized protein n=2 Tax=Streptomyces griseofuscus TaxID=146922 RepID=A0A1X4H0N9_9ACTN  ali  44  11..............................VFLRPGSEVRHGYSEFPTSRSRWCQMDK---SLKCGPIANEPQSVEGPKGFPVGGPRDGELASANNERFGELDDPNGKPWPVTPVVGGRYRFQWWLTAPHSTAKFHYYLTRPDWNQSARLTRSDLEPWLTVFQSGEIPDNAVAHWARIPSGRRGRHVLYAVWDIADTVNAFYSACD......................................................................................................................................................................................................................................................... 190
159 5.000e-30UniRef50_UPI0009EEC205 hypothetical protein n=1 Tax=Erwinia sp. ErVv1 TaxID=1603299 RepID=UPI0009EEC205  ali  35  10..............................STAKSHGNTRHGHVFSPASRAWFAWEEGLIDN---GQL----NQREAGKFFPATPPKDGKIASANQGNAEFLDA-PGSHWKKHAVLSSELTISWAYSAVHTTRRWNYFITREGWDPSLPLSRAQFQPFFKVELTEQPPPEPTVHDVMLP-QRQGYHVLLAVWEVANTGNAFYHVIDLDFTGDSQPGEDVPAAPAGLRAYNITSDSVTLSWNTSS--TAAAAYRLYRDGELI.................................................................................................................................................................................................. 258
160 8.000e-30UniRef50_A0A0Q9MTA3 Uncharacterized protein n=1 Tax=Paenibacillus sp. Soil750 TaxID=1736398 RepID=A0A0Q9MTA3_9BACL  ali  21  999...............................................................NTLYMQWEAESIAASGGKSFSKYANRPFLSGGIGLGAWEQPGQWAKWTIQVPRSGKYDLVLKYVAWDPPAGK-----LTGRLAMIGNKPYYLEAPTTYDATGTPDWGRTPEVWKGLRVKTGQQLEAGPVDVTMWLTGGPMNLDWIALIENQSDEVRPTAPSHLQITAQTDSTATISWTPSTDNVGVKAYSLYVNGVQVIPSGTTSETITGLTPATSYTITLTSTDTSDNRSLTSVPLVFATSDTNAPDWGSS--STLKAEHLFASTARLTWSPATDNSGVVSYSIYR---ADGTVAGTVAGNAYDVDGLVPGASYTFRVEAADAQGNRTANGPSVTIVMPTAANGGEYYETFDNMSSGNLAAPNWKINLIANSISTVTV............. 1373
161 8.000e-30UniRef50_W7BVB6 Chitin binding domain-containing protein n=1 Tax=Listeria floridensis FSL S10-1187 TaxID=1265817 RepID=W7BVB6_9LIST  ali  42  11.......................................................................................................................................................................ANENPSHQVMIPANRTGYHIILAVWDVDDTANAFYNVMDVNVKNGQGPEIVIPDTPSHVKADQVTSSSVSLTWDADT---KAKSYTIYRDGVKINTVETNYFVDKTVDANTVYHYQVEAVSYTSTVSEKSSELVVKTGIKENEIEKKT............................................................................................................................................ 155
162 1.000e-29UniRef50_A0A0E2ZID9 CBP21 domain protein n=3 Tax=Francisella tularensis TaxID=263 RepID=A0A0E2ZID9_FRATU  ali  37  1...........MKLNKITLLTGL-------ALLVSSEAYSHGYVESPASRALLCKE---GKNKDCGRAQYEPQSIEQADELFNLGALDNNIGSADVAGFESLDEQEQSRWAKTVVQPGPLKIKWQFTANHKSKHFKFYITKPNWDPNKLLTRESFEEKPLNCYDPQPTWDGLTFTCT-MPNRSGYQIIMAEWDVDDTRMSFYN............................................................................................................................................................................................................................................................ 191
163 1.000e-29UniRef50_A0A2B0WSG5 Uncharacterized protein (Fragment) n=2 Tax=Bacilli TaxID=91061 RepID=A0A2B0WSG5_BACAN  ali  62  1..............................................................................................................................................................................................................................................................................................................................................................................FTDQNLTANKEYKYAVKAVDAAGNTSIQSNILPVKTKDQNVSYEKWDPRKVYTKGDKVEHQGKVYEAVQNHQGNGDPNWIFALSLWNPL 89
164 2.000e-29UniRef50_R2QXZ5 Chitin binding protein n=18 Tax=Lactobacillales TaxID=186826 RepID=R2QXZ5_9ENTE  ali  45  1.............MKKTMLKTVLTLSLLAGGLFVSSTVHAHGYVSSPGSRAYFGSSQGGKINKNVGRAEWEPQSIEATKNTFIT----GKLASAGVSGFDPLDVQTADRWYKSDITTGPLAINWTLTARHRTSTWDYYMTKQGWNPNQPLDIKNFDLIGRVDDKAAIPEASVNHTITVPSDRKGYHVIYAVWNVYDTTNAFYQAID......................................................................................................................................................................................................................................................... 190
165 2.000e-29UniRef50_A0A2Y9TZ39 N-acetylglucosamine-binding protein GbpA n=1 Tax=Limnobaculum parvum TaxID=2172103 RepID=A0A2Y9TZ39_9ENTR  ali  47  1.................MIPALSLRGLASALVIVSPLVWAHGFISEPPSRAYACTL---GQNVDCGDVEYEPQSLEAPTGFPNGGPADGKMGSAGSSRFTQLDEQTAVRWKKVSMKPGDNTFTWKFTAAHPVNNWRYYITKQDWDPNQPLTRASFTPFCKIDGKMAMPQTITSKNCNVP-NRTGYQVILGVWEVADTPNSFYN............................................................................................................................................................................................................................................................ 185
166 2.000e-29UniRef50_P50899 Exoglucanase B n=26 Tax=Bacteria TaxID=2 RepID=GUXB_CELFA  ali  28  588....................................................................................................WANNQDPLGVSAVETRGDYKRFDDTYVANGDGIYIPSGWTGTMPNGDVIKPGVSFLDIRSFYKKDPNWSKVQTFLDGGAEPQFRYHRFWAQTAVAGALADYARLFDDGTTTPDTT---APTVPTGLQAGVVTSTEATISWTASTDDTRVTGYDVYRGATKVGTATTTSFTDTGLTASTAYAYTVRAFDAAGNVSAPSAALTVTTKATPSDTTAPSVPA-ITSSSSTANSVTIGWSASTDNSGLAGYDVYRG----ATRVAQTTALTFTDTGLTASTAYEYTVRARDVAGNVSAPSTAVSVTTKSDTTPDTTAPSVPAGLAAMTVTETSVALTWNASTDGYDVYRGATRVGSTTT. 943
167 2.000e-29UniRef50_A0A1Z9DXC7 Uncharacterized protein n=1 Tax=Cellvibrionales bacterium TMED122 TaxID=1986772 RepID=A0A1Z9DXC7_9GAMM  ali  37  1....MRRHTVNPKLSHFLIKPIALLGGLLASG-VALESIGHGYVSEPPGRSFLCKL---GDNTGCGAVQWEPQSVEGPDGFPIGGPTDGTIAAAGSPSWSELNAQTPSRWYKHDFAAGYRTFEWTFTANHVSRDWRYFITQPDWNPAEPLSRADLDPFCEYDGGMERPPMVIQHNCYVPERE-GYHVIMAVWDVGDTAASLYNAIDVNFSGDNISVTPDPEPEVDP..................................................................................................................................................................................................................................... 222
168 2.000e-29UniRef50_J1RWS0 Chitin-binding protein n=8 Tax=Streptomyces TaxID=1883 RepID=J1RWS0_9ACTN  ali  38  29......................................SAHGYVSSPPSRQAQCA----AGAIECGPIKWEPQSVEGPKGLTS--------CSGGNSRFAELDDD--AKGWQVTPIGRSQTFSWRLTARHATGTWQYF--------------AGGKKVAEFNDGGARPPETVSHTVDF-GGLTGRQKILSVWNIADTANAFYACID......................................................................................................................................................................................................................................................... 167
169 3.000e-29UniRef50_UPI00093A6729 hypothetical protein n=1 Tax=Paenibacillus ihumii TaxID=687436 RepID=UPI00093A6729  ali  40  1.................MVTLGISVLLFALSIMFADKASAHGFVEN--SRADLCA---KGINTDCGYVKYNPADLEAPGGFPNGGPEDGKIASAN-GRYPEMDQQWTDRWEKINIASGLNTFTWVHTANHNTANWRYYITKPDWNPNQPLTRDSFDSFCTVSHDGSLPEFKDNHLCNVPSDRSGYHVILAVWEVAYTGSTFYQVIDVNIDGDIDPGNGGNPGTGEGNENPEECGH--LAWSSTQ--VYNYGDIVSFNGGDWKARWYSQGQEPGVSEWGAWEYLGKCADADGH................................................................................................................................................................... 268
170 3.000e-29UniRef50_A0A1G7WWU8 Chitin-binding protein n=85 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1G7WWU8_9PSED  ali  40  24..................................PQFAAAHGYLNDPPSRAFACQ---KGLNTECGAAQYEPQSVETAKGFPEAGVPDGKIASGALSQFSALDIQSANRWHKTEIKDRTINFDWHYKATHPATKYQYFITRSGWNPNAPLTRESFTPFCVVDAGGKLPTDQPQHACQIPGDREGHHVLLGIWTVDDTPGAFHDVVDVNIVAEAEAPDGW............................................................................................................................................................................................................................................ 217
171 3.000e-29UniRef50_F9UP60 Adherence protein, chitin-binding domain n=221 Tax=Bacteria TaxID=2 RepID=F9UP60_LACPL  ali  49  32......................................SAHGFVTNPGGRAYLGSTWYPGLNTNIGSVMYEPQSIEA----PQNTFIDGKIASAGIANFAPLDEQNAKRWYKTPVKAGNLSVTWQLTARHKTSTWDYYITKPSWNPNAPLKFSDFKKIASYNDNGAIPSEFVTHQVNISANEKGYQVLLSVWNIADTGNAFYQVSDI........................................................................................................................................................................................................................................................ 198
172 3.000e-29UniRef50_A8LVC0 Chitin-binding domain 3 protein n=58 Tax=Actinobacteria TaxID=201174 RepID=A8LVC0_SALAI  ali  30  1...........MNIRKLIAYPLTAVAAAAGSTLFASPASAHGYVASPPSRQALCAQR---AVPDCGPIKYEPQSVEGPKGLKR--------CDGGLSQFAVLNDN--NRGWPAREVGDTVTFSWTLTARHRTSTWEYFI--------------GDTRIAQFDGGNRQPEAVVTHRVDL-SDFAGPQTVLAIWNIGDTPMAFYNCIDLDVKGGGTTPPTQSPTPEPTSKPTQKPTGQPTS-TALPTNPGTPG............................................................................................................................................................................................................ 212
173 4.000e-29UniRef50_A0A0Q4MKC6 Uncharacterized protein n=2 Tax=Yersiniaceae TaxID=1903411 RepID=A0A0Q4MKC6_9GAMM  ali  25  1...........MKNTKVKILPYAIALVLGG--LYSTVAGAHGYIENPKSRSFWPADEIEAHKLPAGGLMENDTSYENAFNFP----PDGKLASGGNANRTPLDNESYN-WPVNSMKSGTQDFTWYIPAQHRTTYFTYYITKQDWKSKPGYGQKEDKPFCHASNDISFPKLKTVHTCTVP-QRTGDQKIYSVWRIRDTAMAFYQMVDVKFDGSSGPEDEVVKPVADIRASSSDLSTSNLTLSASSGKSLRYSWQVMSNSDKVTLSGSTSSTATKNQATSNFNVQVKLTVTNGQNVSNSKTITLKASKPAEVNKPVAVVPADFTVTESSNSAGYELDGSSKNAQSYSWKIVQGGGGWVKEVKLAKARALVPANKVGKAVYELTVIGKDG----SKDARRVTVTVKPXXQAHPKFEFGKAYKGGDKVMTDGSVYEC----KGWPATNWC......... 485
174 6.000e-29UniRef50_A0A285F0N0 Chitin-binding protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A285F0N0_9ACTN  ali  34  1.............MRRKIAYPLLALGMTAGATLVASPASAHGYVSSPPSRQALCAS---GAVSDCGQIQFEPQSVEGPKGL--------KSCDGGVSQFSVLSDES--RNWPAKAVGSSVNFSWVLTARHKTSTWDYFI--------------GGTKVATFDDGGAQPAAVVNHTVDL-SKFPGRQKVLAVWNIADTANAFYNCVD......................................................................................................................................................................................................................................................... 166
175 7.000e-29UniRef50_A0A1S8YR29 Uncharacterized protein n=1 Tax=Izhakiella australiensis TaxID=1926881 RepID=A0A1S8YR29_9ENTR  ali  42  3.....................VSKTCFALAALLSASGAWAHGYVSEPASRGYLCTNDQGNQNKDCGAVQYEPQSVEGGDGFPANAPKDGEIAGAGLATMSPLNAQSDSRWHKHAMSAGKYSFAWTFTAPHRTKDWRYYITKPDWNPNKPLSRASFEPFCVIDGKNQIPAGKSQPHECNVPAREGYQVILATWDVGDTDATFYNVIDVDFGGHNHP................................................................................................................................................................................................................................................ 210
176 7.000e-29UniRef50_Q59930 Chitinase n=55 Tax=Enterobacterales TaxID=91347 RepID=Q59930_SERMA  ali  34  1.............MNKTSRTLLSLDLLSAAMFGVSQQANAHGYVESPASRAYQCKLQ---LNTQCGRVQYEPQSVEGLKASHRPARLQVHLLRTGSANADALEQAQP---------ENPNSFTWKLTARHSTTSWRYFITKPNWDASQPLTRFDLTPFCQFNDGGGIPAAQVTHQCNIPADR................................................................................................................................................................................................................................................................................. 167
177 7.000e-29UniRef50_A0A1Q5LJE2 Chitinase n=2 Tax=Streptomyces TaxID=1883 RepID=A0A1Q5LJE2_9ACTN  ali  33  29......................................YAHGWVTDPGSRQDQCAEGV----VDCGQIQYEPQSVEGPKGLRS--------CSGGNSQFAELDDDS--KGWRVTPVGTSHTFNWHHTARHATDTWQYFIGNTK--------------IAEFDGNGAQPPADVAHQVDF-GGFTGRQKVLAVWNVADTGNAFYACIDVNVXXXXXXXXXXXXX-----XXXXPGDCAAPVWNAA---------NVYTGGDTVGRTWRAKWWVTGEEPGTTGEWGVW.......................................................................................................................................................................... 235
178 8.000e-29UniRef50_A0A0K1Y848 Uncharacterized protein n=1 Tax=Apis mellifera filamentous virus TaxID=1100043 RepID=A0A0K1Y848_9VIRU  ali  35  24................KMTTTIILFSCISCIASLASIVNGHGYVRRPSSRSYLC---MMWANHDCGSVVFEPQSVEGKKGFPDYGPPDGAIAGAG--IFPKLDESGINRWRRVELRKHSILIKWYYSAPHRTTQYDLFATTKSYDGSKPLSRAVLRHAHTRFSPSKQAMTIVQHYIPRKMVHKT-GVLLCVWVIDDTQNAFYQVIDY........................................................................................................................................................................................................................................................ 217
179 1.000e-28UniRef50_UPI000D6928FE hypothetical protein n=1 Tax=Nocardioides sp. YIM ART13 TaxID=2173172 RepID=UPI000D6928FE  ali  31  410.......................................................................................................................................................................................................................DTQAPTVPGNPRSTGTTGTSVSLAWDASSDNVAVAGYDVYNGSTKAASVTGTTATVTGLSPDTEYTFTIRARDAANNVSADSAEVRATEPGGGGDEEPPTTPGRPHSTGVTASSVSLAWDASVDDTGVTGYDVYRGSTLATTVTTTSATV----SGLAAGTEYSFTIVAKDAAGNASKPTRAVVARTSGGGAPTVPGNPRSTGATSTSISLAWDASSDNVGVAGYDVYNGST........ 641
180 1.000e-28UniRef50_A0A2N5QMV2 Chitin binding protein n=9 Tax=Bacteria TaxID=2 RepID=A0A2N5QMV2_CHRVL  ali  44  10..................................AGMQPRHGQVFKPESRGQLC---VDGVNAQCPLQSWHVNGLESGKFFPAAPPADGKIASAGQAHSAVLDEQSAERWAKHPAKSGEMEFQWSYHARHLTRRWNYFITKADWNPNQPLSRAQFEPFYKVEMSAQPPPEPTIHMMRMPQ-RQGYHVVLAVWEVADTGNAFYQVIDFDF...................................................................................................................................................................................................................................................... 209
181 1.000e-28UniRef50_K0K9W1 Chitin-binding domain 3 protein n=27 Tax=Actinobacteria TaxID=201174 RepID=K0K9W1_SACES  ali  41  28....................................QAFAHGYVSSPPSRQAQCAKGT----VSCGAVKYEPQSVEGPKGLR----------SCNGGVAGFADLNNDSKGWKVTSVGQTVTFNWVFTARHRTSNYEYYIGGK--------------RVGFVDGKNQQPPASVSHTINL-GGVTGQQKVLAIWNIGDTSNAFYACID......................................................................................................................................................................................................................................................... 168
182 2.000e-28UniRef50_UPI0009706B35 N-acetylglucosamine-binding protein GbpA n=1 Tax=Shewanella sp. UCD-KL12 TaxID=1917163 RepID=UPI0009706B35  ali  42  7......................LIRLLTASTLLASTASIAHGYITTPGARGYLC--DKQPENSNCNELRGNSQSLEALKGFPDSGPADTQIASAGTP-YRVLDEQSPLRWVKKEIESGPMDIHWTFTANHRTAKFHYYMTKQNWNPSAPLTRDSFDPFCEVDYNNQIPPMTLSHVCNIPQ-RSGYQIMLAVWDVGDTANAFYNVVDLTFDDETPTGWKH............................................................................................................................................................................................................................................ 203
183 2.000e-28UniRef50_D4HZY3 GlcNac-binding protein A n=9 Tax=Bacteria TaxID=2 RepID=D4HZY3_ERWAC  ali  40  1...........MKVNKLALA--------ITTLLVSGSVFAHGFVTNPPSRDTMCKLSKNSEEICSSSVRYDTSAIESTKGFPAEGPPDGFLASGDNAKGYALNVQNADIWTKNKITAGKNNFTWELTAPHKTANFKYFITKQGWDANKPLTRASFDPFCTIEGNGETPEPKPTHEC-VVPERTGYHVIYATWEVADTSNTFYKVIDVEFDGAVSSEWPKQVGTVNPYMDLKAGDSVKV......................................................................................................................................................................................................................... 222
184 2.000e-28UniRef50_A0A1Y2NNB0 GlcNAc-binding protein A n=99 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y2NNB0_STRPT  ali  38  3............RKRKLALALGAGIAPLLVVTLPVNPASAHGYVSSPPSRQAQCAAGT----IDCGPVKWEPQSVEGPKGL--------TSCSGGNSRFAELDDDS--RGWKVTPIGSSQTFNWRLTARHSTSTWQYF--------------AGGRKVAEFNDGGAQPPATVSHTVNF-GGLTGKQKVLAVWNIADTANAFYACID......................................................................................................................................................................................................................................................... 167
185 3.000e-28UniRef50_UPI0005BDDD7A chitinase n=1 Tax=Kitasatospora sp. MBT66 TaxID=1444769 RepID=UPI0005BDDD7A  ali  28  110.............................................................................................................................................................................YNANVPAGKTTEPYSF--WFVANGPVGTPTGCRINGDKCDGSSDVLPSAPGTPAVTDATAHTLALKWPAATGDFPVASYDVLNGSTVVGGSTTTDAVVTNLTPATSYTLTVRAKDTRGNLGPASAPVTASTFDPATDPTPPTAPTNLRTTAVGSSDVTLAWNAATDNLKVAAYDVYQD--GALVRTVTGSTLAATVGSLSPSTAYTFTVKARDGADNASPATAPLKVTTS.................................................... 336
186 4.000e-28UniRef50_A0A2V8LVL4 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8LVL4_9BACT  ali  29 1262.....................................................................................................................................................................................................................SGDTTPPAAPTNLAAAASSASRINLTWTASTDNVGVTGYRIERCFAQIGTSTSASYSDTGLSASTSYRYRVRATDAAGNLSAYSNTASAT------TDAPPTAPANMTATASGGTQINLTWTASSSSIGILNYLVERCGCTNFVQIATPTATSYTNTGLTPATTYSYRVRASDTHNNLSGYSNTASAATADTIAPSAPSNLAATAPGSAQINLTWTASTDNVGVTSY............... 1492
187 4.000e-28UniRef50_UPI00034C88DB hypothetical protein n=1 Tax=Nocardiopsis alkaliphila TaxID=225762 RepID=UPI00034C88DB  ali  37  25....TVSRTKGMPPLKKHLAAIAGATALIFALMPAGTASAHGYVSDPPSRQAQCA----AGVVDCGPIRYEPQSVEGPQGLMQ--------CSGGNEIFAELDDD--DYGWDVTPVGTTATFEWIITANHATADWEYFI--------------DGQLIDSFDGGGAQPPSRLSHQVDL-SGYSGEHTVLARWTVADTTNAFYACVD......................................................................................................................................................................................................................................................... 201
188 5.000e-28UniRef50_UPI000CA064DE T9SS C-terminal target domain-containing protein n=1 Tax=Aquimarina sp. w01 TaxID=2070536 RepID=UPI000CA064DE  ali  19  526...........................................................................................................TTNVTITYNGGSNTCTAIVPTGVTSSNISANAATINWNTVSNAIYDLRYRQIGTSSWVTSSENGTSKTISGLTASTSYEVQVRSKCADGTTSNYSSSANFTTTGDNPITYCPSNESTNLTKGDSNTITITPTWTGTRYNEGYTGEQVWTKAASKTTPVSGNFSVPANAKEGNTRMRVSMKYNGIPTPCESDYTVVIGGSGGGDNQAPSIPTGVTATNIAETSLTLSWNASSDNVAVTGYDIYNGN----TVVTSVSGTTANITGLTANTAYQFSIKAKDAAGNVSAASTVVNVTTIGGPSSFDVKITFDRYPEETSWEIKNSNNQIVHSGGTYGSQPDNSTINITKTL 925
189 6.000e-28UniRef50_V5XMB4 Chitinase n=11 Tax=Bacteria TaxID=2 RepID=V5XMB4_ENTMU  ali  29  343...................................................................................................................................................................................................................................................................................................................TPDTEKPSQPTNLAGTA-THSTVALSWTKSTDDRGVAGYYIYRDGE----QIGRATNNAYTDTKLTASTEYTYTVKAFDAAGNVSEESKALVISTLEEPPPSVPLNITASSISDKSVSLSWTQSTDNVGVVGYYVYRDGEQVGETET. 489
190 7.000e-28UniRef50_A0A1G8SC10 Por secretion system C-terminal sorting domain-containing protein n=1 Tax=Flavobacterium noncentrifugens TaxID=1128970 RepID=A0A1  ali  26  544.............................................................................................AGGSANNSDDMVLTINAVAGPFSVTSQNSAVTYQSGTTQTVTWNVAGTTANGVNTANVDILLSKDGGNTYPITLASATPNDGSQPIVIPNEPGTQNRIMVKGSGHIFFDISNADFTITTGTVETVAPTVPTDLTASGTTTTSTNLAWTAATDNVAVAGYDVYQNGTLKTTVSGTTLAVTGLTAATANNFYVKAKDAAGNVSNPSNTLTVTTLAVALDATAPTAPTALAAGSTTKISTILSWSASTDNVAVTSYYIYKNG----VFLTSSTTRAFSVTGLTAATTYSFTVKAIDAAGNLSVASNTVSVTTLANATGDTTIPTTPTNLAASGTTQTSTVLTWTSSTDNIGVASYS......... 892
191 7.000e-28UniRef50_A0A286DW03 Chitin-binding protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A286DW03_9ACTN  ali  38  2.............RKTILTAATGAGLAVATVFATSTTASAHGYTTSPPSRQQLCAE---GAVSDCGAIQWEPQSVEGPKGFPGAGPADGSICAGGNTPFAPLDDPRGGDWPATDLTPGSATFSWTFTVRHSTSTFDYYITNDSYDPTQPLTRADLEPFLSVSLDGAQPGETENHQGTV-PDKSGRHLILSVWNVADTGNAFYACSDV........................................................................................................................................................................................................................................................ 194
192 7.000e-28UniRef50_C2UG19 Fibronectin type III domain protein n=21 Tax=Bacillus TaxID=55087 RepID=C2UG19_BACCE  ali  68  1...............................................................................................................................................................................................................................................................................................................................................................................MDKELKANTSYKYVVTAVDLAGNESSRSDVLDVTTKAENSTYEKWDARKAYTKGDRVVYEGKVYKAVQGYQGNGDTNWIFALSLWKPV 88
193 7.000e-28UniRef50_A0A0F7VLS0 GlcNAc-binding protein A n=69 Tax=Actinobacteria TaxID=201174 RepID=A0A0F7VLS0_9ACTN  ali  39  27....................................SASAHGYISSPPSRQAQCAAGL----VSCGSIKYEPQSVEGPKGLMS--------CSGGNAAFAELDNDS--KGWRVTPVSRTTSFNWRLTARHATSTWQYY--------------AGGRKIAEFNDGGARPGETVTHQVNF-GSLTGKQKVLAVWNIADTANAFYACVD......................................................................................................................................................................................................................................................... 167
194 8.000e-28UniRef50_UPI00047073A9 T9SS C-terminal target domain-containing protein n=1 Tax=Aquimarina megaterium TaxID=1443666 RepID=UPI00047073A9  ali  18  473...................................................YLLSQGGQGSNDNGNSYTVEAIGIEKAGQIAFRALTNYLSQNSNYAAARTAVINAATDLY----GASSCEVKAATNAMHAVGVGQQFSGTAGGTPTCADGVQNGDETGVDCGGSCEPCSTTVTYCASNGQSTSDEYISNVKLGSINKTSTAGSGGYSDFTAESTSLSKGNSNTITITPTWTGTQYNEAYSVWIDDFADAGEQVWTNAASQTTPVSGNFTVPSAAKDGNTRMRVSMRYNTVPSSCESFTVTISGGSTGGDTQAPSAPSGLTASNVAQTTLTLSWNAATDNVGVTGYDVYQGS----TLLGSANSTSTNITGLTANTAYQFSVKAKDAAGNVSGSSNTVNVTTTGGSSDPTPYNGSVNYQVGDRVTYQGYLYE....................... 864
195 8.000e-28UniRef50_I0HJD3 Putative secreted chitin-binding protein n=33 Tax=Actinobacteria TaxID=201174 RepID=I0HJD3_ACTM4  ali  34  3..............RKIAYPLATLGMVAASTAVVASPALAHGYVSSPPSRQALCAA---GTVSDCGAIQFEPQSVEAPKGSSQ--------CNGGNANFSVLNDES--RNWPATSVGNSVTFNWVLTARHRTATWVYSI--------------DGTKVATFDDKNAIPNATVSHKVDL-SGFSGRKTVLAVWNIGDTAAAFYSCVD......................................................................................................................................................................................................................................................... 166
196 8.000e-28UniRef50_A0A1Y5WY03 Chitin-binding protein n=14 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y5WY03_KIBAR  ali  38  28....................................QASAHGYVSSPGSRQAQCA----AGTVSCGDIKFEPQSVEGPKGLTS--------CSGGVGRFAELDDDS--KPWRASSVGGSVNFTWTFTARHATTNYEYYL--------------NGRKIADIAGAGRQPAPTVTHSVDL-GGATGRQKLLAVWNIADTPNAFYSCVD......................................................................................................................................................................................................................................................... 168
197 9.000e-28UniRef50_A0A2S1JR70 Uncharacterized protein n=2 Tax=Microbulbifer sp. A4B17 TaxID=359370 RepID=A0A2S1JR70_9GAMM  ali  42  1...........MILRKTKFASVIKTLMAIALAGMSSNALSHGYVEAADGRGTLCKLDTGEMNIDCGAVQWEPQSIEGDEGFPESGPADGQIASAGDSSWSELNEQSSDRWVKNYISSGWQTFKWYFTANHVTRDWKYYITKEDWNPNAVLTRDDLDPFCEVDGNYEQPAVNTTHECQVPE-REGYHVILAVWDVGDTVNAFYNVIDFDGDNVVNTDWSVGGTINPTQDLNVGDKVYTRVFDSSGENSSYST............................................................................................................................................................................................................ 256
198 1.000e-27UniRef50_A0A2R7TXY5 Multidrug transporter (Fragment) n=1 Tax=Pseudomonas sp. HMWF031 TaxID=2056865 RepID=A0A2R7TXY5_9PSED  ali  42  1........MKNTSYKGSALAACTSSMILLSAMLASQSASAHGYLEVPPSRALACQ---KGLNTNCGGAQYEPQSVAGVGGAPLQGPVDGKIASGGHSLFSAMDAQSATRWHLTEIKDRNIDFQWRYTAVHPATKHEYFITRNNWNPNEALKRATFEPFCTIDGGNQKPSNTDKHNCNIPADKTGHHVILAIWTVGDTDAAFYN............................................................................................................................................................................................................................................................ 202
199 1.000e-27UniRef50_A0A1I1AMP4 Fibronectin type III domain-containing protein n=1 Tax=Cohnella sp. OV330 TaxID=1855288 RepID=A0A1I1AMP4_9BACL  ali  22  993...............................................................DTLSVFAEAESFQNSSGGTFNRYTNRPFLSGGVGVSNWTNKGQWLDWTLNVPKQGRYDLVLKYVAGWDAPEGALTSRLAKLGDNAYYFEAPKTVDF-----GTLPEYWKSIRVKTGALLPAGPLKLTMWN-----SVASMNLDWIGLVEAKDDEIRPSAPGAPQLVAKTNTSATVRWGGSTDNVGVKEYRIYSNGQLAKTVPAGSTEVTGLTAGKSYKIMVRAVDTSDNESHDSPALDVVTTDTLAPVWAEGAV--LSAANVFPDKATLSWSGSTDNSGPVAYDLYRIDGAAATKLASVTGTTYEVQGLQPSGSYSFKLEAVDTAGNATKDGPSVTVRTPGANMNGNGYEPFTGMAAGTSPAGNGWTVDPGHGTSIAVTAAGDGNKVLTLT. 1376
200 1.000e-27UniRef50_A0A2N3TDW8 Putative secreted protein (Por secretion system target) n=18 Tax=Bacteria TaxID=2 RepID=A0A2N3TDW8_9FLAO  ali  19  373.................................................................................................................................TSGDTSSNFPTANATHAAKFAKLALEYLIEISNAGSGGNPPTGYCASNGQKTSDEYIGKVALGTISKTSSGGYSDFTVETTNLSKGASHTITVTPKWPGTTYSEGYAVWIDFNQDKDFADSGELVWSKTASKTTPVSGSFTVPSEAKNGSTRMRVSMKYNAVPTACESDYTVVIGGSGGGDTQVPSAPTGLAASNIAQTTLTLSWTSSTDNTGVTGYDVYKGNA----VETSVSGTTANITGLTASTAYTFSVKAKDAAGNVSAASNVINVTTKGGSTDPAPYSSSETYQVGDRVTYSGYLYEKTTS................... 689
201 1.000e-27UniRef50_UPI0006B42260 hypothetical protein n=1 Tax=Mangrovimonas sp. TPBH4 TaxID=1645914 RepID=UPI0006B42260  ali  21  26......................................................................NAASILNEADATTGWNGNGNITSITDDPFSGNFANIAAAVSDGTGKEGNYSFN-----AIVGETYQISIWARLGTTNFQPAFANWFGFNGFTTTLINTTGWTEYTWTLVATNTNPIIRVYAAPWSGAQIGNSVVIDNVSILL--VDNEDPTTPTNLNATNVTETGATINWTAATDNIGVVDYEIFQDGASVGSGGGLAFNVTGLTENTSYDFTVVAIDGFGNSSLESAVLEVTTL-TPADNQAPTSPAGLNATNVTETGATINWEASTDNVGVVDYEVFQDDVSIGF---SGGALTFDVTGLEASTSYDFTLTAIDAATNASVPSAVLEVTTLTPAAPSIPAGLNATNVTETGATINWEASTDNVGVVDYEVFQDGVSIGFSG.. 402
202 1.000e-27UniRef50_A0A248VCW9 Chitin-binding protein n=2 Tax=Enterococcus durans TaxID=53345 RepID=A0A248VCW9_9ENTE  ali  23  153....................................................................................................................................................................................................................................................................................................SSGNGEAKFDNIQAAWLDLESPSTPQNLLVESVTSDTVSLSWGASTDNIGVAGYRVYRDKQLVQEVQGE----QFTDTRLTEDTEYTYEVRAFDAAGNQSEASNRINVRTKDHTPPTTPMNVRATVVTENKVTLLWEASSDESGIRSYQVYRNS......... 305
203 1.000e-27UniRef50_W7YHE5 Chitinase n=3 Tax=Paenibacillus TaxID=44249 RepID=W7YHE5_9BACL  ali  32  491.....................................................................................................................................................................................................................PTDTIAPTAPTNLTSPSHTDKKVTLSWNPSTDNVGINSYEIYQGSTLVKSVNGATTTVSGFTGNNTYTFTVKAKDPAGNLSAASNAITVVTSPPIVDNQPPSVPGNLVSTAKTKTSVTLSWDASTDNDDVSVYDIYQNGALVK----STANLTDTVSSLTAGTTYTFYVKAKDLSGNASAASTSITVTTQAD-PNYPVWQPSTAYAVGTYVTYNGKLYKCTYAHTSLVGWEPSASPTLW... 726
204 1.000e-27UniRef50_A0A2N0N833 Uncharacterized protein n=2 Tax=Ewingella americana TaxID=41202 RepID=A0A2N0N833_9GAMM  ali  54  6.......................................................................................DGEIASASGKSNGELDEQSANRWAKNPIKPGYNTFKWKFTANHPAAKFEYFITKNGWNPEKQLTRDSFEPFCTVDGGGIMVNGTATHECQVP-AHDGYQIILGVWTVADTTNAFYNVIDVDFGGDNKPGGENHEKP........................................................................................................................................................................................................................................ 146
205 1.000e-27UniRef50_E9UPM1 Chitinase, class I n=4 Tax=Actinobacteria TaxID=201174 RepID=E9UPM1_9ACTN  ali  33  1...........MRTTTKXXXXXXXXXXXXXXXXXXXXASAHGYISNPPSRQAQCA----AGTVECGDIKYEPQSVEGPKGLTS--------CSGGNSRFAELDDDSKN--WQVTPVGRSQTFSWSLSARHSTSTWQYFI--------------GGTKIAEFDDGGAQPPATVEHQVDF-GSFTGRQKVLAVWNVADTANAFYACIDVNIGGTATDPESPAPVAGEFPVSEAQFNQLFPN........................................................................................................................................................................................................................ 199
206 2.000e-27UniRef50_A0A1V0LHY7 Uncharacterized protein n=10 Tax=Enterobacterales TaxID=91347 RepID=A0A1V0LHY7_9ENTR  ali  46  3.....................LSKVFLAVTTLCMAGGALAHGYVTEPASRAALCTAAQGNQNKDCGAPQYEPQSVEGPDGFPNAGPADGRLASAGVASMVNLDQQSASRWTKHPMKAGKNSFTWKFTAAHKTGSWKYYITKANWNPNQPLTRNSFEPFCEVTGNGAIANTNPKHECDVPERD-GYQVIMAAWDVSDTGATFYNVIDVDFGGNNPAP............................................................................................................................................................................................................................................... 201
207 2.000e-27UniRef50_A0A1I1C7N2 Fibronectin type III domain-containing protein n=2 Tax=Paenibacillaceae TaxID=186822 RepID=A0A1I1C7N2_9BACL  ali  22  994...........................................VGGGGATAANLWNDPDAKRDTFPILWQEAEAFNAFGGKSFLKYTTRAFLSGGTGLGDWSQRGQWAKWTLNVPKAGTYDLVVKYATGDQIAP----------GVGAGRYAKVGDGAYYFEAPKTVDWGSLPENWKGLRIHTGQQLAAGPVDITMWHEAGGLNLDWIGLVEVRDDETLPSAPGGVQLLSQTAATATIGWTASTDNAGIDSYAVYVNGVQKKTVPMLTATVDGLTAGQTYALTVRAIDTSGNRSLASAAVSVTMTDMTPP--VWSETAALRAEHAFANAVKLAWDPAIDESGAASYSVYRQPGGALTKIASVVGVTYDAIGLQAGGAYAFKVEAKDALGNESEDGPAMTLTLPAANAGGEYYETFDEWTTGPVSTGNGWTITHKAGATTTV.............. 1384
208 2.000e-27UniRef50_A0A1Z7Z6V7 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium 34_180_T64 TaxID=1856291 RepID=A0A1Z7Z6V7_9FLAO  ali  16  474................................................................................................YQSFTLTGQSISDYQTLSLPDVNLTPIATAPTGLSASNIAANTATLSWDLITGATYDFRYRAVGSPTWTTINTSSNSVDLSGLVVATPYEAEVRSICSASTSPYSSYEGNYSIRIRDNSGTSSSMSSPNFDLTPYGSVEISFHYYANSMEYGEDFWLRYYNGSTWSTISFYSFNITLDESASNSQFRIQCDASGNNDQVYIDAVIISGTPSGPDVTPPSIPLNVNASNITETSCDLNWTASTDNIGVTGYDVYQDN----VLIGNSSGTSYSVLNLIGSTSYNFHIIAKDAAGNESVASNTLNVTTLDPPDTIPPSVPSASNTTYNSTDLSWDASTDNVGVTGYDIYQDGNFVANT... 884
209 2.000e-27UniRef50_D6EWM4 Chitin binding protein n=778 Tax=Actinobacteria TaxID=201174 RepID=D6EWM4_STRLI  ali  40  1...........MRTRTKLYAAALGMATTGALVLSSGGASGHGYTDLPVSRQKVCQNGTVG---GCGAIQWEPQSVEGPKGFPASGPADGTICSAGHGSFAALDQPNGQAWPTTRVNGGSYTFRWQFTARHATTDFKYYVTKPGWNQNHNLARSDLTPFFTVPYGGKQPPATLSHSGTLPSGLSGHHVILAVWTVHDTGNAFYACSDVTF...................................................................................................................................................................................................................................................... 201
210 3.000e-27UniRef50_A0A1G0M7M8 Uncharacterized protein n=1 Tax=Geobacteraceae bacterium GWC2_55_20 TaxID=1798317 RepID=A0A1G0M7M8_9DELT  ali  25  342.................................................................................NNATYNYFIIAFDAAGNRSVASSSLAVPVAVAATDVTPPTAPGNLSASTFALSQTTSSVVLMWSPATDNKAVTAYEIYR-DGSLIATVATPGYTDPLVSISTTYLYYVVAMDAAGNRSVPSNQLSVTPNQPVIAPTAPSSLTATTFALTATTSSVVLSWSPSTDNTAVIGYEVYRNGVRISTVAAPGYTDPSVASGSTYTYFIMAFDAAGNRSIASNQLLVTPNQPSPDVVAPTAPSNLSAVTATTSSVVLSWTPSTDNVAVTGYEVYRNG----VRISTVTVPGYTEPSVTAGVQYTYFIMAFDAAGNRSIASNQLIVTPQPGS................................................. 704
211 3.000e-27UniRef50_A0A0F7RUM2 Related to Chitin-binding protein n=12 Tax=Ustilaginaceae TaxID=5268 RepID=A0A0F7RUM2_9BASI  ali  35  1...........MAFQSSLSLFQLVALVATLFHLLVNVVDAHGYINSPASRSYMCKE---GNAKNCGEIQYEPQSLEALKGLPFARSGDGKLCSAGLSQFAELDRQGAGVWPTTK-ASDVHSFKWTFTAQHATTDFKYFITKSSWDSSTSASDFESDPFLVVPMNGKPPSASMTHDLTSMPSRSGYHVVYAVWTVDNTANAFYQCI.......................................................................................................................................................................................................................................................... 195
212 4.000e-27UniRef50_UPI000C143CF4 uncharacterized protein LOC111361572 n=1 Tax=Spodoptera litura TaxID=69820 RepID=UPI000C143CF4  ali  45  1.............MKKVMLKAVLVLGLLAGGLSVSATVHAHGYVSSPGSRAYFGSAQGGKLNKDVGRAEWEPQSIEATKNTFIP----GKLASAGVSGFEPLDVQTANRWHKTDITTGPLALTWTLTARHRTSTWDYYITKQGWDPNKPLDIKNFDLIGQVNDNAAIPATTVNHTITIPADRKGYHVIYAVWNVYDTTNAFYQAID......................................................................................................................................................................................................................................................... 190
213 4.000e-27UniRef50_A0Q763 Chitin-binding protein n=17 Tax=Francisella TaxID=262 RepID=A0Q763_FRATN  ali  37  1...........MKLNKITLLTGL-------ALLVSSEAYSHGYVESPASRALLCKE---GKNKDCGRAQYEPQSIEQADELFNLGALDNNIGSADVAGFEPLDEQEQSRWAKTVVQPGPLKIKWQFTANHKSKHFKFYITKPNWDPNKLLTRESFEEKPLNCYDPQPTWDGLTFTCT-MPNRSGYQIIMAEWDVDDTRMSFYN............................................................................................................................................................................................................................................................ 191
214 4.000e-27UniRef50_B0TY90 Chitin-binding protein n=10 Tax=Francisella TaxID=262 RepID=B0TY90_FRAP2  ali  38  1...........MKLNKITLATGLI-------LLASTQAYSHGYVESPASRALLCKE---GKNKDCGSAQYEPQSIEQVDELFNLGALDNNIGSADVAGFEALDEQQQSRWAKTVVQPGPLKIKWQFTANHKTKHFKFYITKPNWNPDKLLTRDSFEEQPLNCYDPQPTWDGLTFTCTL-PNRSGYQIIMAEWDVDDTRMSFYN............................................................................................................................................................................................................................................................ 191
215 4.000e-27UniRef50_Z2EBF1 Chitin binding domain protein (Fragment) n=1 Tax=Vibrio parahaemolyticus V-223/04 TaxID=1238219 RepID=Z2EBF1_VIBPH  ali  50  1...........................................................................EGPDGFPETGPRDGKIASAETALAAALDEQTTDRWVKRPIKSGTQTFEWTFTANHVTRDWKYYITKPNWNPNASLSRFDLNPFCVVDGNMVQPPKQMSHQCNVPE-REGYHVILAVWDVGDTAASFYNVIDVKFDGDDPVIPEWTQ.......................................................................................................................................................................................................................................... 147
216 4.000e-27UniRef50_A0A085ZPS7 Uncharacterized protein n=1 Tax=Flavobacterium reichenbachii TaxID=362418 RepID=A0A085ZPS7_9FLAO  ali  30  400.........................................................................................................................................................................................................YRVVHYIEYTGRPSDTTAPTKPTSLVFSNVGNNSAILSWTASSDDSGVTNYIIYRNGTQIETIGNTSYSATGLSASTTYSFYVVAKDAAGNSTASDPQSVTT-----TNVIVPQKPEYLNCYLLSEKEIMIEWDFAANSGPAAKYELYRRTSGSALSIHETPNLSYIDNNTAYNTSYLYKVRAVYTNG-VSDFTTEYAIVTDPRDNSCFDVESLVTMASG.................................. 616
217 4.000e-27UniRef50_A0A178X5P5 GlcNAc-binding protein A n=32 Tax=Actinobacteria TaxID=201174 RepID=A0A178X5P5_9PSEU  ali  38  31........................................HGYVSSPPSRQAQCA----AETVSCGDIKWEPQSVEGPKGL--------QSCSGGNDRFADLDDDS--KGWKLTPVSTQVTFTWTFTARHRTSDYEYFIGGTE--------------VASFSGNDQAPPATVSHQVDL-SGYPGQQKVLAVWNIADTGDAFYACID......................................................................................................................................................................................................................................................... 167
218 4.000e-27UniRef50_A0A1N7E4H4 Cellulose binding domain-containing protein n=4 Tax=Microbispora TaxID=2005 RepID=A0A1N7E4H4_9ACTN  ali  29  92...............................................................................................................................................................................................................................................WTASADDVGVTGYEVYRGFVRAAAPTSTMTVVSGLTIGRTYTFYIVAKDAAGNTSRPTAPFSTSAVTGMSVSPSPGTGDTTPPTRPTGMQANFCWTPSTDDVGVTGYDVYRRTDTAWIPVGTPIGTYFTEGNLVTGQSYVYFMVAQDAAGNLSLPSDLVTATASGGYPTYTPPPVS........................................ 280
219 5.000e-27UniRef50_UPI0009960A98 hypothetical protein n=1 Tax=Bacillus sp. FJAT-44921 TaxID=1912214 RepID=UPI0009960A98  ali  47  36...................................QSASAHGNLMD--SRATLCYE---GVNVNCGRVMYEPYSVEGRGDFPEVGVPDGELASA--SLFLELDEQSYDRWVKVDMQGGPFTFEWRIIANHSTNNWKYYITRVGWDPNAPLQRADLELFCSYYDYGQLPPNRVTNDCVIPNDREGYHVILAVWDIDDTMNAFYQAMDVNLSINPNEPT.............................................................................................................................................................................................................................................. 210
220 5.000e-27UniRef50_C6W882 Chitin-binding domain 3 protein n=87 Tax=Actinobacteria TaxID=201174 RepID=C6W882_ACTMD  ali  35  28....................................QAFAHGYISSPPSRQAQCAQNT----VSCGDIKWEPQSVEGPKGLRS--------CNGGVSRFAELNDN--NKGWRATSTGRTVTFNWTFTARHRTSNYEYYV--------------NGSRVAVVDGGNQIPGAVVTHTVTLPS--SGRQTVLAIWNIGDTTNAFYSCVD......................................................................................................................................................................................................................................................... 167
221 6.000e-27UniRef50_A0A2K8XMH4 Uncharacterized protein n=5 Tax=Flavobacteriales TaxID=200644 RepID=A0A2K8XMH4_9FLAO  ali  27  244....................................................................................................................................................................................................TKIWGGTPAEDYWGIYTSNDAEAPTTPTSVTLSNSTPSSIDVTWSASTDNVAVTKYEIYVDGTLHGNTTNTNYTISGLSANTSYAVTVLAKDIANNKSAKSTAV---NGSTTIDSEAPTVPTNVIITNQTGTSFKANWTASTDNAAVVGYDIFVDG----TYKTSTVNTSYTINGLTVSTTYNVTILAKDGADNKSAQSAAVNAVTTDGSNNVSEYVEGASNNKAIEIANLTDNSIDLSTYQSNGAGSWVNELTLSGTI 504
222 6.000e-27UniRef50_A0A0K6IYT1 GlcNAc-binding protein A n=4 Tax=Bacillaceae TaxID=186817 RepID=A0A0K6IYT1_BACCE  ali  70  215....................................................................................................................................................................................................................................................................................................................PDTEAPTQPKGLHSMGTTTNTIDSMWSTSEDNIDVDHYIVYREIAGDMKKIGTASTNSFSDKYLEANTTYKYVVSAVDTAGNESMKSDILTVTTKGQENSYEQWDAYKAYKKGDRVVYKGKVYEAVQNYQGNGDPKWISALSLWKEV 361
223 7.000e-27UniRef50_UPI0006923FD0 hypothetical protein n=1 Tax=Deinococcus misasensis TaxID=392413 RepID=UPI0006923FD0  ali  22  111................................................................................SPIAVGASYSIGFNGSGTFGATEVSLATVNGQPVGGTPTDTVAPTVPGTPTATNINTNSATLSWPASTDNVGVTRYEI-MLGTTVLASSTTNSVNLTGLDAGVGYSLRIRARDAAGNVSVLSNAVSFITKV--PTDTLAPTAPTAVTVASITSVSAGLRWTASVDNVGVASYEVLNGTTVLATSTTNSVTVSGLRAATAYSLRVRAKDAAGNVSALSTAVNFTTSGAPLDTTPPTVSLSGSATSITTASTLNLTATAADNVGVTRVEFYRGTSLLSTDTTAPYNASLSITSALNGT-HTFTAVAYDAAGNKTTSSAVNVSVNISTGGETPP............................................ 437
224 7.000e-27UniRef50_A0A1T5C8T6 Por secretion system C-terminal sorting domain-containing protein n=2 Tax=Alkalitalea saponilacus TaxID=889453 RepID=A0A1T5C8T6_9  ali  26  457.................................................................................................................................................................................................TNNGDNVGMWEDDSRESAKWELIGVPPAPPTGLSMNYIKHNGVSLSWIGLETNGG---YGVYIDGELGYSTTETTAVIDGLIFNTTYLITVRALDVAGNVSEDSEALEITTLPDPGDEEPPTSPTGLTVVEKTDTSISLTWDESTDNIYVEVYEVYVDDRLEII----TNSNSATISSLVQGTEYSIIVVAVDPSGNSSE-SELFTVMTVDIEAPTTPTDLIAEF-SETTILMSWAASTDNVGVVGYRIYVNNT........ 703
225 8.000e-27UniRef50_A0A1G8EGM9 Fibronectin type III domain-containing protein n=2 Tax=Streptosporangiaceae TaxID=2004 RepID=A0A1G8EGM9_9ACTN  ali  19  163.......................................................................................TGPLPAPTTTPYSFDYNVSAPTEIVIVAFGTTDPTPPTAPPNLRASIITGTSITAAWDPATDNIAVTGYGVYLDNVKQGADQTDLTRVFDGLTTGQTYRIEVDARDAAGNRSPKARIDVMAIV-----DTVPPTVPPNFRTTSIGHTTVAVAWDPATDNVGVAGYGVYLDGVQGGDQTDLTYTFSGLARGTTYSLAVDAVDVSGWGSNVAELVVSTLA-----DTLPSIPPGFAATA-GREQVTLAWQAATDDLGVARYEILLDGD----TVAATGALGHVIDGLDAGGVYEVGVRAVDEAGGRGPA-ATLTVQVPAAGVAASSPVYRLGGWVGNAVDEHGVLWT....................... 493
226 8.000e-27UniRef50_A0A242K538 Uncharacterized protein n=4 Tax=Lactobacillales TaxID=186826 RepID=A0A242K538_9ENTE  ali  41  1.............MKKVLLKTILALGLFTVGTVAAATVSAHGYISSPGSRAYFGTAAGGKLNTNVGRAEWEPQSIEATKGVF----TNGKLASAGVSGFEPLDEQTATRWHKTTVSTGLLPLRWTLTAQHRTSTWDYYMTKQGWDQNAPLKMSDFEMIGQVNDNNAIPGATVNHTVTIPSNRSGYHIVYGVWNVADTTNAFYQ............................................................................................................................................................................................................................................................ 187
227 8.000e-27UniRef50_A0A2W4J9U0 Chitin-binding protein (Fragment) n=2 Tax=Thermocrispum agreste TaxID=37925 RepID=A0A2W4J9U0_9PSEU  ali  37  2..........RMKRSLLALGGIGALTTAGLVMMPSPAAQAHGHVESPPSRQAQCRNGT----VECGPIVYEPQSVEGPKG--------QRNCSAGDARWAELDDDS--KGWVATPVGDQVTFTWRFTAPHSTANFEYYI--------------GGDLLATIEMRGERPAETVSHVIDLSR-YSGRQKVLAVWNIGDTSNAFYSCVD......................................................................................................................................................................................................................................................... 168
228 8.000e-27UniRef50_R4SK17 Chitin-binding protein n=216 Tax=Actinobacteria TaxID=201174 RepID=R4SK17_AMYOR  ali  42  30......................................SAHGYVSSPASRQAQCAQNT----VSCGSIKWEPQSVEGPKG----------LMSCNGGVGRFADLNDDSKGWKVHSLGRTTTFRWTLTARHRTSTWEYFV--------------DGAKVASFNDGGAQPGATVTHSVNL--QQSGRHKILARWNVYDTANAFYACID......................................................................................................................................................................................................................................................... 167
229 8.000e-27UniRef50_UPI000B5A3502 hypothetical protein n=1 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5A3502  ali  27  197....................................................................................................................................................................................ENGGRQITIVITDPASKIQTSTNADILLGVVEGVSDTQPPSMPSDLRVLNGVSGEPVLVWEPSTDNTVVIGYDVLRDGQLIATTPYPVYTDTGASAAAFHFYEVQSIDTAGN--RSAAAQVSTDSVVDGGGEALSTPVNVVSVVSTTQRVELSWTQDRIDV-VAGFNIYRGPSVSSLPLVRVSSTSVTDATISAGQEYWYAVTAVDARGNESPQSEPLRVLTTGIALTPPESSPQTV...................................... 433
230 1.000e-26UniRef50_A0A2G7DIR5 F5/8 type C domain-containing protein n=1 Tax=Streptomyces sp. 1 TaxID=492776 RepID=A0A2G7DIR5_9ACTN  ali  25  276.................................................................................................................................................................................TVSLPTATTRWVRLLFTANSAWPAAQLSEFEAYGPAGGDTQAPTAPPNLTYSQPEPGRIRLAWGAATDNTGVTGYEVYANGQLAASVGGDVLTWTDTRPASTVTYTVRAKDAAGNRSNPSAPVTRTGED-PGDTVKPTAPGRLALTEPTAGQIALSWDAATDNVGVTGYQVYADGQLKASTAGTVR--TWTDSQPASATV-TYTVRAKDAAGNLSDPSNAVTRTGDPGAPGSNLAAGKPVEASGQAWTFAPANANDGSTATYWEGNSGAFPNTLT... 547
231 1.000e-26UniRef50_A0A1H8FBJ5 Fibronectin type III domain-containing protein n=1 Tax=Paenibacillus sophorae TaxID=1333845 RepID=A0A1H8FBJ5_9BACL  ali  19  415............................................................................................................................................TSDGTAAAGTDYVPVDEVLTFDEGETSKTVTIPVIDNAVYSAADRSFRVSPTNGATLGAADSVTVAIHEDDASDSDAPVWPVNGEIKFTNVSHTAITLNWPEAVDDTGVTGYAVYMDGARLNTVTGSTYSISGLAPATAYHFSITAVDAYNHESAGLTGMAATLPNSSDDTTAPVWPSGLILSNVSPSGVTLNWPEAVDDTGVSGYAVYMDGARLNT--VTGSTYSYDISGLAPATAYHFSITAVDAYNHESAGLTGMAATLPSDDTTAPVWPSGSSNVSRSGVTLNWPEASDDVGTAGYEIYKDGAGLNTVT.. 742
232 1.000e-26UniRef50_A0A1G2DCD3 Uncharacterized protein n=1 Tax=Candidatus Lloydbacteria bacterium RIFCSPHIGHO2_02_FULL_54_17 TaxID=1798664 RepID=A0A1G2DCD3_9BAC  ali  21  40..............................................................................................................................TINITGSGAQINWTTDIASDSQVNYGLASDNLSGYSTSRCDGGGMVLTHCTGLSPSTLYYYKVT--SCAEGQGCGEASNTFTSTSXXXXXXXXXXXXTGFTNGTPTSTSIPLSWNASANATHYYLEREVANSQSWSQQTGTSHTDTDLASATTYNYRIEACRE-GYGCSDYVYLMGVSTPAAPDTTAPSMPTGLYTSTVSSSQVNLYWTSSTDNVSVTGYKVYRNG----TQITTVTSPYYNDTGLAAGMSYSYTVKAYDAAGNESPVSSSVNGNTSSGGEGDTTAPTTPSGITSSQIVLTWTASTDNVGVTGYKVYRNGT........ 364
233 1.000e-26UniRef50_UPI0004651970 hypothetical protein n=1 Tax=Marinimicrobium sp. LS-A18 TaxID=1381596 RepID=UPI0004651970  ali  34  8..............FHKTIGFSAVTVMAAAVSMFSQQALAHGYLE--GERGDLC---VQGVNQSCSNV--DPADTEHPGTFPQGGPPDGQIASATRP-YDVLDEQSEDRWYKTGMSPGKNDFTWNIPAQHISDNFRYYITKPGWNSNAPLSRSAFESTPFCEIEDEGLPGNPTHECNV-PERNGYHIILAVWQVAYTGAEFYSVLDVNMDGEPQDPTDPTDPGTGGVINGDFESGDFNGWNVYGGNAGVDSYNTYEGQGKAYFWGDSGYTVTGLEDGT---YTISAM........................................................................................................................................................................ 277
234 1.000e-26UniRef50_A0A1I0V7K8 Fibronectin type III domain-containing protein n=1 Tax=Cohnella sp. OV330 TaxID=1855288 RepID=A0A1I0V7K8_9BACL  ali  21 1015...................................................................LFQEAESFAGYGGKAPTRYTTRPFLSGGTGVSEWNQIGQSIQWRFNVPKAGKYDLVVKYLAGWDLPS-EPVEDSTSIRFVKLGDKMNYFKAPKTINDFSDPKQWRGLRVKLDQSLPAGPVDLTMWHQRG-----GMNLDWIALVEVKDDEIIPSAPGNLRLDAQTSDSVKLSWDAASDNVEVKEYHVFANGVRVVPAGALSAKIEGLSMGNAYTFTVRAVDTSDNLSKASNELAVT--ITDTVAPAWGDAPSISPVLTFPNAVRLAWTPATDIGPVTAYELRVSKDGSPVLEVSVAGVTYDVTGLQPGGTYSFKVEAVDEHGNRSVDGPEVTVTLPPASAAFYDSPGEASDGKGWTFTKNNGTSVGLQAVDNYHDPANPSAVTPW... 1410
235 1.000e-26UniRef50_R2SIP2 Uncharacterized protein n=47 Tax=Bacteria TaxID=2 RepID=R2SIP2_9ENTE  ali  40  1.............MKKKSLTLCLLALGVTGLTMFSGGASAHGYVNQPASRVVNAKANGFGWGPGHPEIISTPQGVEAPTADLDSGKLNGKLASAGLDVYSPLNEQTSSRWVKNTISTGENNFNWHHTAVHKTNRYRYYMTKQGWNQNEPLTLKNMDLIKVIGGEGFTPAVDEMQQVNIPTDRSGYHVVYAVWDINDTINSFFQAIDVN....................................................................................................................................................................................................................................................... 210
236 1.000e-26UniRef50_A0A1R1GAH5 Uncharacterized protein n=2 Tax=Paenibacillus sp. FSL R7-0337 TaxID=1926588 RepID=A0A1R1GAH5_9BACL  ali  26  25.............................................................................................................................................................................YDVTNLTPETKYT-IQQVWHV-DSSSDWNRQEQTQSVIPTFSDTELPSAPTGLVSETFDYTNVYLSWNAATDNVGIKQYNIYNGDSLIGVTPNTNFLVPNISVPSINRFKVKAVDEANNISLASNISIIDFSDITRPTTP----TNLAYRDVKLNSVTLYWTPSTDSSGISKYIIHDQKTGKAYI---STEPKYTINDLKSYSTYSYAVTAFDLLGNRSHSSEVLQVTT--DGYTNKSIEVIENGLLTNEGPYNARTYQNGKTF.................. 277
237 1.000e-26UniRef50_UPI000DAC7F1B fibronectin type III domain-containing protein n=1 Tax=Flavobacterium tistrianum TaxID=1685414 RepID=UPI000DAC7F1B  ali  32  89.............................................................................................................................................................................................SVLDANNQAIAWLDANAHIYANNMCILDTIPPSASVLTASSITSNSLKLSWTAATDNLGIVGYEIYQNNVFLTSTTTSQYDVTGLASNTSYNFYVKAKDTAGNS-STSNTITATINAAAADTTAPTVPANFWCVPVGSDNVHLEWTPSEDENSPINYELSRGFYGSFVVLKTNPDTFYSDKVLS-NGTYTYRLRAIDPSGNASTY-KEVSIT...................................................... 301
238 2.000e-26UniRef50_A0A132TGC7 Endo-inulinase n=7 Tax=Paenibacillus TaxID=44249 RepID=A0A132TGC7_9BACL  ali  19  761......................................................................SPASLQVAVGGKKTLNADVAPANATNKNVIWSSSNTSVASVVNGVVTGKSAGSATITAQTRDGAKAASSTVTIVAAPAANIANNGFESGNLDGWIIESGTAFSNSGNNQPYNHAGNYHLLGELSGGNAATGVLKSNEFTLGGNGQVSFLIGGGSDIDKLYVSFVRASDGKELFRSSGPG-SYWNWPSTKGVTEGYTKRSWDATQYIGTPMYIKIVDERTDDWGHINVDDFIVPIQGGTVDAEAPAAPKNLAATGITPSSVTLGWTASTDNVGVTGYLIYRGG----VQVATSTTTTYTDSGLTAETAYTYTVKAKDAAGNISAASNSVTATTQAAQVIGSLTNHDFESGNLSGWTIVSGNAFSDADVVADTNWGWGGPFNQSG.. 1146
239 2.000e-26UniRef50_A0A1L3JGV9 Uncharacterized protein n=5 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1L3JGV9_9FLAO  ali  27  251....................................................................................................................................................................................................TRIWGGDAAIDSWGIYTSTDTEAPTVPTDLALSNITTTSIDATWTASTDNEAVTKYEIYVDGTLNDETANTTFTITGLTPNTTYAVSVLAKDIANNKSDQTTAVNGT---TLSDSTPPTVPTAVTISNETGTSFKASWSASTDDSGVASYDVFIDG----VLNGNTTNTEFVVTGLTISTTYTVTVLAKDAANNQSAQSAPVNGTTTDGTSSVAEYVEGGGYNKALEIVNLTANPVDLSTYSVKRNGTWETALNLSGSI 509
240 2.000e-26UniRef50_A0A118RWL4 Uncharacterized protein n=4 Tax=Burkholderia ubonensis TaxID=101571 RepID=A0A118RWL4_9BURK  ali  45  1...............................MLFAQNAMAHGYVQSPPSRNYKCWASYPGKDKNCGAIQWEPQSLEAASGFPVDGPRDKELASANGTRGHALDEQTSERWTKTDVTPGPLNFTWHFTAGHPARYFHYFITKKGWNPNAPLTRDQFESQPFCYGTGSAAQGTDTMTCTIPSDHSGYNVIYAEWKVDNTANSFWNAIDVNIKNGDPGPGPAPITWNTVGTIY................................................................................................................................................................................................................................. 213
241 2.000e-26UniRef50_W7CI08 Uncharacterized protein n=2 Tax=Listeria TaxID=1637 RepID=W7CI08_9LIST  ali  46  29........................................HGYISKPESRAYLAKL---GINQNAGAIQWEPQSVEATGNFPLGGPSDGTIAGGG--KFPEMDAQTPDRWHHVDLLGGQNNFTWTLTALHRTKEYKYYITKKRLEPKQPAY................................................................................................................................................................................................................................................................................................................ 134
242 2.000e-26UniRef50_A0A0U5H4C3 GlcNAc-binding protein A n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A0U5H4C3_STRRE  ali  37  14.....................................TPRHGWMTEPPSRAQL---LFDDPYPSC--------ALEAGKFFPATPPPDGKIASAGYPHGGAPQLDEVRDWPKVELVSGRQKVVWSFRQRHKTRRYNYFVTREDWDPAQPLSRAQFEPFARLEPNGPPAREPVEHKITLP-QRKGYHVILGVWEVADTGAACYQVIDAHF...................................................................................................................................................................................................................................................... 202
243 2.000e-26UniRef50_A0A1H0I8T8 Chitin-binding protein n=8 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A1H0I8T8_9PSEU  ali  36  31.......................................AHGYVSAPASRQAQCAS---GVVKDCGSIQWEPQSVEGPKGL--------QSCHANLSQFSVLSND--NKGWRVHNTGRSVTFNWTFTARHRTRDYDYFV--------------DGRKVATFSGNNQQPPATVSHTVNVGSP--GRHKVLAVWNIGDTPMAFYSCIDIN....................................................................................................................................................................................................................................................... 170
244 2.000e-26UniRef50_E3FCP9 Chitinase n=149 Tax=Bacteria TaxID=2 RepID=E3FCP9_STIAD  ali  29  104.......................................................................................................................................................................................................................DTQAPSVPANLTSPSKTSTSVSLSWSASNDNVGVTGYDVYRGTALAGTTASTSFTVSGLTANTAYTFSVRAKDAAGNVSAASNTLSVTTSAAGATCSALPSVPNSPSKSSSSVSLAWSASSPGTNCSIAGYDIYNGSTRVGQTSGT--GTDFTVSGLNANTAYTFSVAARNEFG-ASARSAGLNVTTSPNSGGGGAIILGYFAQWG.................................. 309
245 3.000e-26UniRef50_D2TXX3 N-acetylglucosamine-binding protein n=2 Tax=Arsenophonus nasoniae TaxID=638 RepID=D2TXX3_9GAMM  ali  41  1...........................MSIILTASSTLWAHGYIKSPASRAYKCAQ---GINKDCGDIKYEPQSVEQRSGFPDNFPIDGKLASGGIQRFAKLDEAGENRWHKTQMHVGDNNFSWYLTARHSTANWRYYITKNGWNPNVPLTRAAFDPFCTQYDGGAIPKADVSIICEVPVDRIGYHIIYGVWQIADTSNSFYQVVDVIFP..................................................................................................................................................................................................................................................... 183
246 3.000e-26UniRef50_A0A1N6VM17 Chitin-binding protein n=1 Tax=Paenibacillus macquariensis TaxID=948756 RepID=A0A1N6VM17_9BACL  ali  52  5.......RLTHLSVSKXXXXXXXXXXXXXXXXXXXXTAFGHGYVEGPASRAALCKS---GQNNDCGSIIYEPQSLEAPTGFPEKGPVDGKIASANGA-FSKLDEQSATRWSKVNLSSRRNTFTWKISAAHATTSWKY.............................................................................................................................................................................................................................................................................................................................. 130
247 3.000e-26UniRef50_A0A1H7HKP6 Por secretion system C-terminal sorting domain-containing protein n=1 Tax=Aquimarina amphilecti TaxID=1038014 RepID=A0A1H7HKP6_9F  ali  25  7....TKEILCNIRFLKKTYSLRVLCCT---ALFFTSNISPHGTVTSPPSRVWVCFQENPEVASHGTQALYDWNEVADANGMHRDIIDDGNLASAGRPDKYGGLDQVRDDWVATPVSPGPLTLTWSITAPHATLYYEVYITKEGWTPNDPLTWDSLELLK---RTGELPLSSEDNIDVVLPNRTGKHVIYSIWQRSLSPEAFYSTSDVDFGNTLSIDELEKSSAGLEQNFPNPFTSQSTIKYNLSKEVNITVYNIY........................................................................................................................................................................................................ 265
248 3.000e-26UniRef50_A0A125E3Y9 Chitin-binding protein n=90 Tax=Proteobacteria TaxID=1224 RepID=A0A125E3Y9_9BURK  ali  36  4........................ALAGAALLSVMAGAHAHGRLTEPASRIVLC---TQGQNPNCPIDAWHANAMENGKFFPATPPKDGEIAGASTNGAVPLNEQSPDRWQKVPLRSGAQNFKWEFSAVHKTRRWNYFVTRADWNPSQKLTRAQFEPFCTIQNPGQPPSQPTIHQCRLPV-RTGYHVILAVWEVADTSMGFYQVVDAIFTDGSTT................................................................................................................................................................................................................................................ 220
249 4.000e-26UniRef50_UPI000B592FAB chitin-binding protein n=1 Tax=Listeria sp. ILCC801 TaxID=1649188 RepID=UPI000B592FAB  ali  47  2.............KNFFGKSAVFLGAIALTVSGATVGVSAHGYISKPESRAYLAKL---GVNQNAGPIQYEPQSVEATGNFPTGGPADGQI--AGGGKFSDMDVQTDSRWSKVNLTGGANTIEWTLTALHRTSEWKYYMTKKDWNPNEPITRASLEHLQTIDAGNTIPTTKVTQTVNLPTDRSGYYVLLGVWEIADTGNAFYQ............................................................................................................................................................................................................................................................ 186
250 4.000e-26UniRef50_A0A068YVP5 CBP21 domain protein n=2 Tax=Serratia symbiotica TaxID=138074 RepID=A0A068YVP5_9GAMM  ali  48  1...........MKLNKIAIA--------VASLLVSGAALSHGYVMDPPARAYLCSSNAVGTNKGCGNIQYEPQSLEAHKGFPHGGVVDGQIASANRVRGGELDVQNMDRWAKTPISAGKNQFHWTFTAAHPTTKYEYFITKNHWNPNAPLTRASFEPFCTIQRNGAVPGRGPSVHTCDVPAREGYQEILAVWTVDDTSNAFYNVID......................................................................................................................................................................................................................................................... 194
251 4.000e-26UniRef50_UPI00034555C4 hypothetical protein n=1 Tax=Pseudomonas sp. CBZ-4 TaxID=1163065 RepID=UPI00034555C4  ali  38  1...........MRNSQRFTKSLIKLVLPALLLLPTLHALAHGYLDGDSSRARLCQT---GVNTNCGGAQYEPQSTGGSGGSAGQGPKDGQIASGGNSLFSALDAQTETRWKKIEITDQNIVFVWKYLAPHPVDFHKYFITKNNWDHNKPLTRASFEPFCIFPGSGVMPVPDTKHACVIPPGKDGYHVILGIWGVRDTKMAFHDPVDVM....................................................................................................................................................................................................................................................... 205
252 4.000e-26UniRef50_A0A127PCW4 CBP21 n=2 Tax=Collimonas fungivorans TaxID=158899 RepID=A0A127PCW4_9BURK  ali  51  1..................................................................................................................MKAGQNDFTWYFTAGHMTQDWRYYITRQGWNPNQKLSRADLQPFCVIKGGFAPVSNHVKHSCTIPAGRSGYHVILSTWNIADTGNAFYQVIDAEL...................................................................................................................................................................................................................................................... 98
253 6.000e-26UniRef50_A6F7N7 Uncharacterized protein conserved in bacteria n=7 Tax=Alteromonadales TaxID=135622 RepID=A6F7N7_9GAMM  ali  45  22................KKIILTSLSALAVSAALVPTVAIAHGYVAGFPSRVNLCHSDNGSKN-DCASASYDRQSLEAPKGFPATGPVDGKIASAQGGSFDVLDLQSSNQWYKTKIQAGLNDFHWFSTANHKTTDYVYYITKPDWDQNAPLTRASFDPFCVIDMDGQQPLKNLGNHSCNVPARSGYQVILSVWTIDDTANAFYNVIDVEFEDGVTPPP.............................................................................................................................................................................................................................................. 227
254 6.000e-26UniRef50_A0A1Y5JZZ1 Uncharacterized protein n=1 Tax=Paenibacillus sp. MY03 TaxID=302980 RepID=A0A1Y5JZZ1_9BACL  ali  19  995...............................................................DHTAVWKEAETFTATSGGDTSIYTTRSFLSGGAGMGNWLMPGQRIRWKLEVPQNGVYDLVLKYVAGYDLKPGEK---------TSRYTEIDGER-YYFEAEPTADYGTTPESWRGLRVRLNKELTAGPIELELTHTFGQMNLDWIGLAPSSSDVIPPSTPGNVLVESAENEEATISWDSASDNVAVSHYVIMLDGTAHGQVTADTYTITGLDPGRRYAVAIYAVDTSGNRSAATNIEIVT---EDTAPPVWGAGAVLETDLLLPTMARLNWSGAEDDMASLSYHVYQTGSAGKQLIATVSNSVYDVMNLTPSASYTFSVEAMDGSGNISTGGPSLNFDTPATNPYNGIFDFYDDWPTG---PFSGGAYGYTVATGT................ 1358
255 7.000e-26UniRef50_S9SS58 Quinoprotein glucose dehydrogenase n=10 Tax=Paenibacillus TaxID=44249 RepID=S9SS58_PAEAL  ali  24  197.........................................................................................................................................................................................................................................................................................YVGLAVTSHNVSSLSTATFDKVKVNATGDVFPPTEPTNLQANQVTDTTANISWTASLDDVGVKGYDLYKDNVLTQ---ANVQDTSYTFTGLTPDTTYQFTVKAKDAAGNISNASSPLTVKTTNQTDTQAPTAPTGLSKTSSSVNLSWTASTDNVSVYAYDIYKNGT........ 362
256 8.000e-26UniRef50_A4FN78 Chitin-binding protein n=1 Tax=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL  ali  29  1...........MNLRRKAAAAATLGLSIVGTLLAPQAAFAHGDMQAPAGRAYTCYLEGAETPQSEGAPIYDWMSIGDANGRHQELIPDGRLCSANNPQFSGFD-KPATAWPTTQLKTGDVAFDFKATAKH-KGYFDLYITKDGWDPTQPLGWDDLEPFMHVE-NPPDTAEGYSLAGKVPEGKTGRHVIYTIWQRTDSPEAFYSCSD......................................................................................................................................................................................................................................................... 207
257 8.000e-26UniRef50_A0A1H6EWV5 Chitin-binding protein n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A1H6EWV5_9ACTN  ali  28  1..............MRKTTIAAAVATSGVLALLPASAANAHGTMSNPPSRVYVCKNEGPESPKGGTQAYYDWNSLLEAGGRHRQIIPDGKLCSAGREKYRGLDLQRAD-WPATQVKPGNFQLTYHATAPHANSNFEFYITRQGWNPTMPLKWSDLVHIKTF--NGQNPTTFTNWTINLPQ-RSGRHIIYSIWQRVVGSNEAFYTCS......................................................................................................................................................................................................................................................... 200
258 9.000e-26UniRef50_A0A1A9LDK0 Uncharacterized protein n=1 Tax=Aequorivita soesokkakensis TaxID=1385699 RepID=A0A1A9LDK0_9FLAO  ali  17  491..............................................................................GGQYWQNPNCGTPTQYNDYCGVHTNSGVLNHWFYRTVVGGSGT-------NDIGNSFNISGIGMTKASNIAYRTLSFYLSANSTYANARTGAIQAAIDLYGAGSAEEEAVTNAWYAVGVGSAYDGGGDPPPGDCQTGDIYTFDNYPEETGWTLKNSSGTTIDSASYTSANPDGSTVTRTFSSLA-VGDYTFTITDAYGDGICCSYGNGSYTGGSFGSSETTAFCIEAGTGGDTQAPSTPTNLVASNVTQTTATLSWNASTDNVGVTGYDVFQGS----TNIGTVTGTSANITGLVASTAYSFKVRAHDAAGNNSGFSNTVNFTTQSNSITYCASKGNNSSNNLNKSSGNDGGYKDNTSLSANVGYGSNT........ 869
259 9.000e-26UniRef50_A0A2U9T3J0 Cellulose-binding protein n=1 Tax=Lysobacter maris TaxID=1605891 RepID=A0A2U9T3J0_9GAMM  ali  26  20................RPLAIQLIAAGLLLSALPAQQARAHGTMVKPVSRIYACAQCRAAWQVAGPQLFYDWMGINQADGNHQAVVPDGKLCSGNNPTFRGLDL-VRDDWQASDIAPGRYTFQFKGTAPHATRDWVFYVTRDGWDPNSVLKWSDLEEFCRVGNTPLSADGNYLLSCALPQ-RSGRHVIYNTWQRSDSTEAFYTCMDVKFAGGGDPPPPPQWRDAGALIAQNPLPVGTTVTLRVFNADGSDAERIETDSTGQGTTTG............................................................................................................................................................................................. 284
260 9.000e-26UniRef50_A0A0Q8P755 Oxidoreductase n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q8P755_9ACTN  ali  24  46................................................................................................................TNIAGSYVEFTVSAATAGSAALAFRYANAGTADRPMDIAVNGTVVAAGVGFPPTASWDTWTKTVNAALLAGTNKVRATATTANGGPNLDRLQV------GTGADTSAPSRPGAPSCSAVGANSLTLSWGASTDTVGVSAYDIYEHGNKIGEAPGTAKQLTGLTPSTTYNLTVIARDASGNASAASTPVDCTTLAGTD--PPPSRPGTPTVSAVNSTGATLTWAASTDDKGVVAYEIRSGSAVVKTVTGTPPATSTVVTGLACDAPFALTVVAQDTAGGYSTPSAAVSFTTGACSADGGVPGSPTTLSSGWTIPWG............................ 355
261 1.000e-25UniRef50_A0A2G1BWS1 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2G1BWS1_9FLAO  ali  19  473..................................................AILATQLGVWSTSNFNDANPNWNQAYNGMSDVSVTSFDYWNVSGDHTTNKASTYGRGVFTGSFTSNAAADTEAPSAPTSLAASSITATSLTLNWTASTDNIAVTGYDVYQGATK-IGSSTTTSYNVTGLTASTAYTFTVKAKDAAGNISGDSNTVNVTTTAATITYCTSKGDSVSDEYIGSNTITITPTWTGSSYDEGYAGETVWTKAKSKDTPVSTSFTVPSSALDGATRMRIVMKYNATPTACEASFSYVNIGAAVADTQAPTAPSSLASSNVAQTTLTLSWIASTDNVGVTGYDVYQG----ATKLTTVTTTSYNVTGLTANTAYTFSVKAKDAAGNISSASNTVNVTTLDNVVSYCSSKGNRVTYEWIDYVSFGGMTNTTSANGGYGDFTNKVATVTQGT. 925
262 1.000e-25UniRef50_F8G8G3 Chitin binding protein n=2 Tax=Francisella TaxID=262 RepID=F8G8G3_FRAST  ali  37  1...........MKLKKLTILTGL-------ALLASSEAYSHGWVTAPASRVDLCDR---GINKGCGNAIYEPQSMEYGDGRFQNGKMDGEIGGSGVSGYELMNEQSSSRWAKVVVRSGPTKFTWKFTAPHVTTSFRFYITKQNWNPNEPLKRDEFETQPLNYFAGKSQPNNPQSLTCDLPDRSGYQVIFAEWDVGDTGASFGNVIDVDFTNEHP................................................................................................................................................................................................................................................. 203
263 2.000e-25UniRef50_A0A1X7JNR6 Carbohydrate binding domain-containing protein n=10 Tax=Firmicutes TaxID=1239 RepID=A0A1X7JNR6_9BACL  ali  19  362..................................................................................................................................STYPNGQYVTMSGTSMATPHVAGVLGLMRSVNPNLTPSEARNILRNTAQPAGNMNQYGYGIVDAYAAVIAAGGNVPQPIKETNTTLQTDKTVYQRGENINITSSVTDTQGNALQGATVNFKLTRPNGTTLTNTVASWTITSNAQTPLGTYQILAETTLSGYSPSSAQTTLQINDSSGGGDTQAPSAPSNVMSTAKTSTSVTLSWNASTDNVGVTAYEVYNGSSLAATVTNTTATI----TGLTASSTYTFTVKAVDAAGNRSAASNAVTVTTDSSQPSPTSWAPGVSYKIGDEVTYGGATYKCLQAHTSMVGWEPSIVPALW... 686
264 2.000e-25UniRef50_A0A2V8DNJ6 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8DNJ6_9BACT  ali  29  2.........................................................................................................................................................TGYRVYRAGTLLATLGAVTAYQNTGLTPSTSYSYTVQALDAA--GNASAQSASAGATTQVAPDTQAPSVPTGLTGTAVSATQINLTWNASTDNVAVTSYQVYLNDAMIANTPATSFQHTGLTAGTTYNYRVSAADAVPNYSAWTVPPVSVATPAAADTTAPSTPTGLLASAVSSSQINLSWAASTDNVGVTGYRVYRAGTLLATLGV---VTTYQNTGLTPSTTYSYTVQALDAAGNASAQSASASATTQAASDTTAPSVPAAAAVSSSQINLSWSASTDNVGVTGYRVYRAGTLLATLGAV 301
265 2.000e-25UniRef50_Q82CW5 Putative chitin-binding protein, secreted n=45 Tax=Actinobacteria TaxID=201174 RepID=Q82CW5_STRAW  ali  44  20..............KAKVYAAVIGLATAGTFVLSTGPAGAHGYTDQPLSRQKMCATGGSVAN--CGDIQWEPQSVEGPKGFPAGGPADGQICSAGHSNFGQLNTPAGTAWPTTRVTGGSYSFRWQFTASHATTDFKYYVTKAGWNQNHALTRADLTPFLTVPYNNQRPPSTLSHSGTLPTGLSGHHVILGVWTIADTANAFYSCADVTF...................................................................................................................................................................................................................................................... 218
266 3.000e-25UniRef50_A0A1K1N720 Chitinase A, N-terminal domain n=1 Tax=Paenibacillus sp. UNCCL117 TaxID=1502764 RepID=A0A1K1N720_9BACL  ali  23 1013...................................................................LFQEAEAFIGYGGKAPTRYTTRPFLSGGAGVTTWDQIGQSIQWRFNVPKAGKYDLVIKYVAGWDLPSEPVEDSTSIRFIKIGDKMNYFEAPKTISF-GADPSQWRGLRVKTDQQLPAGPVDLTMWHQRG-----GMNLDWIALVEVKDDEILPTAPGNLRLDSQTSESVEVSWDASSDNVAVKEYHVFANGERVVPAGILTAKIGGLSMGNAYTFTVKAVDTSDNLSKASNELAITIVDTSAPT--WGETPSISPMLTFPNAVRLLWTQATDIGPVTSYKLSVSKDGSPVLEQTVTGVTYDVTNLQPGGTYRFKVEAVDEHGNRSVDGPEVAVTLPMTGAGF--YDSFDDWQPGDANDGKGWTFTKNNGTSVVVTP............ 1381
267 4.000e-25UniRef50_A0A2V8HPU3 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8HPU3_9BACT  ali  22  504...............................................................................................................................ATNQTRWNASEIPAGNPVPGTQTLPASLFLAAKPSWWGTMPWPAIGPDVTGGYDQAGHVYKVCYDTSAKNADGSLIFDPVQCYPTGPADTTAPTVSITAPAAGAVVSGSVTITASASDNVGVAGVRFKVDATDIGSEVTTAPWNTTGVVNGSHNLTAVARDAAGNTKTSTAVSV--TVNNVPDTTPPSAPSNVAATAVSFSQINLTWTAASDNVGVTGYRVLRCGCAPTAQVAAPAGTSYSDTNLTPGTSYSYKVSAVDAATNVSAPSAAATAVTQALPPSTFGLIAGYSFSEGSGTIAADISANSNTATLSGASWT........... 829
268 4.000e-25UniRef50_UPI000A44E329 chitin-binding protein n=1 Tax=Enterococcus faecalis TaxID=1351 RepID=UPI000A44E329  ali  51  28.......................................AHGYVASPGSRAFFGSSADGNLNTNVGRAQWEPQSIEAPK----NTFITGKLASAGVSGFEPLDEQTATRWHKTNITTGPLDITWNLTAQHRTASWDYYITKNGWNPNQPLD................................................................................................................................................................................................................................................................................................................ 135
269 5.000e-25UniRef50_A0A1G9DRS3 Chitin-binding protein n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A1G9DRS3_9ACTN  ali  34  1...........MRKSRKXXXXXXXXXXXXXXXXXXXXAWGHGYTSDPPSRSALCAS---GEVTNCGNISYEPQSVEGPKGFPAAGPVDGEICSGGNDPFAQLDDPRGGNWPTTSVSAGPKTFTWTMTARHSTATFDYYITNSSYDPAQPLTRSDLTPIASFSMGGAQPDHTMTHTVTLPS-RTGQHLVLAVWNIADTANAFYSCMDVEFSGGGPGDPSDPPTTTDPGTGEGCSAGAWAAASVYTGGSKVTHEGAAY---------TASWWTQGEEPGTTGEWGVW.......................................................................................................................................................................... 263
270 8.000e-25UniRef50_UPI000996CC75 hypothetical protein n=1 Tax=Paenibacillus selenitireducens TaxID=1324314 RepID=UPI000996CC75  ali  28  96...................................................................................................................................................................................................................................................................................ASGTYVYKVELINTAGTSVSNNLTYTVTGGTGGGDTQAPTAPTNLTSTAKTASTIDLTWSASTDNIGVTGYEVFKDG----VSIGTTTSTSFPVTGLSANTAYAFTVKAKDAAGNVSPASNSLSVTTDPLPAPSVPGNLIATAKTSTSVALSWSPSTDNVAVTGYNIFKDGISAGTSTS. 274
271 1.000e-24UniRef50_UPI0006991C2C T9SS C-terminal target domain-containing protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=UPI0006991C2C  ali  15  526............................................................................................SGTNDIGNAFNVSGIGMTKSAKIAYRTLTQYLSANSTFANARTGASARDLYGAGGAEEIAVTNAWHAVGVGAAFGGGGGTSYCASTSSNVNDEYISRVQLNTINNASGAQSYSNFTAVATTLAKGSTHTVTITPTWTGTKYNEAFAVWIDYNGDKDFSGEQLGTVAPNQNATSSITFTVPTTASATSTRMRVSMQYNAVPTACQSFTYGEVEDGTASDTQAPSAPGSLSASGTTQTTTNLSWTASTDNVGVTGYEVFQGS----TSLGTVTATSANVTGLTASTTYSFTVKAKDAAGNTSASSNAVSVTTLSDTPSGGCTGGIASFPYGESFESGLGAWTQATGDDLNWTRDSGGTPS..... 889
272 1.000e-24UniRef50_G0FM49 Glucose dehydrogenase n=37 Tax=Bacteria TaxID=2 RepID=G0FM49_AMYMS  ali  24  53....................................................................................................VGNSTAAKTRVNIYDCNGHANQAWTFTAAGELRDVAGASTTSPAEAQIYPCNGGANQKWRINADGTITGVQSGLCLDVTGAGTANSTLVGLYTCTGG--------DNQKWRTSLGDTQPPSVPGNPRVSDLVCDAVTFSWDASTDNVGVAFYDIYHDGQSMKSVSGTTLSTSTVVAGAAWGLYVNARDAAGNVSQAGATVSIKPPPCQPDDQAPSAPTNLTA-AASGTTVTLNWAAATDNIGVRAYDVYRGGAKVGAVTGTATATTFVDSGLAANTSYSYYVVARDAQAN................................................................. 345
273 1.000e-24UniRef50_A0A2N2D339 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-15 TaxID=2013776 RepID=A0A2N2D339_9FIRM  ali  22  294..............................................................................................................PRLTLNSESLSFEWDSLTDASNFNISGYNLYASRDPYWSLVKINAEPI-------TGNAYTTTLAAAGLDAANSYYFRYTAVNAGGETGFSPYVSSDANLPIWGE-------QSAVTVSNISKDSLTLSWPAATDNSGISSYQIYLNGTLLDNVTGNTYKVTGLNKNTQYNFKIEAGDAAENWTSNGPSITALTALP------------------------LVWDAATDNIAVTKYKLYQDNQVLVELDG--NTTSYTVGGLTSGISYNFKVEAGDAAGNWSSNGPTLTVSTAAPDPPPSASPDGGAVVNGTLVILTTSTQDAIIYYTLDGSPSVDTSTAYTGPI 606
274 2.000e-24UniRef50_A0A1E5HFQ5 Chitin-binding protein n=2 Tax=Enterococcus ureilyticus TaxID=1131292 RepID=A0A1E5HFQ5_9ENTE  ali  46  17................................VSSTITHAHGYVSSPGSRAYFGSAQGGKVNKNVGRAEWEPQSIEATKNTFTP----GKLASAGVSGFEPLDTQTTDRWVKSDIATGPLSIKWTLTAQHRTSTWDYYMTKQGWDPNQPLAINNFDLIGRVDDKGTIPGATVNHTLTVPTDRKGYHVIYAVWNVFDTTNAFYQ............................................................................................................................................................................................................................................................ 183
275 2.000e-24UniRef50_A0A2V8G8H4 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8G8H4_9BACT  ali  22  235...............................................................................................................................ATNQTRWNASEIPAGNPVPGTQTLPASLFLAAKPSWWGTMPWPAIGPDVTGGYDQAGHVYKVCYDTSAKNADGSLIFDPVQCYPTGPADTTAPAVSITAPAAGAVVSGSVTITASASDNVGVAGVRFKVDATDIGSEVTTAPWNTTGVVNGSHNLTAVARDAAGNTKTSTAVSV--TVNNVPDTTPPSAPSNVAATAVSFSQINLTWTAASDNVGVTGYRVLRCGCAPTAQVAAPAGTSYSDTNLTPGTSYSYKVSAVDAATNVSAPSAAATAVTQALPPSTFGLIAGYSFSEGSSTIAADISANSNTATLSGASWT........... 560
276 2.000e-24UniRef50_A0A2T2TWU6 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium QS_3_64_15 TaxID=1919105 RepID=A0A2T2TWU6_9BACT  ali  22  349............................................................................................................................SNPAGEEGGILHEYATGWRW----EGDDGNGYASVMTYEEGDVRVTHYSNPDVDYEGSPTGSYDESSPY---TPADNAKNMAQTAGTVASFRDSIPPSAPTSLAASGDDEAVDLQWDQNTEDDLVA-YRLYRDTAPTPTTIVDTHTDSTVTNGTRYYYRVTAVDRSGNESGFSNQASAV----PSDREAPASPSELTAGLADTLSITLDWTAST-SSDVDAYAIYRETTSNPTVTVEAGTLTYDDEELSENTTYYYRVAALDSSGNRSDYSSEVSTVTGDAIPPAPTELTASAEEDQVNLSWTASGAGDVASY.................. 659
277 3.000e-24UniRef50_UPI00041522FE T9SS C-terminal target domain-containing protein n=2 Tax=Aquimarina TaxID=290174 RepID=UPI00041522FE  ali  16  409......................................................WQNISQGNSRCGTQSNTGNAPTANAGQDYTIPASTPFVLKGNGSDANSGNNLTYCWEQMDAQPATMPPVATSTNGPAFRSLNPTASSDRYMPALPTVIAGQTSSTWEVVPSVSRTMNFRLTVRDNAAGGASSTRITVAGAAGPFVVNSPNSNVSWAAGSTQTVTWAVAGTTANGINATNVDILLSTDGGNTYPITIASAVTNDGSQTITVPNA--------AGTQNRIMVRG--SGHIFYDISNANFTITGSTGGDTQAPSVPTNLVASNITQSSVDLNWNASTDNIGVTGYDVYQGNTVLTTVTSTS----YQVTGLSSNTSYDFSIKAKDAAGNISTASTSVNVTTASQTDTQAPTAPTASNTTQTSTDLNWNASTDNVGVSGYDVYRG.......... 793
278 7.000e-24UniRef50_A0A2N2X3C3 Peptidase M4 n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-4 TaxID=2013694 RepID=A0A2N2X3C3_9BACT  ali  18  532..................................................................................................................................NARTYAIQSATDLYGATSNEVIQVTNAMYAIGVGSAYGGGSTPSYCASKGSNFSYEWIASVKVGAYTTSGAAGYSNFTSETVALTPGQSYAITLTPGFASTTYNEYWKIWIDYNGDMDFAGELVFDAGAMSKAAVSGTINIPSSATGTT-RMRVSMKYNGAQTECETFSYGEVFTSGGADTQAPTAPSSLTASSVTQTTVNLAWNASTDNVGVTAYIVYQGATALGTTTATSAQ----ITGLTAGTSYSFSVKAQDAAGNISAASNTVNVTTQSASDTQVPTVPTNLAASGVSTTSLTLSWNASTDNVGVTGYQVFQNGSLVKTV 860
279 8.000e-24UniRef50_A0A176TDY9 Uncharacterized protein n=2 Tax=Polaribacter atrinae TaxID=1333662 RepID=A0A176TDY9_9FLAO  ali  29  230....................................................................................................................................................................................................TRIWGGDNALDSWGIYLTPDTEAPTVPTDISLSNITTSTIDASWTASTDNEAVTRYEVFANGVLQGNTATTTYTLTGLTPNTSYSITVLAKDIADNKSAQSVAENAT---TLSDVTAPSVPTDITISNQISSGFKINWTASTDDSGVASYDIFIDGSLKE----TVQSTEYQVTGLTASTTYNVTISAKDIAGNVSEQSETVQAITGTENTGTSCGEETFELMPTNDSSYSTRTWTGDNG................... 462
280 1.000e-23UniRef50_A0A2V7FSK7 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V7FSK7_9BACT  ali  32  425.............................................................................................................................................................................................................................NPTNLTATAVSTSQINLAWTAATG--PVTSYRVERCQGAGCTVAGTTYNDTGLTATTSYSYRVRATDAAGNLSGYSNTATATTPAAGD-TTPPTNPSGLTVTAASSSQINTAWTASTDNVGVTGYLVERCGCTTFAQVATVTTISYNDTGLAAATSYSYRVRATDAAGNLSGYSNVASATTGSTPPPIAFVQGNFATPQSPTSTVTVTYTAAQVAGDNVVIVGWNDASSTVTSV 667
281 1.000e-23UniRef50_A0A1K1PPN4 Chitodextrinase n=1 Tax=Paenibacillus sp. UNCCL117 TaxID=1502764 RepID=A0A1K1PPN4_9BACL  ali  20 1033..........................................................................VEADAG--VNVYTTRPFLSGGKGVGNWITPGQKIRWTFDVPKAGTYDLVMKYVAFNVPEGEKASRSVMIGDTAT------AFQLPPTFDWGTQPEYWRGLRVKLGQELPAGPVDISMWN-----DLAGVNLDWIGLIERKNDEVRPVPPTDLNVVSQTGTTAVLAWNASTDNVAVKEYAIYVDGVKVVPSDTLSAAITDLMVGSTYAVTIEAIDTSNNRSLPSTALNVTLADTTAPT--WGETAALRAVHLFSNAARLAWDSATDNSGVASYAIYRQDGAAKVAAVSGAVYGFDVAGLQSGGTYTFQIRATDGQGNESSGGPVLTVTLPAAGSSGDYYESFDDRPTAELAPGGGWSINKNAGTSVQIVP............ 1393
282 2.000e-23UniRef50_A0A2A4EAB0 Uncharacterized protein n=1 Tax=Microbacterium sp. SZ1 TaxID=1849736 RepID=A0A2A4EAB0_9MICO  ali  53  29....................................SASAHGYVGGSASS--LISRAAWAANTDRGGVAFEPQSLEAPKGFPAGGPADGQLASAGGLFGGTLDEQSATRWAKNVVQAGPVQVSWTLTAAHRTAQWRYFITKQGWNPDAPLDRGDFEPLATFEGRAEIPSVPTTHTLSIPSTHTGYHVIYAVWDIADTTNAFYNTID......................................................................................................................................................................................................................................................... 196
283 2.000e-23UniRef50_A0A1H9CA09 Por secretion system C-terminal sorting domain-containing protein n=18 Tax=Bacteria TaxID=2 RepID=A0A1H9CA09_FLAFI  ali  20  535...................................................................IAYRLESVYLSANSTYANARTYGIQAATDLYGAGSPEVIATTNAFYAVGVGADSIAPSTPTSLTATGTTGSSTNLSWTASTDNVAVTGYNIYNGATL-AGTSTGTTYTVSGLTALTAYTFTVKAKDAAGNLSTASNSVNTTTTAASISYCDYTSITTSLTKASSNTITITPKWTGTSYNEGYAVWIVWSKAASKTTPVSGTFTVPSSATSGTTRMRVSMKYNAVATQCEAFSYTVNITAGTADTTAPSTPSSLTTSGTTTTTTSLSWNASTDNVAVTGYDVYQGS----TLKATVTSTSYDVSGLTASTAYTFSVKAKDAAGNISPSSNVANVTTLSNTVSYCASKGNTVTDEYIDYVSIGGITNTTGANAGYGDFTSLAA....... 966
284 2.000e-23UniRef50_A0A1H4VK29 Por secretion system C-terminal sorting domain-containing protein n=1 Tax=Tenacibaculum sp. MAR_2009_124 TaxID=1250059 RepID=A0A1  ali  27  561...............................................................................................................................................................................................................................TNIQINNLSTNSAQVAWEEIDEVTYEVRYKVGNTTWSTVVTEENSLFLTELEASTEYEVQVRSKCSDGNYSDYSNSSFFTTEDEFVDEEAPTAPVLSVSTVTTTSVLL-TWSGSTDNVGVVSYDIYQDN----VFVANVTTENYNVTGLTPSTTYMFTVKAKDAAGNESVFSNTVSATTEDDEEAPTAPVLSVSSVSATSVSLTWNGSTDNVGVVSYDVYQDNVFVANVTT. 790
285 2.000e-23UniRef50_A0A1H4W155 Por secretion system C-terminal sorting domain-containing protein n=2 Tax=Tenacibaculum sp. MAR_2009_124 TaxID=1250059 RepID=A0A1  ali  19  481...........................................................................................................................................................................YSYTGEIDNCESSYPVDVVITNKSGINNATLFSRAKGSSSWNQTSMTKSENNHWSANITLTS-----------GNSQVTEYYISATSNNNKT---MTYPMTGAQGG----------------------AFTFWCTSQTDTEAPTAPTNLTASNITQTTVDLSWTSSTDNIEVTGYEIYQGSTLLGT---TASITSFPVSNLTANTSYTFYVKAKDAAGNISVSSNEINVTTLTDNTNPVPSNLTASNVTQTSADLTWNASTDNVAVTGYEVYQGNTFIGSTSSI 777
286 2.000e-23UniRef50_A0A1L4BTA4 Uncharacterized protein n=1 Tax=Francisella sp. TX077310 TaxID=573570 RepID=A0A1L4BTA4_9GAMM  ali  40  19....................................QAYSHGYVESPSSRSYLCDKH---QNTNCSDVVGDAQSLEAADGLFDNGGLDNKMGSVGHGWAESLDEQNESRWAKTAVSPGTLTFKWHFTAAHRGKHFKFYITKPDWNPNELLTRDSFEDQPLNCYNPQVVPDDLTFTCT-MPERTGYQVIMAEWDVYDTGASFYN............................................................................................................................................................................................................................................................ 189
287 2.000e-23UniRef50_F2R3Q5 Chitin binding protein n=3 Tax=Streptomyces TaxID=1883 RepID=F2R3Q5_STRVP  ali  47  2..............................................................TNCGSIQWEPQSVEGPKGFPAAGPADGKICSAGLTQFAQLDDPRGGAWPATQLTAGSYSFRWQFTARHRTTDFKYYITKNGWNPSQKLTRADPQPFLTVPYNNQQPPATLSHSGTIPAGKTGRHLILAVWTIADTANAFYACSDVKF...................................................................................................................................................................................................................................................... 151
288 3.000e-23UniRef50_A0A1F8UCE9 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWD2_32_19 TaxID=1797679 RepID=A0A1F8UCE9_9FIRM  ali  32  154...................................................................................................................................................................................................................MASVDTESPTQPTNLTVTAKTETSISLSWTASTDNIEVKGYNIYRDLVKIDETTETIFTNINLIPGETYSYTVKAYDATNNVSDDSMIISET---TNPDYEKPSTPINL-STNVSERMITVSWDASTDNILLKGYDLYLDGVRFDSTI----DTTYSFTNLIPGKTYLIYVKAYDIALNYSDDSTTVIETTVPDLEPSVPTNLLSTSVSETSVTLEWTASTDNVEVEGYYVYRNDTKVGTTS.. 388
289 3.000e-23UniRef50_A0A1C0ZSB7 Uncharacterized protein n=2 Tax=Paenibacillus TaxID=44249 RepID=A0A1C0ZSB7_9BACL  ali  24  731........................................................................................................................NFPSGVPGPIAFYNGNFFVATPASSTNPEPHLYVASASDVAAATASTSITWTDITATDPVFRGMGQFLYNMDISNDGYIYMASDTDGLLVGQLSGGDTTAPTAPTVSSPSHGLTSVDLSWSGATDNIGITSYDLYKNGSFLTNVTGTTKTVSSLTPGTSYSFYVKAKDAAGNASPASNTVNVTTTVDTTAPTAPT----LSSPSHAQTTVNLSWSGATDNVGVTSYDVYKNGSF----LTNTASSSYIATGLSSGTSYSFYVIAKDASGN-SSPSSNTVNVTTDTTSSLLTDDFEDGNATGWTATGTWSVVTDGSTQAYYANNPSSAARSVTGT. 1055
290 4.000e-23UniRef50_A0A2T0M5E8 Deoxyribonuclease NucA/NucB n=2 Tax=Nonomuraea fuscirosea TaxID=1291556 RepID=A0A2T0M5E8_9ACTN  ali  19  716...........................................................GLVASYGLNEGSGTSVADSSGNDNAGAGTGTAWVNGKYGKALSFDGSSSMVTVADAPSLRLTTGMTLSAWVNPVTVTGTPWKSVITKELNADGAS-YALYAANGDAVPSGWVQTDPATPWTAEGTSPLPVNAW----------------SHLALTYDGTTLRLFVNGQQVGHTAMSGSLHDDGHPLRIGGNTVWREYFSGLIDEV----------------RVYDRAQSAAEIQTDMTTPI---GQAAPPDTQAPTAPGSLAATGGTG-SAQLTWTASTDNVGVTGYRIHRATTPGFTQVGSVPATTFTDAGLAAGT-YYYRVRATDAAGNLGPSSTEVSATVTVPPANPGLVAAYGMEETGTTVGDSSGQSNTGAATDTAWAPAGKHGKALS... 1076
291 5.000e-23UniRef50_UPI000DB94CAF hypothetical protein n=1 Tax=Arenibacter echinorum TaxID=440515 RepID=UPI000DB94CAF  ali  27  102.................................................................................................................................................PAAPAFANWSGMSGFSTTVITETNWTEYVFNVTATSSSPRITIYNGTSASGNTAGNTVFIDNVSILPAGSDTAPPTAPTNLVASGTTSTGTTLNWNASTDNVGVTGYTIFQNGTSIGTTNGTTFSVTGLFQNTSYAFTVTARDAAGNVSPASNTANVTTQSGA-DNQPPTAPSNLAANGTTTTATNLSWAASTDNVGVTGYTILQNGTSIGT---TTGALTFNVTGLTQNTSYAFTVTARDAVGNVSPASNTVNVTTLTAAPPTAPSNLAANGTTTTATNLSWAASTDNVGVTGYNILQNGTSIGTTS.. 409
292 6.000e-23UniRef50_A0A1V4H689 Uncharacterized protein n=1 Tax=Paenibacillus ferrarius TaxID=1469647 RepID=A0A1V4H689_9BACL  ali  19  50............................................................................................................................................................PVNWTSALWSRTVAVDSSVTTDVYSSGTKSLYIRAAD----SGAAGWVSKSIAIDSSMPAIKSTVKVRKSSDYTGNSPWVFISYGNNGTFLGTTSAPAVSVSSSAWTEITLTITSNQFPVGTNMIWLNLATLAGGALYQGTIYYDDVTMEVLPDTQAPTTPTNLHATGQTLESVDLAWNASTDNIAVAGYHIYKGT----TLVGTVTGLAFTASGLNSNSSDIFTVKAFDASGNESAASNA--FVTNDMEAPTIPANLTGSAIKMKSVTLSWDASTDNGGVTGYDIFQDSIQVATVTGV 338
293 8.000e-23UniRef50_UPI000D64D6CB fibronectin type III domain-containing protein n=1 Tax=Eubacterium ramulus TaxID=39490 RepID=UPI000D64D6CB  ali  29  895........................................................................................................................................................................................YIRVVAKSNGNPSKPSAHITPIISYVDEAVADTTAPEAPKYATAADVTESTAAISWEEALDNVAVTGYNVYVSGEKVNDITDTSYTLTGLTDNTEYTVTVTAVDAAGNESEAS--VAVTFTTAEADREAPSAPANVAAADITRAGAAISWKASTDNVGVTGYDVYVNGKKDNDAL--VKDTAYELSDLKQDTSYKVEVYALDAKGNRSEAG-SVTFKTLKA.................................................. 1112
294 1.000e-22UniRef50_A0A2N3T3I4 Putative secreted protein (Por secretion system target) n=8 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2N3T3I4_9FLAO  ali  19  537..........................................................................................TYTITVTHKGTLTGGSQNFSLIVTGLTGTATVTATVPTGVSSSAVGSDTATIGWTAVAGATYDVRYRQTGASSWTTVAASGTSNAITGLSATTAYEAQVRSKCADGTTSDYSTSVNFTTTDVQLNYCASNGKKTNDSKGGANTITITPTWPGTTYDEGYTGEQVWTKAASKTTPVSGSFTVPATAKDGNTRMRVSMKYNGTPNPCESDYTVVIGGSGGTDTQAPSAPAGLTASNVAQTTLTLSWNAATDNVGVTGYDVYQGT----TNLGSVTATTRNITGLTANTAYQFTVKAKDAAGNVSAASNTLDVTTTGGSSDPCPYNSSVNYQVGDRVTFQGSLYE....................... 932
295 1.000e-22UniRef50_A0A1W2GC12 Por secretion system C-terminal sorting domain-containing protein n=1 Tax=Reichenbachiella faecimaris TaxID=692418 RepID=A0A1W2GC  ali  19  631.................................................................................................................................................................NVTTTGTPPVNYCASNGNNTSDEYISRVTIDNSTGASSGGYGDFTTQSTSLTKGDAYTITITPTWTGSIYNEAYSVWVDYNQDGDFTDSGEQVYTQSATQTSPVGGSFTVPSGATEGNTRMRVSMKYNGIPTSCESEDYTITVVTGSADTEAPSTPTGLAASAVTQTTLTLNWNASTDNVGVTGYDVYQG----ATNIGEVSTTTANITGLTAGTAYTFSVRAKDLAGNISAASNTVNVTTQSGGMTCSSTTTIPYAEGFESGFGAWV.......................... 903
296 1.000e-22UniRef50_UPI000B5A9656 hypothetical protein n=1 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5A9656  ali  21  125........................................................................................................................TIPPSVPTDL-TGDVTGTTVSIAWQPSTDDEAVLGYNVYRDNKYLTTVRTPAYSGDN--AAGESHSWYVVAFDIRTNFSARSGRITLPDPGPVDTTIAPSVPTDLTGSMASGSDTVTVNWQAATDDQAVAGYNIYRNRQYIATRFGTEYIGT-VDTGSSNNFTVVAFDFDGNFSASSKAITLPLGTATNPGKPPSVPTDLTSNSNGQTQVQLSWTASTSTVKVAGYNIYRNND----YRTTVFTNAYTDT-VPAGSAFSYKVVAFDSFGNFSAKSAPLS........................................................ 400
297 1.000e-22UniRef50_S3JIL5 Chitin binding domain protein n=1 Tax=Cedecea davisae DSM 4568 TaxID=566551 RepID=S3JIL5_9ENTR  ali  52  6.....................................................................................................................GKQSFTWTLTAAHKTERWRFFITKKDWDPSKKLTRAQFDPICDQDGKGEVPANSITIKCTIPSDYKGYHVILGVWDIADTGNAFYQVIDTDI...................................................................................................................................................................................................................................................... 101
298 2.000e-22UniRef50_A0A2E2SJ92 Peptidase M4 n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A2E2SJ92_9BACT  ali  22  659..........................TVTITPTWTGTVYSEGY-------AVWIDYDQNGSFGDAGELVYSRSATTAASVGGSFTVPSSAIAGATRMRVSMKYNGVPSDYTINIIADGPDTEAPSAPANLSASNITETSVDLSWNASTDNVGVTEYEVYQ-DGALLGTVTGTTATVNGLTSETTYAFYVIAKDTAGNSSAASNTLNVTTDGGTVADTQAPSLPTGLSASNIADTTVDLSWNAASDNVGVTGYNVYMDGSLLGSVAGTTANITGLTAGTTYTFAVSASDDAGNTSAQSGSIDV......................................................................................................................................................... 937
299 2.000e-22UniRef50_Q63PN3 Putative chitin-binding protein n=63 Tax=Bacteria TaxID=2 RepID=Q63PN3_BURPS  ali  46  38........................................HGRVITPESRAVYL---YEAGRLDFGQV----NELEGGKFFPQSGPRDGEIAS-GGRTADARAQDSVAHWQKHAVRSGQSQISWSYSMPHKTRRWTYWITKPGWDTQARLARAHFEPLNTYQYWGPDADKELIHEFNLPT-RTGYHVLLAVWDVADTANAFYQVIDLNF...................................................................................................................................................................................................................................................... 232
300 3.000e-22UniRef50_A0A2K4G175 Uncharacterized protein n=1 Tax=Pseudomonas sp. FW300-N1A1 TaxID=2075555 RepID=A0A2K4G175_9PSED  ali  25  321.............................................................................TTYYTAGGLTD---ATSYTFRVRALDADENFADSDPLTITTVDVTAPSKPTDFRASVVSANTVFLRWDESVDNVGVIGYQLLRDNVSIEI-VTTSYYFAKELSEGATYLFKVRALDAAGNHTDSDSVSVTV------PDETRPSKPGNLRASTITGHSVALEWDASADNVGVTGYRIWRNNTAIDFVSNTRYVAGGLSQLTSYEFKVSALDAAENATDSDSLTVRTR-----DGSPPSKPTNLRIVIISSLKM-LRWDPSTDNIAVTGYEVYRNN----VYIDTTPYTYYV--GLDWTPPYVLRVRALDADGN................................................................. 611
301 4.000e-22UniRef50_A0A2V6YD64 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6YD64_9BACT  ali  25  186.................................................................................................................................................................................................................................................................................................VGYTSQLTVFGLLDTAPAASDPQAPTVPGTLTATAVSSGQVNLSWGASTDNVRVAEYRVERCTCTNFLQVATMAITSFNNVGLDPATSYVYRVRAADAAGNVSAYSNVASATTPAAPDPTAPTGLTATVVSSTQINLGWGASTDNVGVSRYRVER........... 347
302 4.000e-22UniRef50_A0A1G7J9J1 Fibronectin type III domain-containing protein n=1 Tax=Pricia antarctica TaxID=641691 RepID=A0A1G7J9J1_9FLAO  ali  23  116................................................................................................................................................................................................................................................................STTLINGTDWAEYVFNVTATSTSPLIRIYTSNAATSSTAGNTIYIDNVSIMAVDSEPPSAVTTLAATGTTTTGTQLSWSASTDNIGVTGYRVFRNG----TQIGTPVGTAYTVTGLTQSTSYAFTVSAVDAAGNVSAAGNTVNVTTPQGTDSVPPSAVTTLAATGTTATLSWSASTDNIGVTGYRVFRNGTQIGT.... 309
303 5.000e-22UniRef50_A0A1R1GE07 Uncharacterized protein n=1 Tax=Paenibacillus sp. FSL R7-0333 TaxID=1926587 RepID=A0A1R1GE07_9BACL  ali  33  251.........................................................................................................................................................................................YTIQQVW-YADSTSDWNRHEKLITLNTSYGDTEAPSAPTGLVSETFDYTNVYLSWSAATDNVGIKQYNIYNGDSLIGVTPNTNFLVPNISVPSINRFKVKAVDEANNISLASN----ISIIDFSDTTRPTTPTNLAYRDVKLNSVTLYWTPSTDSSGISKYIIHDQKTG---KAYISTEPKYTINDLKSSSTYSYAVTAFDLLGNRSHSSEVLQVTT..................................................... 459
304 6.000e-22UniRef50_A0A1P8FNJ4 Uncharacterized protein n=2 Tax=Betaproteobacteria bacterium GR16-43 TaxID=1904640 RepID=A0A1P8FNJ4_9PROT  ali  30  224.......................................................................................................................................................................................................................DTQAPTVPTSLSATATGTTTINLTWTASSDNVGVTRYNIYNGATLIGNVPSVGATVSMLTAGTFYTFTIAACDAAGNCSAQSSPASATTQSPTTDTQAPSVPTNLTAIPAGSTVITLTWTASTDNVGVANYKVFRSG----TQVATSVGTNTSVGSLSPNTAYSFTVAACDAAGNCSGQSNVATASTTGSVGTTPPSVVNGLTATPANGTLINLNWLTSSDNVGVANYRVFVNGTLRQTV 462
305 7.000e-22UniRef50_A0A2N3I2M5 Por secretion system C-terminal sorting domain n=1 Tax=Raineya orbicola TaxID=2016530 RepID=A0A2N3I2M5_9BACT  ali  18  635...........................................................................ANTTTYSDNGLTANTTYYYRVRAFNTGGNSGYSNVANATTLPNAPSAPTTLTATVSSSQINLSWTDNANNETGYKVERSLDGVSFTEIASSLPANTTTYSDNGLTANTTYYYRVRAFNTGGNSGYSNIANATTFPNAPSAP-------TTLTATAVSSSQINLSWTDNASDETGYKVERSLDGVSFTEANTTTYSDNGLTANTTYYYRVRAFNTGGNSGYSNVANATTL---PNTPAAPSAPTTLTATAVSSSQINLSWTDNASDE--TGYKVERSLDGVSASSLPANTTTYSDNGLTANTTYYYRVRAFNTGGN-SGYSNVANATTQAEVTAINT............................................ 968
306 8.000e-22UniRef50_A0A2H1E9J9 Endonuclease containing a C-terminal secretion signal n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2H1E9J9_9FLAO  ali  26  286..................................................................................................................................................................................................................................................................................................................TGSDTEAPTVPANVVVSNETTSSIDVSWDPSTDNVGVTGYEVFLDGNLIK----TTPNTTMSITGLTPNTTYGVTIVAKDLINNKSAASNVVNGKTLEDTEAPTVPIGVVSNQTDSSFKITWTPSTDNTAVTGYEVY............ 419
307 8.000e-22UniRef50_C6X4H5 Uncharacterized protein n=16 Tax=Flavobacteriia TaxID=117743 RepID=C6X4H5_FLAB3  ali  16  408..........................................................................VNTPTGNSIPTASAGSDYTIPKSTPYMLTGTSTDANGDALTYIWEQMDNQSTSAAPSATKTTG-VNFRSWIPSTSPTRYFPRMQSVLAGATTTAGQEVTVEASSVARNLNFRFTVRDNRPGGSGNNSDDAVITVNSTAGPFTVTSQTSAVTYSGGSSQPVTWNVAGTTANNAANVDILWSTDNGNTWTTLLAGTPNDGSQNPNSATTNGRLMVKGSNHVFFNVNKGNITVTAGTSDTQAPTAPT-LSATGTTQNSTTLSWSGATDNVGITGYEVYRGS----TLLGNTTAATYTVSGLAASTTYAFTVKALDAAGNSSIASNSVSVTTLAPTTAPTAPSLATSGTTSSSTNLSWNGASDNVGVTGYDVYQNSA........ 783
308 1.000e-21UniRef50_UPI0009EEFBAE hypothetical protein n=1 Tax=Paenibacillus swuensis TaxID=1178515 RepID=UPI0009EEFBAE  ali  29  145................................................................................................................................................................................................................................................................DRGAWATYTNYAVGDTVTYAGKTYQCRQAHHSLPGWEPANSLWLEGTGGGGDADTQAPSAPGGLTSTGTTASSVSLSWTASTDNTAVTGYDVY----SGASLAVAITGTSATVSGLSANTAYTFTVKAKDGAGNISAASSAVGGSGGSSCGQTPAWSSTAVYTSGARVSHNSKIYEAKWWTQGN............... 332
309 1.000e-21UniRef50_A0A2K1E390 Uncharacterized protein n=1 Tax=Hanstruepera neustonica TaxID=1445657 RepID=A0A2K1E390_9FLAO  ali  24  771.......................................................LTWNASTDNIGVTGYDVTNVSGTSYQVTGLTPSTGYSFYVIARDTAGNASSASNSENITTLDPPDTQAPSAPTNLTANNTTSFTTDLSWDVATDNVGVSGYDIYQ-DGSFIANVSGTTYQVAGLSPSTAYTFYVIARDAAGNASNASNTVNVTTEAF--VDTVAPSTPTGLSASNTTETTTDLSWNASTDNIGVDGYDIYQDGIFIDSVWGTFYLATGLSENTTYSFYVVARDAAGNSSSASNSVNETTLAAPT.................................................................................................................................................. 1028
310 1.000e-21UniRef50_A0A068N889 Chitin binding protein n=1 Tax=Bacillus cereus TaxID=1396 RepID=A0A068N889_BACCE  ali  84  1MKNRFLKQLQNMKMNKKSLGAVALTAGIMSTTLIPQNAYAHGFVEKPGSRAEI.................................................................................................................................................................................................................................................................................................................................................................................................................. 53
311 1.000e-21UniRef50_Q7NSD7 Probable chitin-binding protein n=3 Tax=Chromobacterium violaceum TaxID=536 RepID=Q7NSD7_CHRVO  ali  43  60........................................................................................GRIASAGQAHSAVLDEQSAVRWHKPPVKSGQMELEWSYHASHLTRRWNDFVTQACWDPNRPLARDQFEPFYKAELTAQPFWEHLTHQVRL-SERRGYHVVLAAWEVADTGNAFYQVIDFNF...................................................................................................................................................................................................................................................... 191
312 2.000e-21UniRef50_A0A191WJ02 Uncharacterized protein n=2 Tax=Agromyces aureus TaxID=453304 RepID=A0A191WJ02_9MICO  ali  47  216.......................................................................................................................................................................................................................................................................................................................TTPTVPTGVHSMGTTSSSVDLMWTASTDDRGVTGYRVERATTGAFALVGQPTGTSWLDTGLAASTTYRYRVAAVDADGNRSAVSTVFQVTTAAATGTAPAWNPSGAYTKGDRVTSGGVVYQAVQTHQGVGDPGWITARSLWTPV 360
313 2.000e-21UniRef50_A0A239P2G7 Fibronectin type III domain-containing protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A239P2G7_9ACTN  ali  22  523.........................................................................................SFANANQGTDGWVNLGNMTTGGCTGDCTAP-----SVPSGLAVTGVTNTSVSLSWSASTDNVGVTGYQVLR-NGVLAGSPTGTSFTDTGRSPGQTYQYQVRAVDAAGNQSGLSSTVSGTTSGCSGD--CTAPSAPTLSSPSKTDTTVSLSWTASTDNVGVTGYEVFRGSTLVGSPTGTSFTDTGLTASTAYSYTVKARDAAGNRSAASNTVTVTTNAGTPPPT............................................................................................................................................... 737
314 2.000e-21UniRef50_UPI00046EDD06 T9SS C-terminal target domain-containing protein n=1 Tax=Aquimarina pacifica TaxID=1296415 RepID=UPI00046EDD06  ali  27  551..................................................................................................................................................................................................................................................................................................................PNPDTEPPTIPTDLVSSQITSNSVTLEWTAALDNVGVTAYRISIDNGTEIII----TDTSTEIADLTENTIYTFTVAARDAAGNWSEESENLTVETLEDTNPDTTAPSIPMNLTASDVTSSSLRLSWEPSTDDTGVTSYNVSINGTAPV 695
315 3.000e-21UniRef50_J8HTJ3 Uncharacterized protein n=2 Tax=Bacillus cereus TaxID=1396 RepID=J8HTJ3_BACCE  ali  31  232....................................................................................................................................................................................................................................................................................................................VDTEAPTIPTKLEATADT-TKIKLKWEASTDNVGVSHYNVYRNGE----KLAPVTETEFEDVNLTPETEYTYEVSAVDKSGNESAKTMPLRIKTEKTPDLDTEAPTAPTSETETTVDLMWTASTDNVGVDHYEVYRDN......... 369
316 4.000e-21UniRef50_A0A1X0WKN9 5`/3`-nucleotidase SurE n=18 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1X0WKN9_9GAMM  ali  32  341.................................................................................................................................................................................................................................................................................................................TPDEDTTAPSVPTHLHGEA-TASSIHLTWTASTDDAGVHHYEIYRNN----VKISDAPSHEYTDVNLQENVEYHYTVKAVDAANNISAASDVLSIKTEKAPAHDAQAPTIPTQLVATQVAQNSVTLTWKASTDNVKVLGY.......... 477
317 4.000e-21UniRef50_A0A0L7TAB1 Uncharacterized protein n=6 Tax=Enterobacterales TaxID=91347 RepID=A0A0L7TAB1_9GAMM  ali  22  270............................VIGLPSNPDAAATGYVRNEGDRTAYERLISQGTPIK-GLMTW---SINWDTGHSSAGNAYG-----------YEFAHRYGKLIHEDFTGDPDTQAPTQPGKPALTASSG-QVAMTWAPSSDNVGVAQYQIWR-NGEEIGQSTVPQYNDNQVSNGNTYEYVIIAVDKAGNLSLPGEAASVTLEENDTPDIEQPTVPQDLNGEATGPNSVNLSWEASSDNVAVRHYNIYRNGALLTKETQTSFTDSGLAAGTTYHYQVAAVDTSDNMSDKSDMISVTTAAGENPQ--PGYPAYVAGTA................................................................................................................................... 549
318 4.000e-21UniRef50_V9W8A3 GlcNAc-binding protein A n=41 Tax=Paenibacillus TaxID=44249 RepID=V9W8A3_9BACL  ali  39  193...............................................................................................................................................................................................................................................................................................DTANAFYQVVDVNLVNEGTTPPETIAP--PTSLVSSGQTSHSIELRWNASSSN--VAKYEIFRDGQ----LIGETAGTSYADHGLQADTTYTYTVRAVDAAGNISPASDALNVKTKSDTSAVEEWDPNKVYTEGMTVLYKGLEYKAKYWTKG................ 337
319 5.000e-21UniRef50_A0A1G9DAK7 Ricin-type beta-trefoil lectin domain-like n=1 Tax=Cryobacterium psychrotolerans TaxID=386301 RepID=A0A1G9DAK7_9MICO  ali  25  34.....................................................ASASWTASPVGTTASVASGTIGIQQAGFASLAVQYGPTVTTATAPITVTNTGTIPAPYTLTLSAPAANPLAQAPVNTWPVLFGSSALPVPGTATTSKTWAAGTTLTGSLDAGSSAVYCVTTSLTPAQLSANSGGSMVATLALNSAVGNWSATDTATVAQSVSDMTAPTAPGTPVASGTTGVATTLNWTASTDTVGVTAYEVYRTGLLIATVTATTFTDAGLTPGTTYSYVIKAKDAAGNG-----TVSGTTAVTTTDTIAPTAPGTPVASGTTGVQTTLTWAASTDNVGVTGYDVYRG----ATLVGTVTATTFTDTGLAPATTYNYTIKAKDAAGNQSVSGPTAVATTDTIAPTAPGAPV-ASATTGVQTTLTWAASTDNVGVTGYEIYRGTTLVGTVTS. 425
320 5.000e-21UniRef50_A0A0G3A2X2 Chitinase n=6 Tax=Bacteria TaxID=2 RepID=A0A0G3A2X2_9DELT  ali  22  799.......................................................................................................................DTTAPSTPTGLAVSTKTDRSVKLTWSAASDNVAVTAYDVFR-NGTQVGSSATTSYTDSGLTASTAYSYTVKAKDAAGNTSAASTALSVTTL---APDTTAPSAPTGLTASGTTSSSAALLWTASTDNYGVAGYDVFRNGTQVASVTGTSYTDTGLSPSTAYSYTVRAKDAAGNLSAQSTALSVTTSAGNTTTVYGFATPYIHFRPVGGT-WTVTPGYAMPDSEVSGYAKYTVNLGAATQLEAVFNNGGGTWDNNNGGNYFF----PTGVSTFSAGTITAGAPVVDTTPPSVPGGLGSPSKTAASVSLSWTASTDNVGVTGYLVFRNGTQVGT.... 1124
321 5.000e-21UniRef50_UPI0006888293 hypothetical protein n=3 Tax=Methylosarcina fibrata TaxID=105972 RepID=UPI0006888293  ali  26  38.................................................................................................................................................................................................................................................................................................SGILSAFQINSAQAAIRPPRDTRPPTVPSGLTATAASSSQINLSWTASTDSSGVRGYKVYRGT----TQIANVTTTSFSNTGLAANTNYQYSVAAYDRAGNTSSKSTSVSATTLSNSTDTTPPSTTASAISSSTVNLSWTAATDNVGVKGYTVFRDGSQIASVTT. 203
322 6.000e-21UniRef50_A0A090AI52 Uncharacterized protein n=1 Tax=Thioploca ingrica TaxID=40754 RepID=A0A090AI52_9GAMM  ali  21  842................................................................................................................................NLKAVPTAATETGLSWNDNSDNET-GFKIVRDGKLLSTTAANTTTYQDSPLKCGTEYTYSVTAINAVGDSSA-------TTLTVSTWDCPPPSPTNLQAVPIVATQTMKLSWTDNSDNE--IGFKIARDGKPLSTTTITTYQDSPLKCGTEYTYSVTAINTVGESTAATITVSTWDCPTPPPNQLPIAPIKLNVVATSPTEVTLTWNDTSHNE--TGFKIERNN--ILTQITAANVTTYKDTELTCNTTYNYIIKATNASGDSAALTASIT-TPICATKPLVPSNLKVIATSPTAVNLSWADNSDN..................... 1170
323 6.000e-21UniRef50_A0A1C6Z1P6 Chitodextrinase n=4 Tax=Hafniaceae TaxID=1903412 RepID=A0A1C6Z1P6_HAFAL  ali  22  73.................................................................................................................................................................................NVANNQTVTFSVTANDSCGMSPVAYWVNGNAINSVASTDTDAQTKPTNLKFSSVGANSFTLSWDAPTGD--VDHYDVAYQAALQIETTETQVTINNLMETTSYIIAIATFDTPDNWTSIVEA-NVTTTAQTPDTTAPTAPSNLKSANISVNSVSLSWDAATDDVGVDHYVVTYVSDTQAALEIQTTITSVILSNLTAETNYAISLTAVDAAGNQSPATTATIKTATPSADTSAPSVPNVSAITDTSLTLTWKASTDNVGVTGYKVYTSASGSSVTKDV 360
324 6.000e-21UniRef50_UPI0002884BA4 S-layer domain-containing protein n=1 Tax=Bacillus timonensis TaxID=1033734 RepID=UPI0002884BA4  ali  22  596..............................................................................................................................................................................................................................................AWDKPVTTDGIKQYYIYKNGKLLETVTSTSYQVTGLTEKTSYQFSVIAEDNYNQKTEALTLTAETLKTAPG----WPEGAFLHVPEYGSDFVILSWNQAITYDGVKQYHIYKNG--ALVQTVTGTTTNYKVTGLSPTTLYQFSVIAEDKYG---DKSSALSVD-WETSRVFPHWPENAALVYQTDATSVSLSWDEANTHDG................ 788
325 8.000e-21UniRef50_A0A1I6FF74 Glucose/arabinose dehydrogenase, beta-propeller fold n=3 Tax=Lentzea TaxID=165301 RepID=A0A1I6FF74_9PSEU  ali  22  145.........................................................................................................................................................................................................................................................................................YGTTRCRTGTSYGYSLQEFQVFGNTGPVDGEPPSAPANLVASDVKPDSAKLTWEPSTDNVAVTSYEIYNLGQFVK----SVPGTSTTMTDLKPNTTYGFYVNAKDAAGNISQASNTAEFKTPPAQDDPIPPTAPKNAQTANSVSLAWDASTDNIGVTRYEVYSAGASTSTSATI 322
326 1.000e-20UniRef50_A0A2G6GYT2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2G6GYT2_9BACT  ali  20  395....................................................FIDLEWGASIDNVGVAGYRVQGVEVTTTSTRTGLEPNSPYSFSVSAYDKAGNESGRSTELYVSTTDLDITPPTVPQNLLATDSTENSVTLSWDASTDDAEMGGYMIYSVEDRWHGTTPYTYFDLRGLNHSSQYDVYIVAVDASVNMSAPSEML---RVRTRAPDVDPPSPPGNLKSTLVSQTSISIEWTPSIDNVGVTGYSIIVNGFARGESTGNNYTLTGLSPGISYAIRVVAYDHALNESLPSNEIVETTKS..................................................................................................................................................... 654
327 1.000e-20UniRef50_A0A2R8A4G9 Chitin binding domain protein n=9 Tax=Carnobacterium TaxID=2747 RepID=A0A2R8A4G9_CARDV  ali  25  170.....................................................................................................................................................................................................................................................................................TGYHVIVGTWDISDTLNAFYQVIDVNINNGPVDKEAPTIPTELKTTHTAFNQVNLSWKASTDNIGVSNYEVLRDG----KVIGSTKGTTFEDKNVTEKTTYRYEIRALDAAGNVSKNSTILTVATPEKPKPSSPEGLMAHMTTATSTMLHWNASTDNVAVAGYEIYRDGKSIKVTT.. 348
328 1.000e-20UniRef50_A0A1S9T454 Uncharacterized protein n=2 Tax=Bacillus cereus TaxID=1396 RepID=A0A1S9T454_BACCE  ali  33  197...................................................................................................................................................................................................................................................................................................................GDDTEAPTIPANLQATPE-ATKVNLKWTASTDNVSVDHYNVYRDG----KKLAPVTGTELEDVNLQPTTAYTYEVAAVDGAGNESEKSALITVETKELPAVDTEAPTEPMGETENTVDLMWTAATDNVGVDYYEIYRNG......... 335
329 2.000e-20UniRef50_D3TBL1 Fibronectin type III domain protein n=2 Tax=Aciduliprofundum boonei (strain DSM 19572 / T469) TaxID=439481 RepID=D3TBL1_ACIB4  ali  15 1076..............................................................................SDSSNNVISNNTFSNNWAGIELSYSSNNVISNNLLTNNSGYYGIHIYSGSNWNHIYKNNFYYNDGSGSTFKSSYVQARDDGTNNHWNSTSGIGNYWYDWANNNNTNDQNGDGIVDWPYKIDGSAGAKDYYPLRCPIGESTPSQPFNLTAKTGDGYINLSWEQPVCNGSSDIIEYRIYRNGSLIATVNQLWYNDSDVKNGVRYTYYVTAVNSIG-ESQPSNEVQVTPM------TVPNAPESLQAKA-GNRYVNLSWEVPSDNGGITGYRVYRNGSLIAT--VQANQLWYNDSDVKNGVRYTYYVTAVNSIG-ESQPSNEVQV-TPMTVPNAPESLQAKAGNRYVNLSWEVPSDNGGSAITGYRVYRNGSLIAT.... 1440
330 2.000e-20UniRef50_UPI00083863EC carbohydrate-binding protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=UPI00083863EC  ali  26  40....................................................................AWTASTSYASGDTVSYGGKTYQVVQPHTSLNGWEPPNVPALWKVVTGGGTPDTQAPSAPSNLRVSGTTTTSIALAWNAASDNVGVTGYDIYRGTTIGSASGTTLTYTDTGLTANTTYTYTVKAKDAAGNVSGSNTLSAATQPGSSGPDTQAPTVPAGLASTGATTSSVSLSWNASTDNVGVTQYEVYRNGTLALAVTGTTATVTGLAADTSYNFTVKAKDGAGN................................................................................................................................................................... 266
331 3.000e-20UniRef50_A0A2M9N220 Uncharacterized protein n=5 Tax=Paenibacillus TaxID=44249 RepID=A0A2M9N220_9BACL  ali  23 1099..................................................................................................................................................................................................................................................ATDSIQVNHLRGAPIGTPQNVASGTEVTWAGLHSDGTYAWYVVAQDKFGGK-TLSDVWTFTTDGGKLD-----APTNLKALNVTSSTVQIGWDPAKGDQQVVNYNVYQDGE----RVATVTDSVYEATGLTPDTLYEFKVTAVDKQGTESAPSEILTVITQAVEIPGAPVWTAGSDITSNGVSMSWPEATTDDGVDGYRVY............ 1296
332 4.000e-20UniRef50_A0A0J1G5P3 Uncharacterized protein n=4 Tax=Robinsoniella TaxID=588605 RepID=A0A0J1G5P3_9FIRM  ali  24  903................................................................................................................................................................................................................................................................................................NASRPSAYVTPVITYVDAAETDTQAPTTPDNIKAEDITSTSANISWDASADNVGVTGYEVKNGNEIIKNI---SEGTSASLDGLIPSTEYTITVTAFDAAGNKSEPG-SVTFETKDTQKPTAPANIKVTDITDTSATITWNASADNVGVRGYKVLNGS......... 1059
333 4.000e-20UniRef50_A0A2K2FH74 Uncharacterized protein n=2 Tax=[Clostridium] thermosuccinogenes TaxID=84032 RepID=A0A2K2FH74_9FIRM  ali  31  355..................................................................................................................................................................................................................................................................................................................PTKDTQAPTVPQGLKAVAVSESRIKLDWSASSDNIGIAGYKVFRNGKQIATV---TNGTTYTDTGLKAATPYSYTVVAYDKAGNTSAHSASVVCTTLGSSTTNVALNKFASADSILT------GYDASNAVDGKSSTRWSAA....... 487
334 5.000e-20UniRef50_UPI0001694BEE chitin-binding protein n=1 Tax=Paenibacillus larvae TaxID=1464 RepID=UPI0001694BEE  ali  39  100...............................................................................................................................................................................................................................................................................................DTANAFYQVVDVNLVNEGTTPPETIAP--PTSLVSSGQTSHSIELRWNASSSN--VAKYEIFRDGQ----LIGETAGTSYADHGLQADTTYTYTVRAVDAAGNISPASDALNVKTKKSDTSAVEWDPNKVYTEGMTVLYKGLEYKAKYWTKG................ 244
335 5.000e-20UniRef50_F5LP47 Fibronectin type III domain protein n=42 Tax=Bacillales TaxID=1385 RepID=F5LP47_9BACL  ali  25  40....................................................................AWAASISYAVGDTVTYSGKTYQVVQPHTSLNGWEPPNVPALWKEVQGGGTVDNQAPTAPTGLKVSGTTTSTSILAWNPSTDNVGVTGYDIYRDTTVGSVSGSALTYTNTGLTPNTAYSYTVKAKDAAGNVSASSALSVTTLPTSGGSDTQAPTAPGNLAATGSTTSSVSLSWSAATDNVGVTQYEVYNNGALAQTVTGLTATVTGLSADTSYTFTVKAKDAAGNVSPASAAVTAKTQPT.................................................................................................................................................... 281
336 6.000e-20UniRef50_A0A1Q4X5Z7 Uncharacterized protein n=4 Tax=Saccharothrix TaxID=2071 RepID=A0A1Q4X5Z7_9PSEU  ali  28  375.........................................................................................................................................................................................................................................................................................................TVLHTFTVVPAADTEAPAAPSGLTAGETTPTSVPLSWTAATDNIGVTAYDVYNGG----TLATTVEGTTATVGGLVPDTEHTFTVVAKDAAGNTSDASAALKVRTAPLPAPTTPTNLRSTAQTENSVTLAWDASTDNVAVTGYEVRNGASSVPTTET. 530
337 8.000e-20UniRef50_A0A229UMC0 Uncharacterized protein n=1 Tax=Paenibacillus rigui TaxID=554312 RepID=A0A229UMC0_9BACL  ali  21  551............................................................................................................................................................TFYNIANNTKTPANMNYLRNSSFKNVKINGLAVPWKTITNSTGLIFSDTTMDSVSNDASVAPAWPGGSQLHATVTDSTYVTLGWTAATDNVKVGSYKIMNGSTTVATVAGTSYKVTGLSPAQVYNFKVEAADATGNWTTTGPSLTTATTGTVD-TVAPAAPAGLNLIKITDGTVNITWTAATDTYGIHHYNIYQNGSEVGAVAGTV--TKYNATGLDFATDYTYEVEAVDGAGNRTKYPGSLTVKTAAAYDTGVPKWPARSALTASQMTTTAVQLSWPAATDDLHVAGY.......... 844
338 8.000e-20UniRef50_A0A1X7J748 Fibronectin type III domain-containing protein n=2 Tax=Paenibacillus TaxID=44249 RepID=A0A1X7J748_9BACL  ali  21  806........................................................................................................................APTWPNDSELIAWDVTQTSTKLSWPSATDNVGVTDYRIYVDGKAFTTVSNSVYATVTGLMANTHYTFKVMAFDAEGNESVGLTALVKTLPQQPESDIPTWPNDSELIASDVTQSSAKLSWPSAADNVGVTDYRIYVDDKAFMTVSSSVYTVTGLTANTHYTFKVTAHDAAGNESAPISKQATT........................................................................................................................................................ 993
339 8.000e-20UniRef50_F5LRR6 Dehydrogenase, PQQ-dependent, s-GDH family n=20 Tax=Bacillales TaxID=1385 RepID=F5LRR6_9BACL  ali  24  193.............................................................................................................................................................................................................................................................................................AVSSHNTSKLSTATFTNVTVNAAGDVFPPTEPTNVQARSVTDTSAEIAWTASLDDVGVTGYDLYKDDVLTQ---ANVAGISYTFTGLKPATTYRFTVKARDAAGNSSAASAPLSVTTTSGSSPAAPAGLASSSKTSTSVQLTWTAATDNVGVYAYDIFTDG......... 353
340 8.000e-20UniRef50_UPI00046A24A1 hypothetical protein n=1 Tax=Brevibacillus borstelensis TaxID=45462 RepID=UPI00046A24A1  ali  19  602.............................................................................................................................................................................................................................MVPPYTCEGTVESALTCQLTALGGYGDRTWSIISGDLPSGITLDPRTGLLSGVPESGTYITVVEVTDRTTEKANRTVTMTIKPQQPAPDREAPQWPDDLTVSDITQTSVKLSWPTATDNVGVTGYRIYVDGKERTMVSGNVYATTVND--LTANTNYTFKVTAFDAEGNESAA-LTASIKTLPQPPDPAPQWPEGSKLTISNITQTSVKLSWPSAVNNDKVISYQIAVIGTG.. 839
341 8.000e-20UniRef50_UPI0009ED4BE5 hypothetical protein n=1 Tax=Paenibacillus elgii TaxID=189691 RepID=UPI0009ED4BE5  ali  27  162........................................................................................................................................................................................................................................................................PPSSYTNTCNVPYRTGYQVILAVWEIHDTGNAFYNVIDVDFGGNLDSQVPTAPADLNAVEVTATSVSLAWNASNDNVGVTSYKIYNGSELIGTVSG--STLSYSVIGLNSNTSYTFTVRAEDAVGNISDTSQAVTV....................................................... 295
342 9.000e-20UniRef50_A0A239KT38 Fibronectin type 3 domain-containing protein n=1 Tax=Anaerovirgula multivorans TaxID=312168 RepID=A0A239KT38_9FIRM  ali  17  475.................................................................................NVTSYTDTGLSSNRSYSYRVRAYNDAGNSSYSNEVNSDNGTALEKPTNLTIDSISSSRITISWKDNSSNERGFRIENGSWSEIDTVRANVTSYTDTGLSSNRSYSYRVRAYNDAGNSSYSNEVNSDNGT--------ALEKPTNLTIDSISSSRITISWKDNSSNERGFRIERKIDNGSWSEANVTSYTDTGLSSNRSYSYRVRAYNDAGNSSYSNEVN-------SDNGTALEKPTNLTADSISSNRITISWRDNSNNE--KGFRIERNGSWSEIDTVRANVTSYTDTGLSNNRTYSYRVRAYNDTGN-SSYSNEINGKTT.................................................... 790
343 1.000e-19UniRef50_A0A2A5DW46 Uncharacterized protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5DW46_9BACT  ali  25  890.........................................................................GTSATASFSATGLTAGATYSFTLSAIDAANNNSASSAIAVMTLTATDTTAPSIPMNLLATSVTSTSLTLTWATSTDDTQVSGYKIFK-DGIFLNSSTTNSLEILNLTLATTYSFTISAYDAVNNNSTISNALSVTTKSLL--DTTAPSVPTGLTTSLITENSFKISWTASSDETGVTKYNIYKDNVLLGTSSTTSLDVTGLSSDQPYSISVQSVDEAGNKSALSSALTTTTLVQKEM------PVNITISVITDSTVMLVWEEST-STDVISYTIFQDG----VEIGTATTTSFEAAGLSPSTTYTYTINENNISGISTSASDTIIITT..................................................... 1205
344 1.000e-19UniRef50_A0A068N8B1 Chitin binding protein n=2 Tax=Bacilli TaxID=91061 RepID=A0A068N8B1_BACCE  ali  61  5........................................................................................................................................YY--EKGWNPNKPLTRSDLDLVPFVKNDGGAPGTTVTHEANVPTDRSGYHLILAVWEIADTGNAFYQVIDVNLLNN................................................................................................................................................................................................................................................... 80
345 2.000e-19UniRef50_UPI000DC7A16A fibronectin type III domain-containing protein n=1 Tax=Streptomyces TaxID=1883 RepID=UPI000DC7A16A  ali  18  98.................................................................................................................TGCSSADTTPPSAPAGLTAQAGSATSVHVMWTSPAPAEKVSSFLVFQADRLVELPADKTMVDITGLAPQTAYEFTVKARDTAGNXXXXXXXXXXXXPAARAEDRLPPTAPTATAGRALGPTSAELTWGPATDDSGVTAYDVYQGEARIHTAGPGSTTLEGLQPDTVYTFTVRARDGADHSSPDGPAVDVTTPAGPGQR-PNTAPAEFTATA-SPGAVTLAWTAPPTGRETSEYELYVNGRPTTV.................................................................................................. 342
346 2.000e-19UniRef50_A0A1H5YHF9 Por secretion system C-terminal sorting domain-containing protein n=1 Tax=Flavobacterium urumqiense TaxID=935224 RepID=A0A1H5YHF9  ali  19  284..............................................TASTSNSVALSWLAATDNTGVTGYDVTTVTGLSTTITGLTASTVYSFYVIAKDAAANYSVTSNTVNTTTSGATDTVAPTAPTSLIASGTTSTTTNLSWTASTDNTGVAGYDVYQGATL-KAIVTGTTYSATGLTAATAYSFSVKAKDAAGNVSASSNVVNVTTATASISYCASQGNTTNTARGTAYSFTITPVWTSTVYSEGYAVWIVWSKSASTTTPVSGSFTIPTTATLGTTRMRVSLKYNAIPTACEAEDYSVTITAATSDTISPTTPTSLSASGTTAT--NLSWTASTDNVAVTAYDVYQG----PTLKATVTSTTYAVTGLTASTAYTFSVKAKDAAGNFSTSSNVASVTTAAGGSTATDLLFSEYIEGSSNNKALEISNATGNAVQTNGAGAWSTGLALTGTL 752
347 2.000e-19UniRef50_A0A1B8U0W8 Uncharacterized protein n=8 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1B8U0W8_9FLAO  ali  22  273................................................................................................................WGIYTSSDIQAPSTPTNLIASNNTTFSIDLSWEAATDNVVVSSYDVF-VDGNLFANTTNTSLTINQLNSDTNYSFTVLAKDIVNNLSAQSNPVNASTLK----DTEAPSVPTNLVISNQTTTSFVVSWDASTDNTAVTEYDVYLDGNKIATVTETMYTITNLFAATSYTVQILAKDKVGNLSNLSDDIIATTNNIDTNST............................................................................................................................................... 467
348 2.000e-19UniRef50_UPI0005527DCD hypothetical protein n=1 Tax=Haloferula sp. BvORR071 TaxID=1396141 RepID=UPI0005527DCD  ali  23 1302.................................................................................................................................................................................................................................................................................................................GSGPDTDPPTTPGTLAASNLKSGSLTLTWAASIDDKAVTGYRVFRNS----VDLGTTTSLSFPQTGLTPQTGYTYEVQAFDAAGNLSER-ASLPVTTPADTEAPTTPGNFKGMAGNQTATLSWLASTDDTAVTGYRVYRDSILVNTTATL 1446
349 2.000e-19UniRef50_UPI00041879C9 hypothetical protein n=1 Tax=Nocardioides halotolerans TaxID=433660 RepID=UPI00041879C9  ali  26 1307...........................................................................................................................................................................................................................................................................................VRVYNRALSQADIAADMATGIVPTGADTTPPSAPTGLSATAVSATRVDLGWTASTDNVGVTGYRVERCGCTDFTQVGTPTGTSSSDTGLSPSTAYRYQVRAVDAAGNLSAYSSIVGVTTPAAPDTTPPSAPTG--LSATAVSPTRVDLGWTASTDNLAVTGY.......... 1469
350 3.000e-19UniRef50_UPI00036006AC T9SS C-terminal target domain-containing protein n=1 Tax=Lewinella persica TaxID=70998 RepID=UPI00036006AC  ali  24  627................................................................................................................................................................................................................................................................................................ASGGSFTSSEATAFCITSSGPDTSPPTNPTNLTVSGEQDTQISLSWNASSDNVGVTGYEVFLDGSS----IGTVAGTSANVTGLTACTGYNFGVRALDAAGNASGQATTTGCTTADTTPPSTPTKLSVSNEQDTQVSLSWNASIDNVGVTGYEIFLDGSSIGTVT.. 791
351 3.000e-19UniRef50_A0A242AX02 Serine protease n=2 Tax=Enterococcus TaxID=1350 RepID=A0A242AX02_9ENTE  ali  34  258....................................................................................................................................................................................................................................................................................................................VDTQAPSQVTGLRSFKVTTNSAQLNWNPSTDNVGVDKYEVYRNGS----KVGESKTTTFAVNALIPDTTYTFSIIAVDKAGNRSVMSTGLTVQTEKEIVVDTQAPSQVTGVRANNVTSNSAQVLWNPATDNVGVTKY.......... 390
352 3.000e-19UniRef50_I6TAV0 Chitinase n=71 Tax=Bacteria TaxID=2 RepID=I6TAV0_ENTHA  ali  34  344....................................................................................................................................................................................................................................................................................................................PDTEKPSKPENLKGTA-TQSSISLSWSASTDNVRVSHYNIYQN----KQLIGTSNTTNYTVSNLSPDTTYSFTVEAVDTSGNRSTSSDVLTIRIQAGSQLPAPSMPTGLVVKGNSVTLGWSANDPKEEVIGYEIYRNGTLVTITKS. 487
353 3.000e-19UniRef50_A0A2R7U677 Uncharacterized protein n=2 Tax=Pseudomonas TaxID=286 RepID=A0A2R7U677_9PSED  ali  19  106.........................................................................................................................TPPTPPHNLVAEDIGYFDAILKWDAATDNAGIAGYRVYSGA-NLIATVEETQYQVKNLKIDTPYTFIVRAQDTSGYLSPEAQVTFRTEKDVTPPDKPTG-----LVAITVSSQTAMLVWVTPVDDLRVTHNVIVQDGRDIATSSVDGYLVKGLTPGTTYRFAVAALDAAGNRSAASNEVSVQMPVMD-------APQAIEVTAITKQGFQLRWSPPQGSIGVNGYRTKIDNHAGSTREIHGPLPKVQFIGLRSASTYSVEICAHDVSGRYSAP-ATLEVKTLSA.................................................. 381
354 3.000e-19UniRef50_A0A2V5G5G9 Uncharacterized protein n=1 Tax=Arthrobacter stackebrandtii TaxID=272161 RepID=A0A2V5G5G9_9MICC  ali  45  22.......................................AHGWVTDPPSRQDSCA--AGALSFDCGKLKYEPQSVEAPKG---------SMECSGGNVDAILNDDTL-PWPVKTI-GTDVDINWNITARHATASWEYFL--------------DGKLIQTVESNGAKPEALVTHRLNLP---EGEHTILARWNVADTINAFYNCLDVTKTGTVEPTTEAPTV......................................................................................................................................................................................................................................... 181
355 4.000e-19UniRef50_A0A0P6XJM8 Uncharacterized protein n=1 Tax=Levilinea saccharolytica TaxID=229921 RepID=A0A0P6XJM8_9CHLR  ali  19  45...........................................................................................................................PAPPTNLLANLVSSSRVDLTWTDNS--TDESGFVIYRNGAEIARVSNVTSYSDSSLSCGQVYTYEVSAINIDGESGTAMDTV--------TTPVCPPPAPSDLQTLAVGTNDITLGWTDALPDKQEEGFDVQRSPNGVNWVTVTTFMDAGLPCDTIYYYRIRAFNVSGQS-------FSNVHMTATMSCTPTSPLNLTATPISQTQVDLVW---SDVFGEEAYHVERGGPWTEIGTTLADVTTYSDLTVLCGTTYFYRVKARNAGG-FSEPSNPVLVTTLGCLPKPPVS-LNAVATSPTNILLTWQDKSDNTGFNIERSPDGLGGWTLLGT. 369
356 4.000e-19UniRef50_A0A1V4VVP1 Cellulosome-anchoring protein n=1 Tax=Pelotomaculum sp. PtaB.Bin104 TaxID=1811693 RepID=A0A1V4VVP1_9FIRM  ali  20  303........................................................................................................................................................................................................................DVVPTLISGVLTAVPTGNNLTITWPASTEIADVSGYNVWASENPYWDFTSTSYVTSGLAPGKTYNFRVSGVNGSAEGGFSDFVQAVTPAVTADSQAPVWTDATLSATGIKSTSLTLTWTPATDSVLVTNYRIFQDESLLDT--VSGATYSKHIIGLTPDTSYSFKVEAGDAQGNWSTDGPEANVSTKSSDTESPTWENGTGTKNGEEVTLTWDGAQDNVDVTGYRIYRGS......... 554
357 5.000e-19UniRef50_UPI000BA45618 hypothetical protein n=1 Tax=Pseudomonas sp. Irchel 3H3 TaxID=2009038 RepID=UPI000BA45618  ali  33  93......................................................................................................................................................................................................................PDRMPPSKPTGLRTDSVVGNRVNLAWVASVDNGGVVGYQIFCDGKLVGNTDSIRYSVADLNDATTYIFMVRAQDPDGNHADSDPLM-----VSIPDVGGPTIPANFRGY-VTHDTISLAWFPAYGEVRIEGYEIFVDT---VYRVTTANTYRNIE-GLSPGTTYSFSVRAVNTLGKRSGSTTIQATTTAVR.................................................. 273
358 6.000e-19UniRef50_A0A2T6NVM2 Uncharacterized protein n=2 Tax=gamma proteobacterium symbiont of Ctena orbiculata TaxID=1968598 RepID=A0A2T6NVM2_9GAMM  ali  21  110...........................................................................TSATSHTDSGLAAATQYSYMVVAYDAAGNESEPSVQSTATADSSDINPPTIPSGVNASIVTETTITLAWSASIDDTATTGYRILR-DGIEIATSTVTSYNDTGLSPETQYRYRISAYDGAGNESALSDEIVLSTTNSINSDTSPPEAPTGLIAANVTSTTIALTWSESSDDTATTGYRVYRDDVEVATAAMTDYTDTGLSPATQYQYQVTAHDEAGNESDRSDALSV......................................................................................................................................................... 338
359 8.000e-19UniRef50_A9AZG0 Fibronectin type III domain protein n=1 Tax=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) TaxID=316274 RepID=A9AZG0_HERA2 :  ali  23 1519..................................................................................................................................................................................................................................................................................................................TTVDNEAPTAPTNLLRGVTTANSAAFTWQAASDNVGVVGYSAYLNGSQVAVANCQVTGLGCNLTGLSANTSYSVVVTAFDAAGNQSEASASITFTTSDLDSIQPTAPTNVANIGATTATVSWNAATDNLGVVGYSVYLNGADQAASG.. 1668
360 1.000e-18UniRef50_A0A1Q3HGD6 Alpha-amylase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Q3HGD6_9DELT  ali  22  799.......................................................................................................................DTTAPSTPTGLALSTRTDRSVKLTWNAATDNVAVTGYDVFR-NGTQVGSSSTTSYTDSGLTASTAYSYTVKAKDAAGNTSAASTALSVTTL---APDTTAPSAPTGLTASGTTSSSVALLWTASTDNYGVAGYDVFRNGTQVASVTGTSYTDTGLSPSTAYSYTVRAKDAAGNVSAQSTAISATTGAGNTATVYGFATPYIHFRPTGGT-WTVAPGYAMPDSEVSGYAKYTVNLGSATQLEAVFNNGSGTWDSNNGSNYFF----PTGVSTFSAGTITAGAPVADTTPPSVPGGLTSPSKTSASVSLSWTASTDNIGVTGYLVFRNGTQVGT.... 1124
361 1.000e-18UniRef50_A0A2T6G5F3 Uncharacterized protein n=4 Tax=Paenibacillus TaxID=44249 RepID=A0A2T6G5F3_9BACL  ali  25  633......................................................................................................NTASTATISKVTVNASGDVYPPTAPTNVAVDSKTDTSVGLSWLASVDDIGVTGYDVYRDGQLAGSTTTETFFKVTGLKANTAYSFTVKAKDGAGHVSEPSTPLSVTTAAQ--PDTQSPTAPSNLTSPAKTSSSVSLAWTASTDNVGVFKYDVYKDGKLVDSTTGTTFTVSGLTANTTYSFTVKARDLAGNVSAASNTLSVKTSSTSTDP................................................................................................................................................ 839
362 1.000e-18UniRef50_A0A1H3P9D3 Glucose/arabinose dehydrogenase, beta-propeller fold n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A1H3P9D3_9PSEU  ali  18  37............................................................................................................................................................................................VTASTQSGCCSAAAAVDGDSATRWASTANIDPSWIYVDLGATAHVSRVRLQWDKSCA----TAYEIGVSNDKTTWTKIYSTTLTTVSGDGRYVRMLRCRTDAAYGYSLQEFGVYGTTGGGGDTVPPTPPGKPELVSATPNSATIKWAAATDNVGVTAYDIFRDGQLCATTAGNVLQGTCN--NLNPNVTYGFYVNARDAVGNISQASETTPVKTPPSNDPTVPTNVKASNVQSTSVGLSWTASTDNVGVTGYNVYNASGGTST.... 307
363 1.000e-18UniRef50_A0A0K3BQ53 Chitinase n=6 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A0K3BQ53_9PSEU  ali  21  338.................................................................................................................................................................................................................................................................GTATLSVHDLVMVMTPLKADGTPTGLGTFTSDCTLKDGQTNVLHTFTIETGVDTEKPSVPQNLRKGDVTPTSVGLVWDASSDNVGVSGYEVFVNGQSR----ATVTGTAATVDGLTADTEYSFTVVAKDAAGNKSDPSAALTVRTATAPDTAAPSVPKASGVTETSAVLTWDASSDNVGVSGYEVFVNGSVPGTTATV 538
364 1.000e-18UniRef50_H3SEE3 Uncharacterized protein n=6 Tax=Paenibacillus TaxID=44249 RepID=H3SEE3_9BACL  ali  30  215.........................................................................................................................................................................................................................................................................................................................PSAPAQLAASARTETSITLTWTSSSSANGIKAYEVFRDGAS----LGQTTGTSYLDAGLTPDTSYTYTVRAIDRAGHLSPLSAPLVAVTLPPQTGDTTWKSDAVYTRGDRVLYDGLEYEAQYWTQNNR.............. 356
365 1.000e-18UniRef50_I2GPD9 Chitin-binding protein n=2 Tax=Cytophagaceae TaxID=89373 RepID=I2GPD9_9BACT  ali  13  981..................................................ATGLTLTWTAATDDIGVSGYEVYTLLNGTVSGTSLNVTGLTCNTAYTFTVLAKDGSGNKSAQSSPRSVTTSAAPTVPTNLAANNVTATGLTLTWTASTDNVGVTAYEVYQNGTLLNSNVTGTSLAVSNLVCGTVYTFTVLAKDASGNKSAQSAAVSATTPACPPAGWKEWSWSIDRNYASTNPVKVGQQALAVTYNDGWGGWSVIRDNHFITTPQTAVRFWIYATTNKTIGVSINTENETGQSPYVSFQPTANAWQEVVLTMASQAPGSLSVSNVATTSLRLNWTAPSGNT--SAYEVYQDGNL---LNGNVTTTSLDVTGLTCGTAYTFAVKAKDAAGSGVANSVPTSATTTFCPGSSTVDMIYDEALNPGWQEWSWSLKSGYANTNPVKVGQKSASLSYT... 1426
366 1.000e-18UniRef50_A0A1B3XNL2 Uncharacterized protein n=9 Tax=Bacillaceae TaxID=186817 RepID=A0A1B3XNL2_9BACI  ali  26  213....................................................................................................................................................................................................................................................................................................................VDTEAPSLSGPIEVSHVSDRKVMLKWQEATDNAGIKGYDIYRNGQ----KIGSTAQAFYTDTDVMPETEYHYTIKAIDLSGNESVASEEVIVTTLPLTSPSAPTGLHTMKVTESSVSLMWTASEDNVGVKEYLIYRDGKQIGTT... 356
367 1.000e-18UniRef50_A0A2J4VAZ3 N-acetylglucosamine-binding protein GbpA (Fragment) n=2 Tax=Klebsiella michiganensis TaxID=1134687 RepID=A0A2J4VAZ3_9ENTR  ali  53  4.............................................................................................................................HSAPHRTANWRYYITKQNWVQNKPLTRSDFEPFCQIAGNGVAPAIQVTHSCNVP-ERTGYQVIYAVWEIADTANSFYQAIDVDF...................................................................................................................................................................................................................................................... 88
368 2.000e-18UniRef50_I4DC59 Cell wall-binding protein n=1 Tax=Desulfosporosinus acidiphilus (strain DSM 22704 / JCM 16185 / SJ4) TaxID=646529 RepID=I4DC59_DESAJ  ali  19  480...........................................................................AATGGTVNGGTIYGDAYASGTNVTLTAIPNDGYMFSEWDVDGGTGTASTSNPYPLSVTQNTTLIPVFRATSTKSVTYIDNGSTGGTSFNVSLGSQVTVSGNTGHLVKSGYNFTGWNTEANGSGTAYAAGETFNLTVQWAPVTVPDAPTNVRATAGNASASVTWTAPASDGGSPITDYDVYKNTTLVNTVNTGSTTITGLTNGTAYTFDVKAVNSVGNSAASSATSAVTPTAAA---TVPDAPTNVRATANASASVTWTAPASDGGSPITDYDVYKNTTLVNTVNTGSTTTSAAITGLTNGTAYTFDVKAVNSVGNSAASSATSAVTPTAAATVPPTNVSATAGNASASVTWTAPANDGGSPITDYDVYKNTTLVNTVNT. 878
369 2.000e-18UniRef50_A0A1V4VL32 Exoglucanase B n=1 Tax=Pelotomaculum sp. PtaB.Bin104 TaxID=1811693 RepID=A0A1V4VL32_9FIRM  ali  17  170...............................................................................GANANSYEDTDLDSNTTYYYRVRAYNSSGHSAYSNEDSTTTSAVPEAPSELSATAASASRINLTWEDNSNNETGFKRSGGTYNQIATVGANVTTYTDSSLSDDIRYYYRVRAYNAYGNSDYSDEDSAIT------TDGDEPEAPSDLSATALSSSRIKITWEDNSNNETGFKIERKRSGGTYSQITTTTYTDSSLSDDIRYYYRVRAYNAYGNSDYSDEDSTIT-----TDGDEPEAPSDLSATALSSSRIKITWEDNSNNE--SGFKIERGGTYSQIATVGANITTYTNYSLDDNTRYYYRVRAYNAYGN-SDYSDEDSAITGSTS................................................. 497
370 2.000e-18UniRef50_UPI000D69DA40 hypothetical protein n=1 Tax=Nocardioides sp. YIM ART13 TaxID=2173172 RepID=UPI000D69DA40  ali  24  374...............................................................................GLHEGGLNGNSCPAGDNAIFQPVNEAQKWNLTLLTGGGGDDTQAPTAPSGLRSTGTTANSVSLSWTASTDNVGVTAYDVYNGSALAT-TVTGTSATVSGLTANTDYTFTVKARDAAGNTSASSSVTARTQTGDPGGDDEPPTTPGGLRSTGVTSTSVSLSWDASVDNVGVSGYDVFRGTTLATSSTSTSATVTGLTPNTDYSFTVQAKDAAGNKSKPTRAVIV......................................................................................................................................................... 597
371 2.000e-18UniRef50_W4D5Q5 Beta-xylanase n=10 Tax=Paenibacillus TaxID=44249 RepID=W4D5Q5_9BACL  ali  25 2141......................................................................................................................................................................................................................................................................................................................PPVWAEGSKLEATGITPTGVTLSWPAAMDNLGVTGYRIYNGTGIEPVETATGAVYRYEVAGLLPNTSYTFKVEAGDAAGNWSKDGPYVIVTTLPGEDITPPVWAEGSTLAASGITSSGLTLTWT-ATDDSGIYGYITNGTGDKPI 2295
372 2.000e-18UniRef50_J7VUB9 Uncharacterized protein n=4 Tax=Bacillus cereus group TaxID=86661 RepID=J7VUB9_BACCE  ali  30  239...................................................................................................................................................................................................................................................................................................................SVDKEAPSTPINLKGNS-TSSSIVLEWTASTDNVGVSYYNVYRNGE----KLAPVTETEFKDVTVAPDTKYTYEVSAVDKSGNESAKTMPLTIKTEKASDEDTEIPTAPGGETATTVDLMWVNSTDNVAVDHYEIYRNA......... 377
373 2.000e-18UniRef50_A0A1X7K827 Chitin-binding protein n=1 Tax=Paenibacillus aquistagni TaxID=1852522 RepID=A0A1X7K827_9BACL  ali  28  207...................................................................................................................................................................................................................................................................................................................GGQVQPPTVPTQLISPSQTDKSVTLSWLPSSASQGIKHYEIFRNG----TKVGTSTAPSYTDSSLKPSTAYTYTVVAVDQANSRSGASAPLIVTTKGTVVAPSVPTNVVGHPMETGIHLMWKASSDNVGVVKYDIYRDGKLVGSSTT. 352
374 3.000e-18UniRef50_A0A1K1QPK9 Fibronectin type III domain-containing protein n=1 Tax=Paenibacillus sp. UNCCL117 TaxID=1502764 RepID=A0A1K1QPK9_9BACL  ali  16  410...............................................................................................................................................WDDNSYVDFAWVYITYNVDDPSSASAGFSSTQGANNWSYDGIAFTPMTWDAANYRWKGTSTYNLVFALGHHPDVKDSARKWTASAPGTVRITGNVRKGDTSFGDGV---RVKIMKNQTQLWPSSGWHLIGFNDGVGYNVDLTTNVIAGDGIYFIVNKNVTTYADSTAWDPPAVPSNLRVGSRTSSSVTLLWDASTDSLGPVSYDILLNGSPLDV----TNNTSYIFNGLTATGNYTFTVKARNSFGSVSGPSNTL-VVGGDSQPPTAPGNLRIVSQTANSVTLGWTASTDNIGVTQYRVYSGPALLGTTAS. 725
375 3.000e-18UniRef50_A0A0G0PYQ1 Alpha-amylase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0PYQ1_9BACT  ali  20  219.................................................RIDLSWSSTTEAVTTVTYSVYRNNSTTAGNNYSDTGLLPSTTYSYRVVAADEAGNRATSTEVTATTLNGTSTSGLTKPI-VTAIPVSATQINLTWSSSTQGVGDISYRIYRNGSTSTTATTGNEFNDVGLATSTTYRYIVVATDTAGSRATSTEVTATTLGTGTTTPSLTK---PIVTATSTSPTQINLTWSSSTQAVGKVTYGIYRNTSTIATTFGNEFNDVGLSASTTYKYIVVATDEAGNKATSSEVSATTKSATSTIIL--SAPKNLNAIPLFQVQLNWSSSTAT-NTLVAGYKIYRNDLQIATTTLTTYLDTGLN----PSTNYTYKIAAFDAAGNISDF-AIINVTTQGHAXXXXXXXXXXXXXXXXXIT.............................. 588
376 3.000e-18UniRef50_A0A1G1WFD1 Uncharacterized protein n=1 Tax=Candidatus Woykebacteria bacterium RBG_19FT_COMBO_43_10 TaxID=1802598 RepID=A0A1G1WFD1_9BACT  ali  13  926.............................................................................................................YYYDPPSSPDDTTPPTAPANLAATAVSSSQINLGWTASTDNVGVTGYEVYRDSSTPIATVTTTSYSNTGLSSSTTYSYFVRAKDEAGNRSGPSNTASATTFVYDIEAPTVNPLTPENSAIVSGDVNISATAS---DNVAVTKVEFLIDGVLKYTDTTEPYWDSTKASDGSHTITYKAYDPGNRS-------NAKNRTVTVDNTVPTVSTGPFGGSVVSGTATITATASDSTSGVVKVEFLVNGVVKWQDTTSPYTYSWTTTSVSDG-SHSIVAKAYDAAGNLSSVSADVIVDNTKPSVTVTSPSNGSVVSGDTAINVSAFDSGSNVT................... 1246
377 3.000e-18UniRef50_A0A1L3JGW8 Uncharacterized protein n=1 Tax=Tenacibaculum todarodis TaxID=1850252 RepID=A0A1L3JGW8_9FLAO  ali  24  289..................................................................................................................................................................................................................................................................................................................APTDTQAPTVPTNVTVSNENFTSLDVTWDASTDNEAVTGYNIYVDGTLTA---QTTANTSTTLVDLNPNTTYSITVLAKDLINNFSNESAPVNGTTLPDTTAPTPTNATASTISDSSFVLTWDAATDDNEVESYDVYLDGVLNSNVTTL 435
378 3.000e-18UniRef50_I6T879 Chitin-binding domain 3 protein n=1 Tax=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 64  ali  25  44..............................................................................NGEFNDGLNHWIVSNPGSNNPALVTDESGNHYVM--ASNGENILQYVQLKPKTTYQFTYYVIGDPSFPAIVEFGTLNHGEGFISLKYNDAWKQHEFSFTTPEGENTYIIRFA---SSGNGTAYFDNVQATAL-----DLEAPTNPKNLKVNDVSSDSVSLSWEAATDNVGVMGYLVYRDNQLIQTVNDLAYTDNGLTEDTTYTYEVRAVDQAGNVSVASNA--VTARTKLASSSPPAVPLNLKVTSVTTDSVSLSWESATDSIDVIGYIIYRDNQLI.................................................................................................... 314
379 3.000e-18UniRef50_A0A1B9EZT8 Chitinase A1 n=165 Tax=Actinobacteria TaxID=201174 RepID=A0A1B9EZT8_9ACTN  ali  20  36.......................................................................................................................DTQPPGTPENVTAQASSSTSVHVMWKAAADDEKVAGYEVYRGSKVKSVPATKTMIDVNGLTASTDYTFSVRAKDAAGNLSAPSKAIPVTTQATPPKDDTPPTAPAKLTGRADGSRGATLTWGAAKDDVGVTSYDIYQEDSRIHSVPASETTLTGLRPGTVYTFTVRARDASDKSSADSNTLDLTTASAPGAP-ASTAPTGLRTEVGKEGTLDLSWDQPDTGGTIPAYELHMNGKLTTTIVWGGTATYRLDLPDPAGTRYSVKLRAKLPDGKWGDFSAQRTV....................................................... 326
380 3.000e-18UniRef50_A0A2A4RSW5 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2A4RSW5_9FLAO  ali  22  488.....................................................................................................................TIDTTPPSNITNLATSNTTVXQTDLSWDVATDNVAVTGYEVYQNTNAGVASPVTNSTTIGNLVIGNSNNFTVYAKDAA----GNSSAAASNVVNVITADTTPPVTIADLATNNITETTLDLTWSTT-DNIGVTDYEVFQDVTGVGTPGAASMNISGLILGTSYDFTVYAQDAAGNVSLVSNTATV----LTVDVTVPNTVSDLTSSNITDVTASLSWTPVTDNVGVVNYEIFQDDVSIGFSGGFS---SFDVEELVELTIYRFKVTAIDAAGNASPLSNVEIVETPKESGAIPYTNLNSNLISVD................................. 791
381 3.000e-18UniRef50_A0A117SKL0 Uncharacterized protein n=1 Tax=Clostridia bacterium BRH_c25 TaxID=1734399 RepID=A0A117SKL0_9FIRM  ali  27  31..................................................................................................................................................................................................................................................................................................................ASPDTQAPAAPKRLTAADASHTAISLNWAEAYDNTKVKGYQVYRDG----KKIISTSKTTYTNTGLIPGTTYAYAVRAYDAAGNVSESSNVISAATIGDLQNPSTPGLTAASVTFTSASLTWKPSTDNVGIKGYEIYCNDKKVASTSS. 175
382 3.000e-18UniRef50_A0A285X7Y2 Endonuclease I n=1 Tax=Salinimicrobium sediminis TaxID=1343891 RepID=A0A285X7Y2_9FLAO  ali  24  271......................................................................................................................PDSQAPTVPQNVTVDEVTFETVTLSWEAATDNEGVAKYNV-NVDGEYYTAVSSTSVTVEGLDPGVTYEFTITAADAAGNISDASAAVEGT----TNADEEAPSVPQNLKVSNVAVTSVTLTWDASTDNAGIAGYDIYMNGEFYETVETNEYTVAGLTAVTTYSFAVAARDLYDNVSEVSAAVEVTTEVATGET................................................................................................................................................ 458
383 3.000e-18UniRef50_UPI0009E06AFB hypothetical protein n=1 Tax=Zobellia uliginosa TaxID=143224 RepID=UPI0009E06AFB  ali  25  36.....................................................................................................................................................................................................................APDIIPPLPPKKLEMVQVTDSSITVSWESAKDNVKVVHYMVYQDSIEVARDSLTTYYAENLKPATEYVFSVRASDAAGNNSEFSEKIKVLTEAVAVEDTVVENDTTLSIGKVLKNSVELNWELEINASVVKEYRVFQNT----IQIGNVNNKSYKVADLMPGEGYSFSVAAVDLVGKESKRSNVVEVETLDTIAPTVPTGLKATEIQANSMRLLWSAATDSVGVSTYTVYNDTTVVGL.... 287
384 3.000e-18UniRef50_K2QNG1 Fibronectin type iii domain protein n=1 Tax=Galbibacter marinus TaxID=555500 RepID=K2QNG1_9FLAO  ali  25  111......................................................................................................NTSDPSETLSVATPEDADTQSPTAPSNLATSKLTEGSVTLSWETSTDNVEVVDYQVFQDGSSIGLTDGETTFDVSGLIASTQYEFYIIATDAAGNLSEASNTVSVTTSSDQ--DTEAPSSPTNLNANEITATSLVLNWSASTDNEAVDAYEVYNGDTSIGNTSNTSFNISNLDPDTNYQFRVRAIDNSENVSEFSNVLEVKTLQEEVEPT............................................................................................................................................... 318
385 3.000e-18UniRef50_UPI000A0794BE hypothetical protein n=1 Tax=Demequina globuliformis TaxID=676202 RepID=UPI000A0794BE  ali  42  36.......................................AHGWVTSPPSRQDHCA--AGTTSFDCGQIAYEPQSVEAPKG---------SLKCSGDSGYAVLDDESLP--WPRTQTGTDVTFQWKLTAAHSTSTWEYFV--------------DGELFATYDQGGQQPPSNIQHTLGLP---EGDHTILARWNIADTAMAFYNCVDLTI...................................................................................................................................................................................................................................................... 176
386 4.000e-18UniRef50_A0A0G1FA88 Fibronectin type III domain protein n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A0G1FA88_9BACT  ali  17  795................................................................................FSVSGLPSGVTGSFGSSSCSPTCSTSFTASVSSSANPGTYSITVTGTGGGLSRMTSFNLIKANGSDGPITIAYNSSVTISWTSSGVSSCAVSYPGNSNWASGASGSQSTGALTSSYTLTCDYSGGTITDEVAVNVSEPPPNAPSNLSATAVSTSQINLSWTNNSNNESGFKIERSTSGGSTTGAGAASYQNTGLSAGTSYSYRVRAYNDSGDSAYSNTASAVTI---------PAAPTNVSVSPVAGNCAALSWNASA---GATEYYVMRSGTGAYIYIDATSNTFYQNAGLAGGTTYYYKIVAHNASGN-STDSAAASGTTGLCAPLAPANVSATAN----SCSGILVSWNASAGATGYSVFRSLNGTSGWVDV 1172
387 4.000e-18UniRef50_UPI0009FE0403 carbohydrate-binding protein n=2 Tax=Firmicutes TaxID=1239 RepID=UPI0009FE0403  ali  22 1565...........................................................................................................................................................................................................................................................................................VIMWHDQSGSSWNNGSQWGVVTLVKNDTAAPTWPSTVTASNLGVDAVTLNWTPAEDDTGVTAYEIYKGTDKIGTVAG--NINSYEVMNLNAGTEYTFSVQAGDEAGNISTDGPTVTVSTLPAPTWPQTSTVTASAIGINAVTLNWTPAEDDTGVTVYEIYCGTDKIGT.... 1740
388 4.000e-18UniRef50_UPI000688B706 hypothetical protein n=1 Tax=Paenibacillus sonchi TaxID=373687 RepID=UPI000688B706  ali  37  557.......................................................................................................................................................................................................................DKEAPSTPAGLEVAIERRTSVDLRWNPATDGSGIKGYRVYADGTFIADTYGTSYSISGLTPETEYAFQVQALDYAGNVS--AASVQVRAVTKGEDLEAPALPQGLRVTDTAASRIMLEWQANTEPDLMG-YNLYRGTAGASNKIASLLTSSYADRSIEEKRTYYYKLEAVDSSGNSS............................................................... 739
389 5.000e-18UniRef50_A0A2D6E9X5 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D6E9X5_9BACT  ali  21  241..................................................................................................................MACGTATVAWSANAEADLAGYYLSYSNAGGGSPYTGTDSDQGPSPIFVGNV------LNYTLTGLDQSDIYHFNLEAVDAADNVSSFAQE-----VSGQPQDAQPPSDPMNLAGRVIGNDSIELEWDSSP-EWDIGGYEIHSSNVTVDTSSGPEWVLVGLTNGSVYSVRVLALDACGNASDLTNPITVTMVPCDEDITFPAIPTNFAAFA-GDEVVHLSWDSVPDP-DVVGYEVFESGGGGGTTLLVGNVTSYSVYGLYNQTTYEFQVAALDGCEHTGGFTGMVSATPVQCAGNTDPPAVPSNLTAGDQVSLSWTLSQNEGDILGYRVW-WGTVPGTWS.. 577
390 5.000e-18UniRef50_A0A1V6JGL9 Chitinase A1 n=1 Tax=Bacteroidetes bacterium ADurb.Bin008 TaxID=1852795 RepID=A0A1V6JGL9_9BACT  ali  28  616...........................................................................................YNAAQTACETFSYGEVEDYTVNITQSTADTQPPTAPTGLTASNVTQTTLTLTWNASTDNVGVTGYDIYS-NGSLLGTVTGTSANVTGLTASTTYQFYVKAKDAAGNVSAASNTISVTTLA--PPDTQAPTAPSNLAASNVTQTSLTLTWNASTDNVGVTGYQIYRGGTLLATTAGTSYNVSGLTASTTYSFYVKAYDAAGNVSVASNTINVTTQAATVT................................................................................................................................................. 831
391 5.000e-18UniRef50_F8FJE2 ChiA1 n=3 Tax=Paenibacillus mucilaginosus TaxID=61624 RepID=F8FJE2_PAEMK  ali  19  490...........................................................................NGKTYIHPAGSEQGTYAASAGGRTVYMDGQWNTVFQMQSGPADTSAPQWPAGEPLTSTDVKASEASLSWQPATDNVGVKLYNIYVGGQTASVPGTKTSYTLTGLTPSTAYEVKVEAVDAAGNASAASPVITVTKEVPAGQAPYWNDPAGALTVSGVTYDSVQLQWQHAVDPTGIAKYSLWKGSELLHTVSGESYRVTGLLPGTSYTFSVTAENPAGLVSLNNPTVTAVTYGNGGGEPLPGGKLSL....................................................................................................................................... 744
392 6.000e-18UniRef50_R2QVS4 Serine protease n=8 Tax=Enterococcus TaxID=1350 RepID=R2QVS4_9ENTE  ali  23  197...................................................................VYYDIDSIGGTSGAPVYNENNQLIADGGVAYKNAGSKITGSNYAKHLDQKNADTQAPSQVTGIRASNITTSSVQLSWNPSIDNVGVDKYEVYR-NGSKIGESKTTAFTVNGLASDTAYRFSMVAVDKSGNRSSMSTGVTIRTVKETVGDTQAPSQVTGVKASNITITSAQLSWNPAMDDVGVDKYEVYCNGARIGESLGTSFELSGLTANTSYIISVLALDKAGNRSALSANL........................................................................................................................................................... 438
393 6.000e-18UniRef50_A0A1H4S7H0 Por secretion system C-terminal sorting domain-containing protein n=1 Tax=Tenacibaculum sp. MAR_2009_124 TaxID=1250059 RepID=A0A1  ali  25  792...........................................................................................YNAVPSACGVYDYGETEDYTVVIGGSQSDTQAPSVPSNLTTSNITQTEVRLSWAASTDNIGVEGYYVY-VDGNLVGTTTDTFMNVTGLNPNTTYTFTVVAFDAANNESAPA---TVTATTLSEVDNIAPSVPGNLTASNITQTQVRLTWTASTDNIGVEGYYVYANGNLVGTVTDTFMNVTGLNPNTTYTFTVVAFDAAGNES................................................................................................................................................................. 990
394 6.000e-18UniRef50_A0A0E3WHW7 Uncharacterized protein n=5 Tax=Paenibacillus riograndensis TaxID=483937 RepID=A0A0E3WHW7_9BACL  ali  37  756.......................................................................................................................................................................................................................DKEAPSTPAGLEVAIERRTSVDLRWNQATDGSGIKGYRVYADGTFIADTFGTSYSISGLTPETEYAFQVQALDYAGNVSAASAH--VRAVTKGEDREAPALPQGLRVTDTSASRIMLEWQANTEPDLMG-YNLYRGTAADFNKIASLLTSSYADRSIEEKRTYYYKLEAVDSSGNSS............................................................... 938
395 9.000e-18UniRef50_A0A0Q4M3Q7 Uncharacterized protein n=2 Tax=Yersiniaceae TaxID=1903411 RepID=A0A0Q4M3Q7_9GAMM  ali  35  28.......................................ASGYVSSPTARAQLCKT---GENINCGSELIQSETTES--GFPRL-----LLASAGLERYQALDTESAAQWHKNPITQGKLDISWQITSPSNISNWKYYMTKPDWDKQKRLTAASFEPFCEIANDATQVQQGISHQCQLPV-RDGYQLIYAVANLADKASSIYNVIDV--------DFESSNV-------QVTA-SINGEWTATIDRLVVDSPVVVKAGDVV.................................................................................................................................................................................................. 242
396 1.000e-17UniRef50_A0A2C2T0P3 Uncharacterized protein n=3 Tax=Bacillus TaxID=55087 RepID=A0A2C2T0P3_BACME  ali  26  929..............................................................................................................................................................................................................................................................YTLDGTLPTTSSIQYS-TPLKLSNPTTLKVIAVDAAGNQSKVKSIQFNI------DKTPPTNVTNLTATPFNDK-VDLSWTASTSN-DVLNYEIYNGD----TLTGSINSTTYTVTGLLASTQYSFTVKTVDKAGNKS-SGISITVTTSQDTTLPEVSNLLASSITSDSVGLTWTLSSDVASYEIYRDNGNVTTTNYSVT. 1121
397 1.000e-17UniRef50_A0A1G6EYM9 Por secretion system C-terminal sorting domain-containing protein n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A1G6EYM9_9FLAO  ali  20  867......................................................KLNWSASTDNSGVTGYEVYTTTTSTNFDVTGLQSNTPYSYYIIAKDAAGNKSEKSNNVSATTSGTDIAAPSAPTTLSVSNITINSLRLNWSASTDNIGVTGYEVYQ-NSTLISTTTSTYINLSGLISNSAYSYYIIAKDAAGNKSNKSNTVNITTL---SVDSIAPSSPSNLTASNITTNSANLSWYSANDNVGVTGYNVYRNGVLIANITGTTYQVSGLSSQTTYIFTVKATDAAGNLSDASNSVDVTTDGGGSITQSYCTSNSNNINDEYISRVQLNTLDNS-----SGAKAYSDFTDVSTELLIGSSYSITITPTWSGTVYS............................................................................ 1188
398 1.000e-17UniRef50_A0A1M4TNY6 Por secretion system C-terminal sorting domain-containing protein n=1 Tax=Mariniphaga anaerophila TaxID=1484053 RepID=A0A1M4TNY6_  ali  25  498.............................................................................................................................................................................................................................................................................................................VVSTISASDETAPTAPSDLVAEPA-ETTITLSWAASTDNVGVTGYTVYVNG----ILQGTTTETVYALTGLEAATEYQISVEAIDAAGNSSEKATVVVSTSATPDETAPTTPVDLVAEPETSISVSWGASTDNVGVTGYNVYNDILQGTITETV 648
399 1.000e-17UniRef50_UPI0009E2C5F0 hypothetical protein n=1 Tax=Paenibacillus sp. IHBB 10380 TaxID=1566358 RepID=UPI0009E2C5F0  ali  25  326...........................................................................................YNGTSYEAKWWTQNEIPGKAQVWKLISDAGQGPTVPTGVHSMKTTYTSVSLMWTASTAPTGITQYEIYS-NHILVGTSTTTAYEAIGLSANTSYVFTVKAIDGAGNKSQASSAFTVKTSTDGGTGGNEGNNYPKWDATKA----------------YVGGEKVQYNGASYE--------------------------AKWWTQNEIPDKAQVWKLISDAGQGPTVPTGVHSMKTTSTSVSLMWTASTAPTGITQYEIYSN----HILVGTSTTTAYEAIGLSANTSYVFTVKAIDGAGNKSQASSAFTVKTSTDGNNYPKWDAKKAYVGGEKVQYNGTSYEAKWWTQN................ 633