current user: public

If you have questions about the server, please let us know.

Query: IDP05533 hypothetical protein CD2149 [Clostridium difficile 630] CD2149 [Peptoclostridium difficile 630], from CSGID

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# E-value Template Links and tools%idFirst MGRRTTRVSRLGKEKKRSVLIVLAALVLIMGGFTYFFNSKFLYNGKIAKNVYIEGVNVSDMTKAEALKAITDKYTPEDLNLAYDGKKYTISPKDIDLKYDTEDVVKDAYESTKKGSYFQNLKKYIDIRVNKANMKIKAEYDEAKLSSKVSSIADSINVKMKNASISVGSGGLSYTDSVVGREFDLAANKESIYNMIKNKEHKTLELKVNLQKPDITTEQVKTVNSVIGQYSTTYSQAVEGRSYNVGLSARKTSDVLLMPGEEFSYNKLTGPSNKANGYKDAPVIVYGKLEQSAGGGVCQTSSTVYNAALLSGMEITQVTNHSSASTYVPKGRDATVSDGGLNLKFKNPYKHPVYIKNYAGGGSVSSVIYGNSGDKPNISIEVKQTGQNKYSTYRIFKDSNGKVIKKEHISNSSYKELKKLast
1 0.000e+00UniRef50_A0A1Y4NEB4 Uncharacterized protein n=1 Tax=Anaeromassilibacillus sp. An172 TaxID=1965570 RepID=A0A1Y4NEB4_9FIRM  ali  25  154.................................................GIFVNGQSIGKMKVSDARKLLEKYAKDNTYTIKLGENTYDIQSEGLELNANIDSVLATAAKYTKEKG--DALPTDKNGEIQQIEYTLPFEITEEVLTEQLDKASEVLNTEPVNAEVVGTDEKFTIEGGTDGQNLNYDSAVEEMNKLLTQEETGEVEPKTDAVEPEITAEMATENMVPIATFSTN-STNTYNANHNMATALAACNGSIIKPGETWSFNDSTGNSNLENGYVPATVIANGEYTSGVGGGLCQASSTIYNAALFANLEIVERYNHYWASPYVYSGFDATIDWGNLDLKLKNNTDYSVYLEAYMEGTTLTVTFYGWKDYDGIATYSYNYEGPSGYTAAFRIYIKDGEEIRREELPSSTYR.... 533
2 0.000e+00UniRef50_A0A1F6SA39 Uncharacterized protein n=7 Tax=Candidatus Moranbacteria TaxID=1752737 RepID=A0A1F6SA39_9BACT  ali  24  45.......................................................................SAMTPNSLIIRSGDYAETVAPSAISTRLDTHLAYDPSIQSEIEDTSFCPAQKLFRYASHHLHNTLSRQTDMAALKAFVAELAERINQDPVDVKFSVDGDRVIIEPEKVGRRLQEEESLKLLSSALQTAETETITLPTEVTQPKLVSSDREGLRELVGEGRTNFKGSPKNRVYNIKRSLEQFQNVIIAPGEEFSFVKYLGDVDGEHGYLPELVIKNNQTTPEFGGGICQVSTTVFRAAIYSGLKITERRNHAYPVKYYPYGMDATVYIPKPDLSFTNNTPGAILIQSSIEGTELTFRFYGTNDGRKVTILQRNPDGSMKTVFSQLVTDAAGESLINDSFW-SNYKS... 407
3 0.000e+00UniRef50_UPI000B49F77C vanomycin resistance protein VanB n=1 Tax=Desulfosporosinus sp. FKB TaxID=1969835 RepID=UPI000B49F77C  ali  22  2..............KRAGFILTVLLVQLCVTLSLGSVATYASTHDRAPSGLVIWGRNFSGLNRAEIASELKKNMPNA---IIYQGKSFPLKLERSYAKID--NWLNQIFPPVSGVW----YLDVLQSLIHKPVLNPVPELDRADIVSQLKAIGAQINKPMIPATISYMNHHFEKASGQNGRALNIDATFNKITN---DHINKQVDAVVEEIPVQPASAEIDKIRDVLGDYTTYFSPQDASRTQNVRLAANAINNYLIAPGKVFSYNKVVGERTETAGYLPAYIFVGQEEIKGDGGGVCQDSSTLFQAVREANLKVLERHNHSLPVSYVAKGQDATVAYGLLDFRFQNDTKGYLLVSALTGNNWLRIRLFGVADPNHPVQQ------ADGYPVRPDVFNED................... 369
4 0.000e+00UniRef50_A0A1F3C7W8 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium RBG_16_67_12 TaxID=1797288 RepID=A0A1F3C7W8_9BACT  ali  24  31..........................................YAGRVLPGVRIEGALVSGLGASQLAARIQAPALARPVTLKAVAHEVTLTASALGVTPDVARTSAAALAVGRTGSLLDRLRDRAVMLRIPTDVRIVYQYDAVVARDAIARFVSLLVVEPQDAAVTVTRGRLTVVPSQDGVVVDIPLSTVRLIAALVH-WQPEVRLAFELRRPAFITEMADQMAEPVAQFTTTF-AYNPDRVHNIRLAASALRGLLLPPGALLSYNQVVGPRLPERGYRKAPVLINNELVPGDGGGVCQVSSTLFNAALLADMAVESRTNHSRPVPYLAAGRDATVEYGSIDLRLRNTTGRPLFLWTEVSSRSLTVSIFGAPQPGREVAIIVTDQPAPSHTVVKRVVRQEGRVVRQEVVAANYYQPTPR 436
5 0.000e+00UniRef50_A0A136L0W4 Putative vancomycin resistance protein n=1 Tax=Armatimonadetes bacterium OLB18 TaxID=1617424 RepID=A0A136L0W4_9BACT  ali  25  14.............PRMKRIAWITIALGAIGGGLAYF---HFAHVPTYPSGSVVGDVAVGELTPTQAESALRSRWNEEPIARLAGGRTLQARIGDLGIEPDFGATLAQLQTEG----LFQTWYGKLFTPKSKGALPWVWRLDSAKASA-VSERVREVLGPRSPAKAFWVEGKVELTHEVPDAEVDFDSWLASL-NAGETFLDEPV-LPLRTGAFHVPPTELSKIQEVIAEFATTFPAGERSRNTNIRIASEKIDGVVLMPGEEFSFNDSVGRRTIENGFKLAGVYRSGRHDVGIGGGICQVSGTLYNAAVLSNLEVVQRANHSMPVPYLSVGRDATVDYGKIDLRFRNNYDFPIAISSTFQPGKLTFRVLGQKDPSLEVKIRVVEKGSRGVTTYRDVY-RNGARVSRTVLNSSRYS.... 437
6 0.000e+00UniRef50_A0A0K2SQ17 Uncharacterized protein n=1 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SQ17_9FIRM  ali  25  42...............................................................SEARDLLQRDLSRREVVLEAPGRVWRLAGAEVGLTVDRVATVTLAGSAHPPAGSPSLPVLRLETW---------------RIKSLLREVAGTVRVDSVPARLDEQGG---IVPDRPGRQLDLSEAVRRVSDAFASGAPVRVAIPLETVRADVTASRLEALAELLASYTTRFDPAAANRASNIRLGVSLLDGTLLEPGDTFSFNRVVGPRTEARGFKPAPVIISRQLVSGLGGGVCQLSSTTYNAALLSGLEVLDRQHHSMPVGYLPIGRDATVYDDLIDLRFRNSLAHPVMVQGHVEGERLTVAIWGHPGGRATEGLEVVDPGRTGYEVQRVFYGADGEVDRVELLSRDLYPPEPR 427
7 0.000e+00UniRef50_A0A2H0R3H9 Uncharacterized protein n=1 Tax=Candidatus Yanofskybacteria bacterium CG10_big_fil_rev_8_21_14_0_10_46_23 TaxID=1975098 RepID=A0A  ali  26  42........................................................................NLDKEALELAFQGENLTLSVPETGASFTVPRDI-----------FETWLETYTRAYTRKKETRLIPQV----VADYLDSIEFEVNKAAVDARFKFSGGALQTSPAQKGYALNKDASLTAIHRQLAQGQAL-LNLVVNTVDPEITENQINGITALIGQGTSDFQGSSVARQHNVQTGAKRYNGTIVKPGEIFSFNDRLGRVDAASGYQYELVIKGEKLIPEYGGGICQVSTTVFRAAFYSGLPILERKAHSLPVRYYPQGFDATIYPGVVDLRFRNNTPGHILIQTEIVDTRLTVSIFGTDDKRIIEIYETSEDGALKAVIARQVVYANGEVENKS--FYSNYKSPSK 379
8 0.000e+00UniRef50_B2A3X4 VanW family protein n=2 Tax=Natranaerobius TaxID=375928 RepID=B2A3X4_NATTJ  ali  24  39.......................................QYRYQNTFIPGISIAGINISEKSHTQVXXXXXXXXXXXXXXXXXXENTWEYNFHELGMDWMVKASFDKALD-NDELSFFEGIKLLLAEISQDQEIQLEHELDESKTKSIVSNLRDEIAQKPQDAEYQVNKQSVSIKPHQNGKEIDESKLLEQISQDLRSFTDAEIEIPTTTVEPDTLTEELQGIDTLISTFETHYDEDDEQRVTNIELASEKLDNKKLEPGEKLSFNEVVGPRTRERGYQEAPVIIDGELVDGLGGGICQVSTTLYNSVLKAGIIPIERSPHGIPVEYVSLGRDAAVAYDYLDLVFENHRDNGILISTLVDENRLRVDIYGSQES-HDYTIRTEDYQEIHPDTIYFLKTDDGERVE.............. 418
9 0.000e+00UniRef50_A0A1I4LGQ4 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Paenibacillus sp. 1_12 TaxID=1566278  ali  24  32...........................................QNRMPAGYFVDHWHVNGITYKEFEQQLNEQIKQQPLRLVSEQTTVTTTMEQLGLRVSLEDVLEPLTQL-RSGSPWSRALSRWQL--NNRHQALRYEFEPAVLHGVLLQQFPSLYQQPSPARIVGPTDQISYIPDKHVSRIDETALLQQLRDAVESRGPVDIPLSFVTQNPELTLSQAQGVDRKISEFSTPLLQTSEGRLHNVRSTASTIHDLLMKPGEVFDYATYITQTEARFGFQEAPVIVNGKLVPGIGGGICQVSSTLYNAVLRAGLAIVERRHHSLPVSYVALGQDATFAAGHINFQFRNSTDKYLLIRTSVDDRQMTVKLFGQIPLDTTYAIESISEGRPGYVVTLRYKKQADRIIAQERISQDTYAAQP. 455
10 0.000e+00UniRef50_UPI000BFC8F5C hypothetical protein n=1 Tax=Bacillus thuringiensis TaxID=1428 RepID=UPI000BFC8F5C  ali  25  1.......MIKKKIKRTKCLIFVFTILLVTLISFKIMYHISSVNHDVVLPNTHIESVDVGGLNRKQLESMNQEQIKQKEITFALGKAKRTYSYQEMGIMYEPTLVIDKIFDQQGENKWTGWLKQLAEIGFRKIDYKLEPKIDDNKLQHFIANEFTKFQKEPTNAFIKISNSKISYFDEKIGKKVNITMLKKDILDAVYKETNNVV-VKYSNIHPNLSLQDLKKIKNPMSEYKTDLLGRSENVRENIEKAAMKLNGVVVPSNKEFSFNEIVGITDQAHGYKNAPVILHDKIIQAAGGGVCQVSSTLYNAVLLANLDIVYRVNHSHQVKYVPAGLDATVADNGPDFKFKNTTDTPIYIKTIVKDNQLI...................................................... 368
11 0.000e+00UniRef50_R5ADG1 VanW-like protein n=1 Tax=Clostridium sp. CAG:1024 TaxID=1262770 RepID=R5ADG1_9CLOT  ali  24  2...............KRAIIFSFICVLALLSGCA-RKAREITDRTLLPAGASLCGVNLSRVRMGSATAAIEQKLGEPQITLLLPGNSVHFRGSELGLRYDVRSALTALCQ------------------GEPCDG-VALAADRTLLEARLSRFAEGYRTPPTNASVEINSEPFSYTDAAAGTAVDLPLLIQKILCATAAGDAGSIEVPLRTLEPEVTLADIQKYRQPIASYSTSFAKSPKNRVHNLKKAAAAIHGTVLAPGEEFNCNAVLGDRNKENGWLEAAAIRNGSYVDEYGGGVCQVSSTLFNAVLMADLTVTERKPHSWPMGYIGIGRDATISTGGKNFRFVNSTEHEIVIGASVDEHTLTCTLYGMPPADHTIRIVSEQTGSKTSRTFKEYYDASGALIERIVAFEDVYRSIP. 423
12 0.000e+00UniRef50_A0A1F4U4J1 Uncharacterized protein n=1 Tax=candidate division WOR-1 bacterium RIFOXYC2_FULL_46_14 TaxID=1802587 RepID=A0A1F4U4J1_9BACT  ali  25  3...........NKFNLTVKVLSVVAVISLCFALFFLAVDFFGSRGRFPANSFIGKVDVSGLDKAEAVQRIKTTPVPAAVYFNASGETFAYSTQELGIYIKAEESVNNALSQANRGNYVEGLQ--KRIYKEVESFPLILDAEPAVLQTLLEDLATKVESVAQNASISLDEKTYNIVEDFPGRKLDIKKSIDECRSRLNESKN-TFSLSLDYYEPRVTEYALRSPVHKLASFTTYYTHDSPNRIHNIKLIASWLDNTLLLSDESFSLVKAIGNFSPERGFKQAYVISGGVLVPEYGGGTCQIGTTLYNAVALADLNVISRRNHSFYFSIYPFGRDATVYPGSSDFRFQNNTGAPILLKAEATGRLLRFAVYGTPTGKKVEFSEVYSLTSRGFVVIRKVYDKTGKLLKEETI-TSFYK.... 431
13 0.000e+00UniRef50_A0A0J1FY68 Vancomycin B-type resistance protein VanW n=17 Tax=Peptococcaceae TaxID=186807 RepID=A0A0J1FY68_9FIRM  ali  24  2..............KRAGFILTVLLVQLCVTLSLGSVATYASTHDRAPSGLIIWGRNFSGLNRAEIASELKKEIPD---VIVYQGKSFPLKLERFYAKID--NWLNQIFPPVSGVW----YLDVLQSLMHKPVLNPVLELDQDDIVSQLKAIGAQINKPMIPATISYLNRHFEKTSGQNGQALDIDATFHKITN---DHVNKQVEALVQEIPVQPTPVEIDKIKDVLGDYTTYFNPQDAPRTKNVRLAANAINNYLIAPGKVFSYNKVVGERTEAAGYRPAYIFVGQEEIKGDGGGVCQDSSTLFQAVCEANLKVVERHMHSLPVSYVAKGQDATVAYGLLDFRFQNDTKGYLLVSALTGENWLRIRLFGVADAN............................................ 350
14 0.000e+00UniRef50_A0A1W6WFJ9 Uncharacterized protein n=1 Tax=Ruminococcaceae bacterium CPB6 TaxID=1572656 RepID=A0A1W6WFJ9_9FIRM  ali  28  69..................................................VTVEGISLKGMTMAQGRSAVLEQMEKKTYTLTHGEKSYTLSGKDLHISYNTNAVLQRAMQAGXX----XXXXXXXXXXXXDTEYRLTPTVDQTSLQAKLEDLTKSVNHSAKEPTISFDGSGFSFTEGTPGVKVSNSALLKKVLDVIPTSDSATISIPTETVDCTRTIDDLRQHIVKLGSFTT-ISRNTENGTYNMSKALRAVNGTVVPANGTFSYLGTIGEAGQSQGYKLATALENGQAVQSYGGGICQGSTTIYGAAMRSNCGIVERSPHSSPSSYVPIGQDATVSFPGLDFRFSNPTDYPMYIQSGADGRTMYCTIYGYKSDTIEVSSKTVETGRY-ATCTRTFY-KNGSAVRTESMPSSYYPP... 439
15 0.000e+00UniRef50_A0A0M2NBI3 Vancomycin B-type resistance protein VanW n=2 Tax=Catabacter hongkongensis TaxID=270498 RepID=A0A0M2NBI3_9FIRM  ali  28  62.................................................GVWIDDVDVSGWTREQAEATLEQEAQDVEIKLTFNDKEKTFNAQELGIKSNIHEIIDQAFEAERDKSLVQNYETALEQKAGKRYYS-GIETDKQTLGNSVEEFIGKNSVQATDATFHKDTRRFTYTASKQGITADTASVIAELSERIQNKNFDALQVMGEIVYPKVSEEDLKENTVLIGSCET-IATDNANRNTNIRLMCEAVNGLKLEPDQQLSINELVGQRTAEKGFKEAAAIADGKLVNELGGGICQLSGTLYNAALRANMEIVERVHHSFPSEYLPIGLDATLNWDDKDLIIKNTSEYPIYISAELDGKIVRVNLYGQPPDGTEIEIVLIQKEHKGYDVYRN-YYKDGKLEKKELISKDHFSA... 463
16 0.000e+00UniRef50_A0A069DEW0 Uncharacterized protein n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A069DEW0_9BACL  ali  26  30..........................................HQTKLPSKVTLSGWAVGGQDIPSVFRELDQALEELPLQLKEGNRTPKLTLQHAGVKYSANE-FKQAAAGLSEGSMVQRLFNRLRFQ---KDWSISYSYDRAKLQSYLSPAWEQSFGDMIPAKVHITKDEIEFIPEHSANRITWTEMTRRIEQAVPADFTRVIDLPLQVMNPSVTIDSLRGIQRKIIQVSTPLGTSGEGRTYNVTAAAKAVDGMILKPGEELDYGQMVNKAEKDSGFKEAPVIVGGELVPGIGGGICQVSSTLYNAALRTGLHIVERRNHSLPVSYMPKGLDATFATDYINFKFKNTTGKWLLIKAEVRDRELVVKFFGTMPENVTYELEVVQEGAPGYIVEYQIKRINGAIVSRTLISKDTYRPQTR 449
17 0.000e+00UniRef50_A0A0Q1F8Q5 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=A0A0Q1F8Q5_9FIRM  ali  29  36............................................NTIIQGANINGVDIGGLTKVKAQKKIDEELKNRQVIIKYGGKESKTTIDKLGFEVEDKDYVDKAYQIGKKGSIFKKFKEIVSCSKKDVTYKLKTNLNEDKLRKFIKLKSKIHNKKMKNSRLKMVKGKLKATKDCTGLKVNVDATVDRFSEKLNNDKKLVLDAVVSIKKPKYTRKMYSKCTDLLGEYSTDYSSSTADRCSNVQTAAERINGTILKPGQTFSTVKVIKERTVENGYKAAPEYAGGKVVSGVGGGVCQVSTTLYNAVINAELEVVERSPHSMVVHYVNVSRDAAISGNYKDLKFKNNTKSLIYIAASAKGGVLSFKIFGEDTREKDRKIEVTQSAHTGYKLWKIIYIK-GVKKKRVLVNTSSYNAEP. 446
18 0.000e+00UniRef50_UPI000B4AD3EA hypothetical protein n=1 Tax=Kineosporia sp. R_H_3 TaxID=1961848 RepID=UPI000B4AD3EA  ali  22  45..............................................VAPRTTVGGIDVGGMTRPEVREVISGPLAEKTITLTAGDGQIDVDPGEAGFALDARAT-ERALLATAPDTLLGRWRQGR--EDTRRDLDPVVTVDEEKATAYLTERLAPLDREAKDATVTTTQGTVEVGEARTGQEVDPARALTAVRAAVNGLRTR-AEVEVRVTQPTLSTDEAREVDQLIGTFTTA-HPCCQPRVTNIHRMAEIVDGTVLMPGDEFSLNRTAGRRTAERGFVPAPAIVEGESEDQVGGGVSQFSTTLYNATWFAGIDLVTHAPHSQYFSRYPPGREATLDYDSIDQKFRNDTDAPILVRTATTGTTVTVALYGHTGDRTVVSTTPTADGGFSIVVTRVVRDG-GEQVSTKE-ARAVYK.... 430
19 0.000e+00UniRef50_A0A1H8IZL4 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=2 Tax=Lihuaxuella thermophila TaxID=1173111  ali  32  231....................................................................................................................YLEDEKFELDLRTIGYNGEDPSTIDEAKLRDWLQDVNMKVYQPAQNAKMRRWGE--EITPEKPGRKMDV-KAVEAWLTSLKPLINKPQEIPMISVEPLVTAEDLRQVNGLIGDYRTKFDGSNVNRTTNIRLASKAINGLILMPGEKFSFNQIVGPRTAARGYKKAAVIVKGEFSEGIGGGICQVSSTLFNSVDEAGLRIVARYHHSAEVTYVPPGRDATVSWGGPDFKFRNNLNKPVLIKIKVGANSITVYTY-TVPGAKVHTKKVEDAP................................. 497
20 0.000e+00UniRef50_A0A1V5PAK8 Vancomycin B-type resistance protein VanW n=1 Tax=Firmicutes bacterium ADurb.Bin356 TaxID=1852890 RepID=A0A1V5PAK8_9FIRM  ali  24  30..............................................FPDGAYIDDIAVGGMHAEQAREKVEKRIAAKSIRVQSDGFAHSFTYYDAGAHLAMDDAFTK-LNALSNGELLLKLNNRLMAK-SGFYTKTEVLFDKERLRLAVEEFANEAYIAPIDAVVIFEDGDFSFTKEQSGSRLEADELTELLYERFVHGNLDTINVERTELAPAITESLLMQHTKKLGTASTAVFGSPE-RLTNICLIVDAVNGHSFMPGEILSLNALTGERTPEKGYQQAPAIRYGELTEEIGGGICQLSGTLFNAALLSGLEILERHHHTWPSDYLPVGLDATITWPNKDLKVRNSTNWPVYIHATMLDDTLTVTFYGEDDTRPEGYKRVLNKERAGYRVYRKYYNGD-TLTQKELIHTDRFYP... 429
21 0.000e+00UniRef50_A0A1H8IDM1 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=6 Tax=Paenibacillus TaxID=44249 RepID=A0A1H  ali  26  66.........................................................VGGMKETEALQLLKQALEQLAVTITKDGKKRTWTLAELGISVSIADA-QSAIEKLKQGSMWDRARYRWNF---PRELAIRVAFDRNKFVQRVQSQWGYLNTEPVNAKRTITTDEVVYWPHKDAYRLDTEKAVTAVEAALRDNWPMTWPLALKAVHPNVTLDRLKGIDRLLVAFTTEFATSGAGRAYNVTMTARTLNDWDLAPGEVFDYSTVIKQTNKQYRYRQAPVILNGAFVPGIGGGICQVSSTLYNAVLLAGLDMVERRNHSLPVAYLPLGRDATYADDAINFRFENTTGKHLLIRTVVEGRKLTVKLFGTMPQGVSYSLESVTEGKPGYVVTYRIKKVGGKQVSRTRISRDVYKAQP. 481
22 0.000e+00UniRef50_R6HH00 VanW family protein n=1 Tax=Clostridium sp. CAG:575 TaxID=1262823 RepID=R6HH00_9CLOT  ali  31  2..........................................................SGLTAEEARSKLEKEKQEKDIMLKYEEYETNINSELLDINYNIEEAVREAISFGKEKNIFANNYDILFALFGFKNIKVNMEINEEETKKTIEDIGTKLPGAVIEPEYIIENDNLIITKGKEGITVNEEQLLKLIKNKLEDITDNEIEIPVIVLYPEVTIEEAKKIMSKIGSFSTRYDATNIDRTTNLELACKKLNDKVVLPGETFSYNNTLGERTAATGYKNAKVYMAGEVVDGIGGGICQISSTLYNAVLQSNMEIVERRNHQFVTSYVPAGRDATVAYGSIDFKFKNTRKYAIKIKATVSDGIATISIYGIKENDEYGTEKVKQSGANGITETYIIKSLNGKVVSKELLSKDTYSAMQR 458
23 0.000e+00UniRef50_A0A1H7L7B6 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=8 Tax=Pseudobutyrivibrio TaxID=46205 RepID=  ali  24  57...........................................DDRIIPGITIEGISVGGMTVTEADTVVADQYDDVEFTLSANDQTISATGADLCIGAKNSDVTVKAATYGSYGNFGERFKASQDLAEGRKDFALSLGVDKDGVILYLNSASTQVNDEASDDYLTRENGEFVFHEGTSGVVVQIEESAAIIVDYIENSWDGTIALATEVKEPRGSKEELAEITDLLGSYSTDYSSSSAARKNNVANGVGFINGTILYPGDEFSVLNTITPFSAENGYMLAGSYENGTTVETYGGGICQVSTTLYGAVREAELEVITRSCHSMIVTYVPPSQDAAIAEGGKDFQIRNNKNYPIYIEGYCDGSNAYFSIYGKEEDDASVEYETEITGVNQATTWVXIVYENGEEVSRDVYNNSRYNPSNR 469
24 0.000e+00UniRef50_A0A1W1YZP2 G5 domain-containing protein n=2 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A1W1YZP2_9FIRM  ali  24  120..................VLTVLACLVLIAALGTGGYFAITNYDGLFCPGVYVDGIHLGGMTPEQAENQIRQQHDNWKVQLTYNGEVLEINADMLGFSVDTATVLTNAWAQGHTGTAEQRYDAMLRLEQEPYDYTAKPEGNTQVIDQKLAEIKEKIDTPARDATMTFDPSQFLFEEEVYGRVLDTAPLKEQLYHMVSTMETGSVEIQPEPIEPMVKVNDLRSTCALRAEATTKIDHSTDERNKNIARAFEFINGTVLKPGDTFSFNKVVGERSLARGFYEAIEYVSGEHVTGVGGGACQASTTVYQAALKAGLNVTKRYFHNDKVSYADYGLDATVYWDRKDLVFKNNTSGNIYITAVVEKDRTRVDIYGMYRGDVRYELQSEQKPKYKYTSYKVVEARDGMKVDRKLLYTDTYEPQPE 584
25 0.000e+00UniRef50_A0A1M6KAN5 G5 domain-containing protein n=1 Tax=Anaerobranca californiensis DSM 14826 TaxID=1120989 RepID=A0A1M6KAN5_9FIRM  ali  28  36..........................................FNHIFYPGIYVNEVPIGNLSLEDAVVILNAALNTKGIVLENNIKQWELPMEEI-VYFKIEEGLTNILKKQKKNSFIKGFF----VRNSPQYYKIEFTLSKSIL-NYIDKIRSEEEIPPKNAEFFISDKKVNILPHREGKTINIEETIEEIYQAISEGKYKS-KISYKTLVPQITTVQLENLKDHLFSVQTYYGDSSENRLHNIKLAAGNIKNILLLPGEEFSFNKLVGPADETGGYKEATIIVDGQFVPGIGGGICQVSSTIYVGALKANLEILQRHNHGRPVSYLPKGLDATISYPYLDLRFKNNTEYGIIINTLTTSTHLIVDFYSYKPLFPDIEFETVQKGQVGYKVYKIITDVNG-ITRKELISIDTYRPVKE 434
26 0.000e+00UniRef50_A0A1W2A2T3 Putative peptidoglycan binding domain-containing protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A1W2A2T3_9FIRM  ali  26  133..........................................YNEKFCPGVYVDGIDLGGMTADEAREAVNSRIRQWKVQLTWNGTVYEIDADMLGFNVDTESVLYEAAQLGHTGDAETRYEEMLRLEKEPYQYTAKPDGNLRVIDEKLAQIKVQIDKPAVDARVSFNDNPFTFEEEQYGWSLDTEEVRKEIWRRASALESGTVELTPKKITPSVLLENVKKNYTRRGEAVTDIR-YDEDRNKNIELAFEYINGSILKPGETFSFNDVVGRRTQERGFYPAIEYVYGEKETGFGGGVCQASTTLYQAAVRSGLTIVERKQHSERVNYTQPGKDATVYGKKIDLKLRNDTDGPVYICTEVTRKIARVVIYGKDPGGVTWDIVTEEPAENGCIVYR-VEYTNGVETNRVKLGRDEYKPKP. 555
27 0.000e+00UniRef50_X0ZJL1 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=X0ZJL1_9ZZZZ  ali  27  16....................ILLSLMIIIVAISLVDAVDIYKNRNKILHGVSAFGVELEGLKKEKAREILQSKMIDSPRILVFENKEIKIPHTELGTFIDLNRVVEETYGIARTGNIFRRIKDRIVVWRKGYEVPFQAEFNPQKFEDFQNKIISLINRMPSDAYVDGN----RIIESRIGVXXXXXXXXXXXXXXXXXXXXXKFDIPVITIDPKITTQNILAINRELGTYSTSLENKEENTVYNIRLASEVINGILVKPQEIFSFNKYVGPAEKADGYKESTIIANGTFVNGYGGGICQVSSTLYNAALLVNLPIIERYNHSVYTEYVPLGQDAAIFYGFKDLRFKNNLDHAIVIFSKVFRDTLQVSIFGGNEDKAEVEIISKQEGVPGYKTYRIVR-KDGEE-KIEFLAEDTYKSVP. 446
28 0.000e+00UniRef50_A0A2C6MCZ2 Vanomycin resistance protein VanB n=1 Tax=Desulfotomaculum profundi TaxID=1383067 RepID=A0A2C6MCZ2_9FIRM  ali  37  6........................................................................................................................................................................DNKVEISPGHSGRLVDIHQLSQDIRQNLLQRSKSPIELKLVEVPPARTTEEVKGVDTLLGMFSTQFDPNKVNRAYNVSVAAAALDGLIASPQEIISFNEVVGPRSTEAGYKNAPIIVNNELVDGLGGGVCQVSTTLYNAVLLANLEVVERTNHSIPIPYVPIGRDATVVFDNVDLKFRNNTDHWLYIQSYVTGGRLTIKIFGNETYQPETITEVKQKGAQGYKAERIV-IQDGKVIKVEKLPSSVYKARNQ 284
29 0.000e+00UniRef50_A0A173YYI3 Uncharacterized vancomycin resistance protein n=3 Tax=Clostridium ventriculi TaxID=1267 RepID=A0A173YYI3_CLOVE  ali  26  14....................IVALCMFVFIGALTTGANQTRVEEEVVYDGIYLEDKNLGNLTRDELIDVLNEKLQENTINIVYQDVNEKINASDVGLSYDVKDIADEIINIGKEGNLIKNTLDRIYIKINKKVISFDEVCNDKILDEYIDNLSSLIDIEKEDARVSFNGDEMLISNSREGLIVEKEELKRLIIENLNNETFDEIVEVPVNVVEVEIDEDVFNNMNVLGTYETTLPDLTSGRTQNIRLFSSKLNEVVLMPGEVLSVDEQGGSREISDGYTAAPGFINNEVVPIVAGGICQVVTTLYNSVLYSDLEIVERAPHSLPVSYVSLGRDATLAKGVVDFKFKNNYSNPIVVQAYVTDNTIKTTIWGNENPEKSIEINAVKTGNKSSITYKNTYES-GVLIKSEVLSKDVYN.... 418
30 0.000e+00UniRef50_A0A0F2Q930 Uncharacterized protein n=1 Tax=Clostridiaceae bacterium BRH_c20a TaxID=1629719 RepID=A0A0F2Q930_9CLOT  ali  25  25...........................................SGTIPANVSIEGIDIGGLTLQEAEQKIAEHY--KRIKFYYKTFVSSLSPEELGISIDFKGTFEQLEGRG--------IWQRVVMNFQESQFNLEKAIDENKITEALRAIGQGVSIAPQNAYFEVVSGQIVTKPGLKGNKMEIDLLKKIIMENPLKNEYIIPIVVVEPVVSE-KEINLLKPDKLLAQYTTKFV-KNENRTENIRLACESMKKLLMPPGTIFSFNETVGPREQERGYLMAMIILGGEFSPGLGGGICQVSSTLYNSVLLAGLEVVERHPHSLKIDYVPLGKDATVTYGLKDFRFKNNTPGYLLLDYNISGQNLTMFIYGSHP.............................................. 342
31 0.000e+00UniRef50_A0A1I7GV86 VanW like protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1I7GV86_9FIRM  ali  25  2..................KRFFCGLALSVLTLAAVPVAQVSAASNTIAKGVMIGDIDASGMTIEEAKEAVANKVKDGELILTGGGKKIPVKGSDLGISWGNPDVVKDAYAVGHEGNVVERYKEGKDVEENAVKFDIDYGIDDEALTTIIRKXXXXXXXXXXXARKEGEGDKQ--TSGMTAYIVNSDESKAIIKDFIANSWNNEVELAVKTVDAFKNLDELQKMSDVLGTYTTGYRDSGAARSANIENACALLDGIRLEPGQELSILDTITPFSEENGYYPAGSYLNGLVVESIGGGICQVSSTLYNAVLLAELDVTERHNHSMIVSYVEPSADAAIASGGKDFKFRNNTDSPIYIEAICTPDKVTFTIYGHDNRPAGRKVTYKQSAHLGYKSQLKVVEEDGVESATKIINTSTYNMVPR 460
32 0.000e+00UniRef50_UPI0009FB527B hypothetical protein n=1 Tax=Cellulosilyticum ruminicola TaxID=425254 RepID=UPI0009FB527B  ali  24  5............KDNYRVLIFQLGCAIMSLGLGITIGTSFAKYTGKVFKNISVGDIAIGNKSLTSATDRVKAHYQKIKLVLQLGETTLAAPLSDFILDTNIDEIMDYVAAYNKELSFIERYNLL--TNKTSKTFDISYTYDSSKVAEFVSKFMRKASHPSQNAAIQISAGEIVRKSDITGLKLDSNALINAVYEQLSTKDTVGTELVIDTIPASITSDNLSHLDTLVASYSTSFTPGTGS-DVNIAIAAKSINGTLIMPGKTFSYNDIIGNTTLDKGYTYATVIVNSMPTKGVGGGVCQVSSTLYNAILRIGLLPTERRPHSRPSSYVPLGLDATIDWGNIDFKFENTNNYPLYIVSYVKNNKVYVDLYSDKSNLPKGTKELISKGSTGYQVRISRTYENGVLSDTTVLYQDTYAPVP. 458
33 0.000e+00UniRef50_A0A1V5YBQ3 Vancomycin B-type resistance protein VanW n=1 Tax=Firmicutes bacterium ADurb.Bin182 TaxID=1852884 RepID=A0A1V5YBQ3_9FIRM  ali  23  52......................................QSIINTGTFHNGIIINGVSVGSMTIDEAKLALEETKNEIAITLKYDDYVQILTADDLGIAFNTDEVLNKAIXXXXXXXXXXXXXXXXXXXXXGREFTVDYLPDKTALRKIIQSIAQELYSPPVDASFEINPDRFVFHEAEEGISVDEEKLLNEIESHISARDFNEISIPVINAPAAVTADSLKKSIVLRDSFHTSFGSGSYDRVFNITKAAGIINGTVVAPGEIFSMNEVLGDRTYSSGWQPAPAVVEGKTEDQPGGGVCQVSTTLYNAVVSSDLEVVYRQAHSMKLGYVDGGLDATIDSGHIDFKWRNNTKSDIYVFAWVDKKEVHCEIYGPPTSKRVSTIEPSNEARNG-SVWKSYYYKGDTEIKTVEIAKTTYRAHP. 488
34 0.000e+00UniRef50_A0A1G8GLP8 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=12 Tax=Pseudobutyrivibrio TaxID=46205 RepID  ali  24  47...........................................DNRIIPGISIGGTDVSGKTVTEAEDVVNNYYDSAVFTLSANGQTFTATGKDLCIGAKNPEVLEKAATYGSTGNFAERFKASKDLEEGGKDFPLSLGADKTGIEFYLNGASSQVNDEASDDYLTRENGQFVFHEGKAGVVVQIPESASVLQNYIENEWDGTVELVTEVKEPRGSKEELAEIKDLLGSFSTDYSSSSKARKNNVANGVGFINGTILYPGDEFSVLNCITPFSAENGYMLAGSYENGTTVETYGGGICQVSTTLYGAVREAELGVVTRSSHSMIVTYVKPSQDAAISEGGKDFQIRNNKNYPIYIEGYCDGNNAYFNIYGKEEDDPSVEFETEITGVNVQNTTWVVVYENGVEVSRDVYNNSKYNPSNR 459
35 0.000e+00UniRef50_UPI00037E651A hypothetical protein n=3 Tax=Paenibacillus TaxID=44249 RepID=UPI00037E651A  ali  26  34.............................................TLPAGITVGDWAVGGLPIDEFERQLAAKLMAERVRLSAQTLTAERTLEQLGLELASQELLSKLAPL-REGSPLRRAIYRWG--QRGADWTPPARFAEAKLAAALEAFAPLYAREPVDARRVVENDTIRYIPEVPAVRIDEAAAGEAVQAASSDGGVIAVAVPLRLVQPPVTVETLKGIERKLAEYTTRYPPSSAGRLHNVKSTAASIQDVVLKPGELFDYATFIEQTEKRFGFREAPVILNGKLVPGIGGGICQVSSTLYNAVLRAGLAVVERRNHSLPVSYVPLGLDATFASGHINFKFRNSTEHHLLIRTYADDTKLTVKLFGQAPQDVAYEIESKTRGKPGYVVYRH-KKQNGVRVATELISRDTYAAQP. 499
36 0.000e+00UniRef50_A0A089LY51 Uncharacterized protein n=12 Tax=Bacillales TaxID=1385 RepID=A0A089LY51_9BACL  ali  26  33.............................................TVPKGTLLAGWDIGRMNIAAVRSELDRKLSEVPLTLRIGETELTLTLKEAGVSYQAKSFLNGLDRLS-EGGVCERAKARYSFE---KNWALTAGWTDTALRSRLNAWESSTFGDPVDATRRITDDRIVYTPGRTSLRIDWTHAGLTLSGVIPKDFSRAADLPLRTAQPDVTLQSLQGVTRKIMQFSTSLGSSGPGRSYNVESAAKAVNDTLLPPGAVFDYDRAIEKAENEYGFREAPVIVNGTLQPGVGGGICQVSSTLYNTVLRTGLEIVERRNHSLPVNYLPKGQDATFSRGSINFRFRNTTGHYLLIRAAVSGRSLTVKLFGTFPSNVSYSVESRTKGRTGYETYRT-KFVGGEAVERVRVSRDTYRPQQ. 446
37 0.000e+00UniRef50_A0A1H5UM49 Putative peptidoglycan binding domain-containing protein n=1 Tax=Eubacterium ruminantium TaxID=42322 RepID=A0A1H5UM49_9FIRM  ali  24  1.......MDRMKNKKRILNIFIAFSFVIFSFLFAGNLNGKKVEETVIRQGVTIDGKDVSGLTKKEAMELMKKDADSSDVAVTIKDDTYSTTLGSLGLTADYEKAVENAVNVGNSGDILKRYRENKNIESKGVAYKSSKKINKDILASVINNLGSRINEGIETTLIKKDDGTVSVVASGSQMKVDYTTITKAINKLISKGNSESTDLVLLEND-NGKTESLNDITTLLGSYTTDYS-SGENRMMNVERAAELIDGTIMYPGDQFSVYYTISPMNAENGYYKATVFIGDGTGEDYGGGVCQVATTLYNAVLRAELQIDQRDCHGQPVHYVDLSYDAAIAGGYLDMVFTNSSEYPIYIESICSGGDITFNIYGKETRPANRSIEVTIEASRGYRAWKNIY-IDGELSETVLVNTSVYPA... 447
38 0.000e+00UniRef50_R7M8H4 VanW family protein n=5 Tax=environmental samples TaxID=2231195 RepID=R7M8H4_9CLOT  ali  29  93............................................DKILKGITILGIDVSNLTIEEATTKVNNAIENSSLILKREDNETNVTANTFNAKFDTDSAINEAYNIGRKGNIISNNYEILITELLKKEIKPTLYLDEDLLSNTIKDINSKLKDAVVENSYYIEKQKLILVKGKAGYTIKTEELKQKIRDQLSNTNYQEIEIPVEELNPTVVHAEVDGVDDLISTFSTRFDASNYNRNVNIKLAAQKVNGTVIMPGENFSFNTVVGSRTIEAGFKEGTAYIGGKVVPDVGGGVCQVSSTIYNTALLANLKIVERSNHMFTTGYVAPSRDATVYYGSLDFIFKNTRKYPIKLVASASGGVCKVSVYGIKEENEYEVIVVEQTAITGCRSYKIVK-QNGKVISRTLLSKDTYNSRNK 568
39 0.000e+00UniRef50_A0A267MB47 Uncharacterized protein n=1 Tax=Anaeromicrobium sediminis TaxID=1478221 RepID=A0A267MB47_9CLOT  ali  26  8...............KKTKLLSCIIMVFILSFTLSYGES---------PNIYVEDIKVENIDKNESLISIENSILNNEIIITYEDENMTLNYKDLGFKLDKVSVANDIYN--------SIYFNDQIGPNKDVHLKAHYIVDEKNFLAALAPL-DEIPIPMENAKLHISGDNITVIPEVNSFEFDKAKLMENIKATPLIGKNI-FTVPTKLATASVTTKTFQNMEELLSEFTTKYSASNKPRSTNIAVATSYINGTLLKPGEVFSYNETVGRRTSERGFKVAGVYANGRVSKGLGGGICQTSTTLYNATLLGDLEIVDRSNHSLTVPYVPLSRDATVSWGVQDFKFKNNTDKDLYIYGSTTKNTVTFKIYGKKLDKEIGEEKVTDKGHTGYKLIKEVY-KNGELLDSYVVSKDYYRTTPK 424
40 0.000e+00UniRef50_A0A1V4IVX4 Vancomycin B-type resistance protein VanW n=1 Tax=Clostridium oryzae TaxID=1450648 RepID=A0A1V4IVX4_9CLOT  ali  26  3.....RGSYRITISAKIIILQILLFSLGAMCGLTWICRYNKKWDSLLYRRLEVNDLHLRGRSVKEDKALIKDPLMKRDIKIITDDKSYKLHISKIVRKYSIESKIDKLEQLNGQPTIYEKIKLIK--KGINQIYSVNFIYNEDYIDSFVNRIEKDINAEPVNANIVEKGGSIEINPDINGRKLDKEKLEKELKEEVRSKNTKNMIIRAHTIEAPITVNKLSVINTRIASFTTDFSSSPDGRCRNIELSSKSINGRLIMPGQNFSFNAAVGKRTTERGYRTAPVLADGRVDSGIGGGICQVSSTLYNAILRSGIKPFEREHHTIPSSYVKLGLDATVSWNDIDFKFKNTLRYPIYVEAHTENKKLQINIYSNSPRLPKGKIVFVQAGHDGYKVKRDVYENN-KLVKCETISNDMYTEIPR 449
41 0.000e+00UniRef50_R5YRA1 G5 domain protein n=5 Tax=Eubacterium TaxID=1730 RepID=R5YRA1_9FIRM  ali  27  32.......................................NSKDKDVIKSGVRIESIDVSDLTEEEANTKVKAYVKEKPVKIDVNGTEVKTNLSDLGYKWTNKSVIEEAVGVGKSGNVIKRYKDGLDLKNKGIELKLEFGIEEKNMKDNLKKICDSYNVEAKNASLKLTSSGFEVIPEQDGVVIDYDXXXXXXXXXXXNKSDILYTAETKVSKPKYTSEDLKKVSTPMGSYYTSFSTSYDNRNNNIKHGAEVLDGILLYPGEQYSLNEHLAPWTAENGWYPAGTYVDGGVADSYGGGICQVSSTLYNALLEAEIKVVERYSHSMSVAYVPLAADAALAGDYKDLVFENNTDAPIYIQSVYNGGTLTFKVYGHDTRDSSRSVKVTENGHVGYVAKLKVTYENGEEVDKELLHTSTYAMTPK 450
42 0.000e+00UniRef50_A3DI09 VanW family protein n=5 Tax=Clostridiales TaxID=186802 RepID=A3DI09_CLOTH  ali  31  44............................................DRVYKGVFINDTDVSRMTFDDVCNLLKSKYSEKKVVLNHEGMAAEVDLSEIDLEYKIEEAAQKAYNLGKVNEIIDDFYSKTLISVKEANLSIQKSIDKEKALEIIDNIYNQIVVQPVDAKAVVENNKVRVVPHELGREISKSELADIIKEN-ENTTDKEILLPVKFIQPKVTTDEVNAFRDVLASSSTSFSTNNYNRGINIGVAASKINGKILAPGEVFSFNDVVGPRTVANGFKIAKEYVNGKIVDGVGGGVCQVSSTLYSAVLFADLETVERQNHMFTVSYIPLGRDAAVAYNELDFKFKNNTNWPIKIVSSVKNNTVSFTIYGTKEEPEEGKTVVVQSGYTGYTTYKIVK-INGNVVSNNKIHRSIYRP... 519
43 0.000e+00UniRef50_A0A1H3ECI8 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=4 Tax=Clostridiales TaxID=186802 RepID=A0A1  ali  25  156.....................................AYAELMTDKFYQGIVIDGIDVGGMTKAEALAAVSATLPEKPIRLDLTTVVIPVDFSDAGFAYNTEEIVDKAFDLYRPTDITECYNGVQQLKNAPATYETAYTVKIEGVSQKIHSVLDPLYEEVENAQFDVDTCEFTVSPEKVGYEMDIEKTITDVKNLLDSKVSGLVKVPMTVKEPELTEQMIRDEFGCISVYTVAYNNSNRNNNI--NQACVNINGTILQPGEVFSFNGVVGQRTVANGFKEAGVILNGQVDQGLGGGICQVSSTLYNAVLMANLTVVERSAHAWPSDYLPAGLDATVDWPALDFKFENSSDFQIVIVTYWSDNTIVAEIYGKKLPDPTGQSKTVRTAHNGAKAYKVWYDKDGNVINREEYNSTYYSPFP. 583
44 0.000e+00UniRef50_A0A1R1BTQ4 Uncharacterized protein n=1 Tax=Paenibacillus sp. FSL H7-0331 TaxID=1920421 RepID=A0A1R1BTQ4_9BACL  ali  24  1..................MITAIACLGIALYGL----------QNRMPAGYTIDEWHVGGITYMEFEQQLTEHVRQQPIRLTLPDLKFTATMEQLGLRVSVEDALVPLAQL-RTGSPWTRAVSRWQLR--ERHQALRYEFDPAVLHALLLQLSTLYGQQPSPARVVGPTDEISYIPDRPVNRVDETALLQQLQKEIRPLGTRDIPLSFVTQKPDLTLSQAQGVDRKISEFSTPLMQTSEGRLHNVRSTASTIHDLLMKPGDTFDYATYIAQTEARFGFQEAPVIVNGKLVPGIGGGICQVSSTLYNAVLRAGLTIVERRHHSLPVSYVPLGQDATFAAGHINFQFRNSTDKYLLIRTSVDDRQMTVKLFGQIPIDTTYTIESISEGKPGYVVTIRYKKQADRIISQERISLDTYAAQP. 439
45 0.000e+00UniRef50_UPI0008C3050B hypothetical protein n=1 Tax=Anaerobranca gottschalkii TaxID=108328 RepID=UPI0008C3050B  ali  26  27......................................DNQRFNNTFYPETYVNELPIGNLSLEEAAIILNIGLNTKSFILKNNDKEWELPMEEI-VYFKIEETLTTILNEQKKNNFIKGFFMRNSPRYYNVEFTLS-----KNLLNFIDKIQGEVEIFPKNAEFFISDKKVNIIPHQEGKSINIEETIEEIYQNISEGKYKG-KIIYKPLKPQVTTSQLEKVKDHLFSIETYYGDSSENRLHNIKLAAEKIQNILLFPGEEFSFNKLVGPADEAGGYKEATIIVDGQFVPGIGGGICQVSSTIYVGALKANLEILQRRNHGRPVSYLPKGLDATISYPYLDLRFRNNTDYGIIINTITTSTHLIVDFYSYKPNMKSGEKKVIQKGQVGYKVYKLITDHNG-ITRKELLSTDTYRPVKE 429
46 0.000e+00UniRef50_W1ULQ9 Uncharacterized protein (Fragment) n=1 Tax=Intestinibacter bartlettii DORA_8_9 TaxID=1403940 RepID=W1ULQ9_9FIRM  ali  46  1................................................................................................................................FKGHDFSIKVSYDEDKLDKKISSISKQINKPSVDASISVTSG-IYVKESQTGLKCDDKENKKLIEKAYKDKNYETIALKVDVTQPKIKTEDLKSIDSVLAGYSTTFNSSIYGRSYNIALALKRCS-TVVMPGETFSYNKATGPRTISNGFQNASVIVSGTYQDAPGGGVCQGSTTLFNAALLSGLDITQVRNHSKTSSYVPRGRDAMVNDSDSDFKFTNNFNHPVYISAYAGGGQASVKIYGSSQDKVSVSIKTDNNGLPGAKTYRTIT-KNGKS-ETKHIYTAVYQ.... 286
47 0.000e+00UniRef50_A0A1V5U1L4 Vancomycin B-type resistance protein VanW n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1V5U1L4_9FIRM  ali  27  42..................................................VSIDGIDVSGMAVLEARRVVTERVEALSYIVRAGGESVTIPGGKLGIAFDTDAVLARAASLPRKISPWDD---------QAREFKTTVSVSAASVAKQAQEAALMLKRAPTNAYFDREAETFVYMSETTGLEVDAKDLALWLTDKALALESGAVEARSVDVPADYTIKDAENDTQLICEFSTSFKGSTYNRVHNIVKAASMLDGISVEPGAEFSINEVLGPRTGETGWKPATGIKYGVYVQEYGGGVCQVSSTLYNAALMADLEITERTHHSWPLGYIPVGRDATISTGGPDLRFLNNSGARIYIRAFTDEKTVTVRIYGRPLADGVGETEIDRESHIGVTTYKEYYAADGTLVKRELASRDKYRS... 439
48 0.000e+00UniRef50_A0A0G0BA38 VanW family protein n=6 Tax=Candidatus Roizmanbacteria TaxID=1752723 RepID=A0A0G0BA38_9BACT  ali  23  42.............................................KIYPNVYLDKQNFGLKSREEIVNYYNSKLSKTSVTVFFANEPVTFSAQILGLKYDGKTIAERAYLVGRSTNLPSKYLQKVLTIFKKFYFESQIEYDNSELKDFLSTSEDKYNLPAKNALFKFEKGKVVFRKESNGLKILTEKFLPDFDKIITDAANKKVILNSEVIKPEIKLSDINGIEEFIAEGKSDYTHSIPQRVHNLTLAASKFNGVLIPKGKEFSFNEIVGDISSLTGYQPAYIIKDGKTILGDGGGVCQVSTTLFRAALNAGLPIIERTAHAYRVGYYEPGFDATVYSPTVDLKIKNDTPGYILIETEIDNNLLYFKFYGKKDSRKKGVTKQVDFPAWGSKVFFTYKVFQGDKLAIDNKFFSNFRPW.. 458
49 0.000e+00UniRef50_A0A239QKT5 Putative peptidoglycan binding domain-containing protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A239QKT5_9FIRM  ali  22  214..........................................YRDRFCPGVYVNGIDLGGMTYEEAKSAVESGIADWKVTLTYGSNHADITASDLNFTVDVTGVLNEAMQQGHNGSDEQRYNDMLQLEQTPYRTSTPSAGNTQRIDDLLAIIKSSIDRPAQDAYVTPDNAPFQFYDEVNGLTLNTAPIREWIFEKLSTMENGTYEIQPDQVQPSVRKADLMQKYSLRASATTKIHTSSEDRNNNIRHACDFVNGYKLAPGETFSFNTVVGYRTAERGFYPAQEIAYGNYVEGYGGGVCQASTTLYQAALCAGLQIVERKAHSEKVRYTELGLDATVYMENKDFRFKNNTDGDIYIFATVEKDRTRVDIYGPYMGDVHYELQSTSEGREGYKV--NVYRTNTVNQQSEWLYTDTYEA... 640
50 0.000e+00UniRef50_A0A1W1V0C7 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Peptoniphilus asaccharolyticus DSM 20  ali  27  8.............KLKDKKILSAVCVGVLFLISLIYYNYEIKNID-IHSGVGIAGINISNXXXXXXXXXXXXXXXXXKMSFLLEDKTIEIPYEKLGYHVDIERAVDKAYSVGRTGNILVDYFNIVTPFFRK-NIELNEKFDVSSLDRSVAYLVDKVFKEPVNAVVTTEDKAFKVVASETGRFLDAQVTRDSILSNISKNE--IVQLKVNTSYPKITEEKFEGIDAILSEFTTDYSSSAQGRKENVAIGSGFFNGLVIDPGQNISFNGTVGEISVKNGFQKAGVLVNGELEQGVGGGICQVSTTLYNALLLSNIQIDERHNHTRPIAYVDIGTDAAVVEGYKDLKFTNNLAHKIYLKAEADGKKLTFQVFGNKADKYDVEIEVESSGAKGYSYATYKKLKKGEEEKTEKISNSYYLPKDK 440
51 0.000e+00UniRef50_A0A1Y0HA24 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium Uphvl-Ar2 TaxID=2004468 RepID=A0A1Y0HA24_9BACT  ali  23  37...................................VAAYEFVGPPTIARGVSVFGTDLSGLTPSEAEKRLEAEWAKQEIKVELKEFEITLTPAEAGVKFDATAMI-KALPVER---PVTASVAQMQGPAVPKAVTPVFVYDGNLLKKWVEEA-----RPAQPARAQWAGGRVKLTQEIPTWELDQTRLSTAWADALANNTALVVPLKAEDL--KIKPEQLESIRTIVSEFNTKFSSGQVARSKNIKRAAELIDGTILMPGEVFDFNGVVGQRTSARGFHVAGVYVSGRHDFDFGGGICQVSTTLYNAVLLGELKVNARSPHSLPVPYVPLGRDAAVSWPNLDFKFTNDTKSPLAVAAEYRPGQLTFRILGTKDNGVKYETRVVDRGGAGVRTYRIIKNGD-QVVRRDDLGESIYRGGPR 445
52 0.000e+00UniRef50_UPI00047BDDED hypothetical protein n=1 Tax=Clostridiisalibacter paucivorans TaxID=408753 RepID=UPI00047BDDED  ali  32  33............................................DDMINGVNVSGISIEGMNKEEAKKHLRDKLKDRYIKLKYKEDEYVHDYEKLGINYDYDKTIEKIYQDIDTKTNINKIKTFLTGLINERDYDMEYTYDISKLEEFVKSMEKDINSEAQNASVKIDNDRIDIVPEIIGKKVDSDSLKEILINSI--GKDSIIDIPVMEKSPTIVEKDIETINSVLGSFVTRYNTSKKNRVNNIVQATNTINNKILMPNEKFSFNKATGVRNSDNGYKKAPVIINGELVPEVGGGVCQVSSTLYNAVLLSGLDILERHNHSLPLSYIGKGRDATVVYD................................................................................ 329
53 0.000e+00UniRef50_A0A0D3VFB3 Uncharacterized protein n=62 Tax=Bacillales TaxID=1385 RepID=A0A0D3VFB3_9BACL  ali  28  28........................................YVNQGTIPKDVQLSGWQVGGMKSEDLLKKLNNRLEQLPLSLQMEHQNITLTLSEAGVRYEADS-FREAIAQLQKGSMLARLSYRWNFQS---NWSITTYVDPELLKSKLSPAWEKKNFGVVNASRRIAEDQVVYTPEKSAARLDWKTLLSKLTDTATTESPLTIELPITIKHPNITVNSLKGIERKITEFSTTLFSSSSGRIFNVNSAAQAVNGMIIKPGEDFDYSKVIEQAESKYGFQEAPVIINGKLAPGIGGGICQVSSTVYNAAVRTGMEIVERRNHSIPVSYLPLGQDATFASGSINFRFKNNTGKYLLIHAAVEDRTLTVKFYGTFRKDTQYTMESVQDGKIGYIVTFQVKKVDGAVVDKTRISRDTYRPQNR 449
54 0.000e+00UniRef50_A0A1Y4NWR7 Uncharacterized protein n=1 Tax=Lachnoclostridium sp. An169 TaxID=1965569 RepID=A0A1Y4NWR7_9FIRM  ali  27  53..............................................IIGGVSVGETDVSGMTAAEAEAAVEQQYGAETVTLTLEGGQAQATLTELGLKANLERIIRDAVDYGKTGDPVDCYKILKKSEKNEKTFPVEYEVTAEQVKTVAQERLAGQLKSPVNARLTQENGATVVVEDELGEAVDVEGTVANLNSLVGGEWDKEVSVKLTDLTADITAETLSGITDVLGTYSTYYGDSSEGRTKNVESGANHIGGTLVEPGQEVSANDLMAPYTEENGYAMAPSYENGEVVDSMGGGICQVSTTLYNALIRAEVEIVERYAHSMLVSYVEPSMDAAIATDLKDLKFRNNKEEPVYIEAVLSDGNITFNIYGKETRPEGRTIETSSSGRSGAQLWKIVYE-NGEEVSRDTINYSQYRA... 460
55 0.000e+00UniRef50_A0A1G4PXC6 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Ruminococcaceae bacterium YRB3002 Tax  ali  23  176....................................AFAELTEGEKFYDGTLVNDINVGGMTKTEAYNAVTAGLEAAPIDLKVSEEVHDLDLSSLTLTVNTNEVLDEAFAFNRPTDPFEKLKECYDAYQRQKNVPVKYTCATEGLTDLVHSVLDPMEVQEADAVFDKTTNTFVIQPEVNGFKIDSEKAVNDVKGLLEDRIYQIVEVDSEVVVPEVTQAFINENFGRRSSCSST-ASNNKNRNTNLDQACKNIDGTILNPGDEFSFNGVVGQRTSANGFVEATVITGGQYEQGMGGGICQVSTMVYGAAVKADLEIVNRKYHAWPSSYVDPGLDATVDWGSIDFVFKNNTDYQIVMRAEWNDRSCTVSIYGMKPNLAVGERNTLRNAHDGVKSYKVWYTADGNEIKREDVATSNYRMW.. 600
56 0.000e+00UniRef50_A0A2J0MPF5 Uncharacterized protein n=2 Tax=Candidatus Moranbacteria TaxID=1752737 RepID=A0A2J0MPF5_9BACT  ali  24  72.....................................................................................EKWTREKSELFYRPKYHSEIENPNFCQYKKSIICSLFFDARKENHIQKIS-TLELDEKLMRSFLDDLARQTDKDPENAKFGMENGKVVFSLGAKGTKLNKEQGLQALLAYFNSNWGTSINLPYDESEPEISTGSILGINSLIGEGRSNFRGSPKNRIFNINVATKRFDGILIKPGEEFSFVKILGEVDKEHGYLPELVIKKDKTEPEFGGGICQVSTTAFRAAIYSGLEITARRNHAYPVQYYPQGMDATVYVPRPDLRFLNNTPGHILIQTKTEGTELVFQFYGTDDGRKTKVIGPTITGSLKATFTQEVRDKDGHSII-EDVFNSAYDSPSK 413
57 0.000e+00UniRef50_A0A1M6IBM9 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Clostridium cavendishii DSM 21758 Tax  ali  27  1..........MKNKFPKMFIPLSIVCFIAIITTMVCAISYNLHKDKVYSNVYLDDIDLSGLKETEVKDIVKDKISNNKFIFTHKNIKETKSLKDLSITFDTDTMIKDALSKNKRNNFFIDSFNYLSSNKTRIDLQIKFNINKDLLTEFCSKIDQELNKNKKLSKIEFLNNKLEYKIGDPDLSVDFDELSNSISTKLNDNNNNTINLKINEAKSPLSTDTFSKMT-IIGSYKTKLPNANVDRTNNIRLFMNKLSGTIIMPDNVFSCDKTAGRREMQDGYKPAPAFASNKVVDSVAGGICQGVSTIYNAVLYADLQIVERAPHAMLVTYVEAGRDATIASGQIDFKFKNNKKNPIVLQSYVSNGYVVANIWGNENPNREIKIVVNHPSTLTSSTYKQTYE-NGKLIKSDHLSSDKYNA... 412
58 0.000e+00UniRef50_A0A081P3M9 von Willebrand factor A n=13 Tax=Paenibacillus TaxID=44249 RepID=A0A081P3M9_9BACL  ali  25  34.............................................RVPAGARVAGWPIGGLSWPELERQLASKLLEQKVRLTVGGGSAERTLRQLGLEIDGQELLAQLRPV-REGPPYR--RAAARWRLRGASLALTPVLSADKLQAALSEAFPQVYRKPTDAKRLIDNDAISYVPEARVERVDEGQLLSRLQAALPDPAAILLDVPMRTQEPAITEQALQGIIHKVGEFTTVSPPSIEGRVHNVRSTAASLQDVLLKPSEVFDYAPFI-ERTEKRGFKEAPVIVNGKLVPGIGGGICQVSSTLYNAVLRAGLAVVERRNHSLPVSYVALGQDATFATGHINFKFRNSTDHYLLIRTSSDERSVTVKLFGQTPPDITYEIESKTQGKPGYVVTFRNKKQNGVVISQEKVSRDTYHAQP. 456
59 0.000e+00UniRef50_R6GJW7 VanW family protein n=2 Tax=environmental samples TaxID=2231195 RepID=R6GJW7_9CLOT  ali  26  86..........................................YEYKVYPEVYIYSEPVGELNEVDLSKVLAEKIASKTVKVTVNDKEYSSSYAGLDVTTNKDELEDKIMSYGKNKSFKGKLNLIN--EPKKKTYNMTTTVNEEKIKEFVAQISEDVKVDPVNASASISGGVVNIVEGQNGYVLDEKALVDSITSQINGGADVVANGALVESEADITANELRTIDTRISSFTTYFSPGNSG--HNIQTGASYFNNTLLMPGEEFSCTDGIGPTTAERGFVSSNTYVGGKVVPGMGGGVCQIATTLYNAELRAGILPTERQNHMMTVGYVGIGLDATLADDLIDLRFVNTYDYPLIITTSSTSGSLTVEIWSNSTNGYTYEPRVEAISSLDCYTYLDKYDSSGNLVDSIYLNESVYQP... 463
60 0.000e+00UniRef50_A9FSS8 Vancomycin resistance protein n=7 Tax=Sorangiineae TaxID=80812 RepID=A9FSS8_SORC5  ali  22  32......................................................................RDALRERVVRLRHDDVELTATLGEAGVEVDVDETLAAARRVGHEGPWARRLREARGARRGEIDVPLTWAVDEPRARAFLERLAPQIYRAPVDARLDLANRRK--IPEQAGRALDVEASLAALR-AGEHGDEELIELAVRQILPQVVVADLVDVTRVVAAYETKFKGKEAGRARNIRNAASKIDGTILAPGDTFSFNAHVGPRTAKNGFTIAPEILGDETVPGYGGGTCQVSSTLYAASLFGALDTPDRQSHSRPSAYIPMGLDAMVTYPESDLKIKNTLPFPIMIHAYLEPTVLRVEILGVKSELAEGKVKRHQKGSCGYDVFVTVRYKDGR--ASERSYSSEYRPAPE 406
61 0.000e+00UniRef50_A8SMW6 G5 domain protein n=5 Tax=Bacteria TaxID=2 RepID=A8SMW6_9FIRM  ali  26  53............................................DKFYEGIFINDIDLKGLTKEEAISKIKQSLEKNEFTLTRDNYTKKFLPKDIDFSYNFENLVYQAFNIGRFGTEDERIEILKNLLKNPKKFEIKATCDLSKLNEIVSEVSEKLNSDPIDEKFSFSNDKISVTEGKVGVKVENEKIVDNFKTVPVKFDFQ-IPATITEYK-KIDKTLLSSIKGVIGEATTKFD-NQPNRNNNIKVAAGKVNEFVVNPGETFSFSKELGEVSKNTGYKPAGTFLNNKVVDSIGGGICQVSSTLYQALVKSDLEIVERNQHSMRVPYCTIGLDAMYYDGQSDLKFRNKFDFPVVITSYVSKGELTFKILGDTDKKPEGKRVVVEKGFPGWRGSSYKQKENEKPV---LLNSDYYKPKKQ 448
62 0.000e+00UniRef50_A0A1F6S488 Uncharacterized protein n=6 Tax=root TaxID=1 RepID=A0A1F6S488_9BACT  ali  24  19..................................................VRAQETNLGDFSVDKIQDVI-----GSPIYLHFSGQKFAVDKESLLKWLKIRPSLKEAENINFSPTSEPGLAIYFRFLTQSRDISTRLSIDEENLQKYLENAQNETRVAPENAKLAFSEGKVSFAVSKNGSEINPEKSVEKIRAELEKNPYKDIEIETNVLKPEVSSSDVAGIKELIATGVSNFRGSPKNRIHNIGVGARRFNGVLIKPGDEFSFIKTLGPVDKSTGYLPELVIKVDKTIPEYGGGMCQVSTTCFRAALNAGLKITARTNHAYPVQYYPQGTDATVYIPNPDLRFVNDTPGYILIQTHIEGTQLTFDFYGTNDGRETKLVGPTEGGAMKTVLYQEVYGADGNLVRKSEFKSSY...... 398
63 0.000e+00UniRef50_UPI00082A7AE4 hypothetical protein n=1 Tax=Christensenella timonensis TaxID=1816678 RepID=UPI00082A7AE4  ali  27  44.......................................QVTDNKVFAQGTVVNGFELAGKTYEQAKEEVLKQLKQIRVKVTYNGNIREFTAADLGVSGNAEEILKQAYEYSRSGNVFSDYDHTYA----GEQLESSILIDNEILEKNVKSFLDKYDTEPVEATAKFDTHKFTYTESSVGSMADADAVCAQIEANLKSGKAEDINVTGQRLNPDMTEEELKQNTVLIGRCET-IATENPNRDVNIQLMCKALNGLVLQPGETLSVNGLVGERTAEKGFKAAPAIMDGKLTDELGGGICQVAGTLYNAALLADMEIVERVHHSWPSAYLPVGLDATLNWDDKDLKLKNTSEYPMYLGADFYKHSVVIEIYGQPDEIPAGERKTTITGRKGYDVYRN-YLKDGEIVKSEKISHDY...... 445
64 0.000e+00UniRef50_A0A0Q9KSQ3 Uncharacterized protein n=10 Tax=Paenibacillus TaxID=44249 RepID=A0A0Q9KSQ3_9BACL  ali  24  39...........................................QKTVPSKVDAGGISIGGMPVDDALELLENSLLQRTITIHSDSKQWTV--AVLGYKAEFKGA-REALLRLSTGDIWERAVYRYQFQKK---YELTQVWNHDAFDAALRKQWSWIEKETKNARIITADDEVIYEPHVDAYRLDTGKLLDEVDDWVVLEKEQDAKLPVTAIHPEVTLEKLKGIERKIISFSTEFRTSAEGRAHNITVTAEALNDWELAQDEVFDYSKLIARAEELYDYREAPVILNGKLVPGIGGGICQVSSTLYNAVLRSGLEIVERRNHSLPVAYLPIGQDATYAGGAINFRFKNTTGKHLLIRTVVADRKLTIKLFGTMNTNERYEIESVETGKQGYVVYRTLF-RDGNEVSRERVSRDTYKAQP. 454
65 0.000e+00UniRef50_G7VUN3 Vancomycin resistance protein n=56 Tax=Paenibacillaceae TaxID=186822 RepID=G7VUN3_PAETH  ali  26  31...........................................RQTLPKGVTVGGINVGNMDKTAALQLLDTKLKQRPLILTDSDQDIKLTLGEAGIHYEA-KAFRDAVNALVSEHLWTRAQTRFSF---GKEWTITPSRQEGALQRFGASWEEQRYGKPVNAVRQIDDDQIRYIPGRSARRLDWPKLGVALDKALASGEPVRVELPFRQLEPDITVDGLEGIERKIVQFSTSLSSSSEGRVYNVNSAASTVDGLILKPGEIFDYGQIIAKAERTYGFREAPVIVNGQLEPGIGGGICQVSSTVYNAALRVGLDIVERRNHSLPVSYLPKGQDATFATGSINFRFKNNTGKYLLLRAAVQNRTLTVKFFGTFPSNVSYELESRTQGKAGYVVTYRMKLVDGKTVERTRISRDTYRAQQR 443
66 0.000e+00UniRef50_A0A1V5Y6B4 Vancomycin B-type resistance protein VanW n=1 Tax=Firmicutes bacterium ADurb.Bin182 TaxID=1852884 RepID=A0A1V5Y6B4_9FIRM  ali  27  67......................................SAVIDSGTFFEGISVNGVDISGMTFDQAYEALNDEIASVNLSIVYGSTRWTLTSADLDMSSTLNEVLNEALMLGRSGTLIENSNVKAQLKEQGKSFETKLVPDDAKIQGLLAGISSSVNQEPIEPYAVPDTSAFRFIEGTDGHILDIEVVKTQIIQSLEIKEYDTIQPELKLVAPTRTMDEVKNNTKLIAEFVTSYEGGDSKRVRNIEKASDILNGLKLEPGEQVSFNEYVGPRTEKGGWALAPGIVNGNTEMQAGGGICQVSTTLYNALLRCGIEIVDRKKHSWPSSYVPEGLDATVSTGGPDLVFKNNTQAPIFIFTYAADYKMTVYVYGAPPEGVTYVARSEIKERTGYTAYRD-KLVNGEVVETVELYTDTYRA... 488
67 0.000e+00UniRef50_A0A1W1UJF8 Putative peptidoglycan binding domain-containing protein n=1 Tax=Desulfonispora thiosulfatigenes DSM 11270 TaxID=656914 RepID=A0A  ali  21  32...............................................PPNMQVNNIKLGMVKKSELDSVLEKTLSNNKVHITYKDQSKTYTLSDLGISVDRLKTKQEILAASKP-----NIINFFTTLKDGKEFKPSCVTNTEKFYDSLEIFEDNTAKKPINAYYKYQHGKVVIVNEVPGYILAKDNLLQELLDD-PFKENLELSLSLEYVQPEITKEILNGVNEIVSSYRTSFNPSNKSRSTNLQLAVNAINGTVIAPNEIFSFNNVVGQRTAQRGYQNSIVFENGIMVSGLGGGICQVSTTLYNAVLLGDYKIIERSNHSITIPYADPSRDATVAWGYQDFKFQNQTDRHLFIHSEVQGNQVVFNIFSTKVPNKKVTLESVESNKCRSKLIKKVYYNN-NLSHTYTVSTDTYK.... 401
68 0.000e+00UniRef50_A0A1V5KE12 Vancomycin B-type resistance protein VanW n=1 Tax=Firmicutes bacterium ADurb.Bin467 TaxID=1852894 RepID=A0A1V5KE12_9FIRM  ali  26  51...........................................ESRFY-NVYVNGVPLKGYTKQQGYEKLEADWQSRSFELYHGNDAWSFSPAMVGAQLNEEEAIERAWNFGHVGNIFARKSQIRSLAGEPQYFTSAISYDEALMEDFLRSVQQKTDKPAVDAVVALGDDGPWVKDSSDGSKLDVDATLKILNNLMLTGAAGEMELPVEILKPAITTEDASESLNVIAEFTTGIVGSRESRKWNIKKALSSFNGVTVYPGMQMGFNEIVGERTQAHGFKKAPEFSEGTTTEDYGGGVCQASTTLYGALLQSGMTIVRRSPHSMTVGYVYPSLDAAVNTGSKDLVFRNDSDHPMYIYTNVTEASATVKIYGARPDNIPGTREVLRVDTTGYATYTSYDWETGEEVKREKLSTDYYEP... 461
69 0.000e+00UniRef50_A0A0G1PJ96 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Collierbacteria bacterium GW2011_GWC2_45_15 TaxID=1618394 RepID=A0A0G1PJ96_  ali  24  72.........................................................................................................KKLILKGRDSQVIIDNEEILNLFGLSGT-----TVNETGFEALIEKITPKIETQARDAVFVFKDDRVEFQPEIVGSKIDIPLFKQVLGETLYNPEKGELEVSLILTYPDITTGDINGIKELIGRGSSEFAHSIPGRVFNVNLASTRISGVLVPPGEEFSFNAVVGEISRETGYQSAYIISGGRTVLGDGGGVCQVSTTVFRAALNAGLPITERKAHAYRVGYYEPGIDATVYNPTADLKFKNDTEHHILVQTYVDTKKMRVDIFGTKDGRVKGTKKQIDWSAWGAKVSFDYTVEKGGQMVYEKTFYSNYQPWQ. 414
70 0.000e+00UniRef50_UPI00039CB3AB hypothetical protein n=1 Tax=Paenibacillus daejeonensis TaxID=135193 RepID=UPI00039CB3AB  ali  24  41.........................................ATQDTVPDGTVVDGVPIGGLQIDQSIEQLEEAWEATELTITANDKQQTWSLGELGFRVNREPIL-QAVQSLREGSLLKRARYRFTF---PREHRMKLAWNTKQFEARIRHQWGWLDQKTADATRRITEDKILYYNHREAYRIDMPVLSEHVRSWTAELWQQSLKLPIRIVQPELTLQKLKGVERKIAWHTTDYSASPVGRAFNVEATARTLQDWVLAPGEVFDYDKVIASAQAQYGFREAPVILNGELVPGIGGGICQVSSTLYQAALLAGLEIVERRNHSLPVSYMPLGQDATFSEGVINFRFRNTTGKHLVIRTETKNRKLTIKLFGTLPSNITYRISSNTEGKPGYETYRTMV-RDGKEVSRERISRDTYKATP. 465
71 0.000e+00UniRef50_A0A1V5RK25 Vancomycin B-type resistance protein VanW n=1 Tax=Chloroflexi bacterium ADurb.Bin325 TaxID=1852859 RepID=A0A1V5RK25_9CHLR  ali  22  36.......................................EWRYHDRVYEGVHTEGVPLGGLTVDEAAAAIRNALTPASVTLRYDAQTWELAPADLGLDVNAAATAAAAFAVGRRESVLTDLLDQWYAFNVGVGIEPILRVDDARLSERIRAIAADVDLAAQEGRIDIVGLKATGVSGRPGRQVNFNATRTALLELMAAGKGGSAPLVVRELRPTVSVDDAMGIVELVSEGVSSFRGSPPERVHNIVTAADKFQHVVVPPGGTFSFNQNVGNVSAAEGFMDALVIAGDRTAVGIGGGVCQVSTTVYRAAFFGGFPIVERHAHGYVVGWYEPGMDASIFTPSVDFRFRNDTEHYLLIKSFVDTGQLTFRIYGTKPGRTVGQIKQVDWAVKGMDVKRVIRFADGA-VKEENI-VSKYQPW.. 512
72 0.000e+00UniRef50_A0A1M5NRH8 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Asaccharospora irregularis DSM 2635 T  ali  28  46.........................................KYRGLVYPNISFYNQSVAKLNEKELYKFLESKIKDKKICVEAGGENYYITVGNLLEKSNKKDLCKQL--TTHSGNILKEFGII--LLDVKTDYKLELHLNNDNLNKEVKYIATKTNNKSTEPKVKIDGSSIKLIEGKDGIALNEKQLILGIKDILENNNNLKVVADYSKTSPNIDIEDLKCIDTKISSYFTGYGTGGA-RGSNIQNASSKLDNLLIMPGEEFSYEDTIGPTTAENGYRSAPVIVNGQLKSGLGGGVCQVSSTMYNAQLKAGILPSERSNHSKPVSYVPRGLDATLASGSIDYKFINTYDYPLVINAYTSSGRLYIEFWSNKNATKGITYEAKSSGRV-ANAYLLGYDKNGKQVYKRHIDTSVYR.... 422
73 0.000e+00UniRef50_A0A2C1AIL1 Uncharacterized protein n=1 Tax=Bacillus cereus TaxID=1396 RepID=A0A2C1AIL1_BACCE  ali  27  48...........................................KNVVLPNTKMEEISVGGMERNKLESIIVQRLTRKKVAFLLADRKQLFTYGEMNVTYSSKQIVDDIFRNQQSTHIWNGISEELEAEIGIRDYHLKPVIDEKKIKQFIEKNFKQYNTSPTNASFTSNTSQPTLVKSKPGKKIDVNQLQKDIITAIRQ-DKSEIRVPYLDVQPKIGTEDVQKINTVMSEYKTSLDGRNENVRENIAQAAKQLDGLIILPKESFSFNQIVGVTDQKHGYKNAAIIMNNKLVQAAGGGVCQVSSTLYNAVLSANLDIIYRVNHSQRVSYVPMGFDATVADNGPDFKFKNSSTTPIYMRAILENNQFIVRIYGEPLHETVYAKNTKQTDSTTVSTYRDIQDNNQNVIKSEQIATSTY..... 429
74 0.000e+00UniRef50_A0A0G0FDB2 VanW family protein n=2 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G0FDB2_9BACT  ali  28  40......................................................................................................................................DTKLTLNQDKVNLYLKKIASQIDRPVQEPLLSVDPSSTQFQPPIEGQKLDLEKTYTLLSQAMLNQNQKTIELPVTVVKPKNKLTNDLGINELIGRGVSNFAGSIPNRIYNIELTAQRINGALIPPGEIFSFNSTIGDVSADNGYKQAYVIKSGRTVLDDGGGVCQDSTTVFRAALNAGLPIVKRTAHAYRVGYYPPGLDATIFTPSVDFQFKNDTPAHILLQAYTRGTTLYIDLYGTSDGRPRGTTKQVDFSAWGANVSRTVT-RNGEVIISDT-FKSNYRPWQ. 360
75 0.000e+00UniRef50_A0A1B8W142 Uncharacterized protein n=9 Tax=Bacillales TaxID=1385 RepID=A0A1B8W142_9BACI  ali  25  32...........................................QKTVPAEVDAGGIPIGGMPVSDALKLLDQYLLQRTITIHADNKQWTV--AELGYKAEFKGVRDALLKLG-EGDIWERAVYRHQFA---KTYGLTQGWNRDVFDAAVRKQWSWIEKETKNAARTITDDKVIYEPHVDAYRLDIGKLLDEVDNFVVLKKEQEAELSIAAIHPELTLEKLKGVERKIVEFSTDFKTSAEGRAHNVTVTAEALNDWELAPNEVFDYSKLIARAEELYDYREAPVILNGKLVPGIGGGICQVSSTLYNAALRAGLEIVERRNHSLPVAYLPIGQDATYAGGAINFRFKNTTGKHLVIRTLVEDRRLTVKIFGTMKANERYEIVTVEKGKEGYVVTFRTLLRDGKVVSRDRLSRDTYKAQPK 448
76 0.000e+00UniRef50_A0A2J0M8S5 Uncharacterized protein (Fragment) n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A2J0M8S5_9BACT  ali  27  15........................................................................................................................FKTANHTNGSNEEKKVVAGFNQEIIYGYLKSIAPQINIKAKDAKFEIRDGKVEFQISQDGQELDLKKSWEKIEREITREKKKEVELVVEKIEPQITVESANGIKELVGRGESNFKGSPKNRRYNIKVGSERLHGLLIEPNKTFSLVEAIGKVNKEAGYLPELVIKGDKTIPEYGGGLCQIGTTTFRVALDAGFPIVERQPHSYRVSYYPAGTDAAVYSPHPDLKFINDTGHHILFQTKIEGDKLIFEFWGTRDGRKVEMTEPTEISHNGADTERTITYPNGE--KKEEKWRSHYKPWQ. 342
77 0.000e+00UniRef50_A0A226BVS7 Uncharacterized protein n=1 Tax=Natranaerobius trueperi TaxID=759412 RepID=A0A226BVS7_9FIRM  ali  27  2......KFSNLTKKQKIYCGICLVVFLCIILVISLDFGYRMTYSNKYNPSTFLAGKQVQGLNYEEGNKLIEEKIKNKDISLIYDDYRLETSFEELGIHWSKDKTHKELIS--EEMSFGKGIKHILGLYEDESEIKLQFKKDETTLDKILKKVSDDISKNPKDAQFKVDNQKVRIIPHEEGYELDKKQSKDNILDKLEETEQLDFELTTRKVPVDKTSDDLKNLDSVIGSFATSFSANDENRVANISLAADYINETLIKPKEQFSFNETVGPINKENGYKTSSIIVDGEFVDGVGGGVCQVSSTVYNSVLKTGIEPVERYPHGRPVGYVGLGRDATVAYDYLDLVVENTLENPILFSAFVDENEIQIDVFGSEQDYNYTVQKTDYTELQPEKKYK-YQSKDG---IKEKISKS....... 416
78 0.000e+00UniRef50_R7FJC3 VanW family protein n=5 Tax=Clostridium TaxID=1485 RepID=R7FJC3_9CLOT  ali  30  153..............................................ITKGVKIEGIDVSGLTREQAKEKLESIYSEKKITLKYEDFETTIAPETLETNYNIEKATNEAILVGKSGNIITNNYGIFFALIGKKNIKVETTINEEQTKQAIEDIQTNLPETIEEPDYYIENDKLIITPGKEGLKILTDKLLTEIKEQQKNTNQETIEIPAEKAWPDFNIEDAKKILEKISSYSTRYDGGDKDRSTNLEIACKKIDEKIVLPGETFSYNKTLGARTTKAGYKTAKVYENGAVVDGIGGGICQISSTLYNAVLKANMQTVERRNHQFITSYVPEGRDATVAYGVTDFKFKNTRKYAIKIKATASNGVATISIYGIKENPEEGTEEIKQKGANGCVTTYIIKSLNGQVVSKDLLSKDTYSAMQR 621
79 0.000e+00UniRef50_A0A101VB78 Uncharacterized protein n=2 Tax=Desulfitibacter TaxID=293136 RepID=A0A101VB78_9FIRM  ali  25  33..............................................VPYNLFVQDKSLNG-TKKETLDDIEDSLLNKKLIIEHEDETFSYNVSEVGIFSNKEQIEADILAI-YDKNFLITMHSFLEIFLNSKKYSLNYKIHEDLFLENIRDIDKVRLGQPINAEFEYIDGKVTIIQEVNGTEVDKEKLIGVIANSKIDSGHLVLELPFKDVVPEITSHELAGINEIIGEFTTVFNPNLTNRTNNLILSTGAINGKILAPGEIFSFNETVGQRTIESGYKASPIYVGDTIRDGVGGGICQVSSTIYNAVLLADLKVIERRNHSLTVPYVQLSRDATVSWGTVDFKFKNNTDNYIYIYGNIENNQLTIELHGTNSEKTTVLTSIVSRGTPGYTS-RLIKYIDDELILREVISTDRYLPT.. 433
80 0.000e+00UniRef50_D4W3T8 VanW-like protein n=6 Tax=Turicibacter TaxID=191303 RepID=D4W3T8_9FIRM  ali  26  40........................................MAYESVAFPNIFINDIDVSELTQEKIVEVIEKELGNRKMTVVVGDQTFERSLEDFNVTFDIESFSKKIIEIGKDLEIMEQASQIQEPML--YEFEIGYNYDQDALENWVKSIEEACYVEKVEPIFEMVYGSFQIEEGSDGQLISGEQLLEQLTEQLKTISKEPIYIEVTPINPRETDELLKTIDTKISTYSSTYPAGIP-RAKNVELAASKVNKTLLMPNDEFSYAEKVSPVDAAHGYVDATIFLNGKAVPGIGGGICQVSSTLYNTQLEAGIIATERRNHSLSVNYVPLGQDATMADNAIDLKFINTLDYPIYINVMAEYGTLTVEFWSNSEALKGITYKPVSEGGLRADTTLYGYNADGEVVFEQFLHTSKYKPHQ. 425
81 0.000e+00UniRef50_R7FKC2 VanW family protein n=6 Tax=Clostridium TaxID=1485 RepID=R7FKC2_9CLOT  ali  30  155.............................................TIAKGVYIKNIDVSGLTREQAKEKINNYISSEEIKLTHNGFETSLSTSQLSIYFNTDEAVDMAYNIGKTGNIFQKNLTILQTRLSKTTIDPGFSIDMDQLKKDLEDISSKLPDKIIESSCYIDGNNLIITKGKAGKTVKVDDSAKYIKQAINDLENNSLELLTEDSTPKITLDEAKNMTNMIGTFSTKYAASNKNRTTNLILAAKKINGTVLMPGETFSYNKVVGARTIQAGYKEAPIYVSGRVEDGIGGGICQITTTLYNAVVYANLDIVERSNHQFVPSYAGPSRDATVVYGAIDFKFKNNRDYPIKIACSVSGGIANFKIWGKSDNDYEVQISSRTTGKTSSEAYKILK-KNGNVVSTTLLSKDTYK.... 599
82 0.000e+00UniRef50_A0A1S9CJF0 Uncharacterized protein n=3 Tax=Epulopiscium TaxID=2383 RepID=A0A1S9CJF0_9FIRM  ali  27  1..........MKSIIKWGIVTASIIATSFVGSNAEAMTYEFTLDETFIDGVFVEGLYVGGLEKDRAQENLEQKLNQVFITVVDGNREQTISLKNLGVEYDIDTVLNDALKASRGQN------------TSDIHYKTKYLVDINTIKNVLENLKPMFSVRAQNADLIRENRKFITIPEVMGRELNVEETAKLIQTAILENNSNKIPLVMNTIRPQYTSQDMAALQTPISSFFTTYNSFDVNRSVNVALAAEKIS-VKLLPGQIFKFSEQIEPVTKANGYKDGGVIVDGEIVDGIGGGVCQVSSTLYNSLIMSKLEITKRRSHSLPVSYVPLGRDATYAQGWLDLQFRNNSNYPVFIEGYCENGRIYVDIFGHEPADTEYIYDSETTPISGKTVYRQGY-INGQKVNTELISTSYYQKRN. 435
83 0.000e+00UniRef50_A0A1H6BLL5 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=4 Tax=Paenibacillus TaxID=44249 RepID=A0A1H  ali  26  40...................................................SVSGWKVGGMAYADFPQQLSRQLNSVSVQLVSDRKEVPSKLQDLGLRVD-DRELQDLLRELTEGNLLDRARSRWKLRHHEAKIGLSIETDR--LDKKLQILWPELYVQPVSARIVTPDDRVEYKAGQPVLRIDAPGLKADIERQIRAENPLSIQVPFRLQQPEVTEKMLRDVDRLLTQFSTPLNQSSPGRKHNVRSTAATLHEVILKPGEIFDYAPIIEQTGIKFGFREAPVILNGKLVPGVGGGICQVSTTLYNAVLRAGLEIVERRNHSLPISYAPLGQDATFSTGFINFRFRNDTKAHLLIRTQMSDTALTIKLFGSIPSDTTYEIETIQPGKQGFVVTYRIKKQGGREISREKISRDRYTPQAR 446
84 0.000e+00UniRef50_A0A1V4IHA6 Vancomycin B-type resistance protein VanW n=1 Tax=Clostridium oryzae TaxID=1450648 RepID=A0A1V4IHA6_9CLOT  ali  30  26.......................................QVNYNDRIRSGVTINNHDLSKLTYDKAKKKLQKNILSHKIVIENGDQKYSIGFADAGIGTNMEEILQSAYNYGKRSTIVKSVMSMFT--EQEKHFSSKLLLDEDKINAYIKKLEKSVNKPTVDAKIIVTANKLRITESKDGIELDTVKLKKELYDKVINYKSGDITLMASTVKARVSSKILKTIDSRLSSYSTYYSEYVAGRASNIKKAAKAVNGTLLMPKEEFSFNRTTGERTIKRGYREAPIIVNNKLQPGPAGGVCQVSSTLYNAVIRANIRSIERRNHSLAPAYMPPGFDATVSS-NIDYRFVNTLKYPIYIRGFAHNGKVTFSVYGNNYYTKKGEEEVIQQKHKGYIVKFLITMENGKEKGRTLISRDKYVKTDE 435
85 0.000e+00UniRef50_A0A2V2DNK2 Uncharacterized protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2DNK2_9FIRM  ali  27  59............................................DTFAEGVSVAEMDVSGMTEEEAREKIAEQMAAGYCSYTVEGKTYNLTAEQMGASVDYESVLQEAIRFGNEEDAKVRNANREEAKTNGKDFPLTVTVNRETLLATLQTNGEQYNTEPVDATVSVNKGTLEYTEGSPGMTVDDEALADKLVAAAQNGDTNPIAAELTETQPSITKEDLEENLTLRASYDTSFQDSAYERRYNVWKMATVVNGVTLQPGEQWSINEAAGPRDANSGYKQAPGITDGGYTEQYGGGICQVSSTLYIALLKSEYEIVSRKHHSWPVSYTPTGLDATISTGGPDLVFKNNYDYPVVLLAKCDGKTVKIEVYGPKMEYKVR......................................... 409
86 0.000e+00UniRef50_A0A2H5WPY8 Vancomycin B-type resistance protein VanW n=6 Tax=Bacteria TaxID=2 RepID=A0A2H5WPY8_9BACT  ali  23  5................WYRIALFAGLSVLGLGVGVVYYRVKQGAGVFY----VGAFRLPAETLAELEQQMAEALEAVPVYVQVPQQTYPLSA--WGFRLDVPATKEALHLAWEATPFWKRLTTQPRVQVAPL-----WKVNPEAFERTLAR-YRFIERPPQDARLRYQGGQITILPEQAGQQIDPKPTMRALMDALQYASPDTFALATETLRPRLIAQQLSVITGEMGRYTTRFPGYQVHRNHNIRLAAQALNGRILMPGERLSYNATLGKRTPKNGFRLAPVIIRGEKQLGVGGGICQVSSTLYNAALLAELKIVRRANHSIPITYVPLGRDATVTDTGLDLVIENPHPHPIAIATEVGRSSVTVRILGVPPNLPVGVRKIKEKGSAGVKVWRLVYE-NGQLVRRERVATSIYRAQPR 428
87 0.000e+00UniRef50_R6AHK5 Uncharacterized protein n=3 Tax=Dialister TaxID=39948 RepID=R6AHK5_9FIRM  ali  30  33...........................................DDRVIPGVTIHGTKAGGATEEGLKELFNADLLQGKLLLTKEDAHEEISFRSLSVRYD-EKAIEKAMALGRTGGLFQRWYDRWRILLTGQSAAIDASFDEKHLTEDIAQLAAKYAKPPVNAKPRFKDGSVSFDEGRPSMKIDKAALEEAAALQLKKGESGEVEIPTDIQKPNMTKEAAKEINAVLAEYTTTFYPGG-NRSRNIEIAANSISGRYIAPEVSFSYNQATGSRSSANGYLEAPVIINGKVEPGTGGGVCQVSTTLFNAVILSGLAVTERTCHYSPASYAPIGRDATVAEGSLDFCFLNHLKHGVYIYAVYEPGAVTVRILGNQEDKPSEEDKKVEEGHEGHNVTQSVKWADGR-IYHDSFFSD-YEPVD. 434
88 0.000e+00UniRef50_UPI0009DC0D20 hypothetical protein n=1 Tax=Paenibacillus pinihumi TaxID=669462 RepID=UPI0009DC0D20  ali  25  65...........................................QDSVPDGTTAGDVQIGGLGTKQALDKLDEAWDDMQVRISLNDNSRQWTLRELGFTVRRDETRDKILEL-NEGSLAEKMSYRYRF---PRQIPVQLSEDSKMLEKTIRSQWGWLENEPVNARRSFTADQIVYEPHQDGHRLELNKLFSQLSKWASQADHRQFVLQVAAVHPPVTLDRLKGVERKISSFSTDFARSSEGRAYNVTSTAKILNDWELAPGEIFDYSKVISAAQEHYGFREAPVIVNGRVVPGIGGGICQVSSTLYNAALLAGLDIVERRNHSKAVPYLPMGRDATFAEGYLNFRFRNSTEHHMVIRTEVSNRTLTVKLFGTMPKATRYIIETKKQGTVGYEVYRTRMEHD-KKTERELISTDTYPALP. 476
89 0.000e+00UniRef50_A0A1F6SNA7 Uncharacterized protein n=1 Tax=Candidatus Moranbacteria bacterium RIFOXYA2_FULL_43_15 TaxID=1801648 RepID=A0A1F6SNA7_9BACT  ali  25  38..........................................................................ENSDMVFLIDRTEHKLSRKELGRWIREDSFLSYNSSYLSEGNICDEKKSIFSLKNASHIQKKSFKLDKDQAESFVKDLARSDNKDPEDARLKMEDGRVSIFSSKSGLKLDEEKSLLALVEYIKNPDAKSLELPFEKINPEVSIDSIDGVTSLIGEGRSNFRGSPKNRVFNIKVATNRFNGILIKPGEEFSFVKVLGEVDGEHGYLPELVIKKDKTEPEFGGGICQVSTTAFRAAINAGLEITARRNHAYPVSYYPQGMDATVYVPRPDLRFKNDTPSYILIQTKIEGTELIFNFYGTSDGRKVEILERNPDGSMKTVFTQKIYDGNSNLIREDVFNSSY...... 395
90 0.000e+00UniRef50_A0A2M7LLW7 Uncharacterized protein n=1 Tax=Candidatus Roizmanbacteria bacterium CG_4_10_14_3_um_filter_39_13 TaxID=1974831 RepID=A0A2M7LLW7_  ali  21  39...........................................DNRLFPNVSINGQKVGKMNKTEVTSNLESQIQENIITLSYENNVATFSASMLTTHLAIDDAFDRAYIVGRSPHTPSRLFQTVALGLRQFEFPLAISYDKQPVVEVLSHLTDLYEKEPINAKFQFESGKVTFEKESDGLHIEVKKALSEVNDSINKLISHPLPVKSTIRKPTVTLTQTNGIEELIGEGNSDYTHSIPQRIHNLLLGTAKFNGVLIPKGATFSFNDTVGDISSSTGYQPAYIIKEGRTVLGDGGGICQVSTTIFRAVLNAGLPIVEYHSHAYRVGYYEPGLDATVFGPTVDFQFINDTPASILIQTSADNHRLSFKFYGKKDNRKKGVVKQVDFAAPGGRSRYSYKVTKGNDVSFQKDFNIWYRPW.. 457
91 0.000e+00UniRef50_A0A254QHV3 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium Cent15-Ar3 TaxID=1987502 RepID=A0A254QHV3_9BACT  ali  26  39................................................KGSQVGIVDVGGLTVSEAQKKVRIWWEARPLNLKIQDKTATFTATQLGIVVDDVASVAQVPVEGVVGQVLSDEKKVFNPIFKPNSVDLTP----------LRSIVSKIFGPAAPAKVKFVGGVIQKTPETPVLTLDEAGLTASVISAVQ--DDQIVDVPVKEAPKKLTDEVLAQITDVVGEFKTNFNAGVRDRSNNIRLATGKIDGTLLLPGERFSFNKTVGERTVKSGFREAPVFVNGRHETGVGGGICQVSTTLYNASLFANLKIVERTNHSLPVPYVPVGRDATVNWGAQDLVLENNMTTPIVLAAEYTPGTLRWRILGKKDPTVSVKISSTPPGAVKVTSTRSVYTKNGVEVKKEPLGRSYYAGSPR 429
92 0.000e+00UniRef50_A0A0W8E4G3 Vancomycin b-type resistance protein vanw n=1 Tax=hydrocarbon metagenome TaxID=938273 RepID=A0A0W8E4G3_9ZZZZ  ali  25  45...........................................SQTVPYGITVDGHEVGGFNREQLVAYLASNIIDTEMVIKNGSREWYLATKDFDFRYDYGKTVDAILQEPPWADSHPMVLSLLKLQARKLELPFEISWHEDRLDTFLASINEETMIPARNASLHVVDGKVLIVDGQSGEQTDFESTTENIIRSIRSNNGEIVNIVKKTIMPEIVSEDLTAVDSVVAVFDTEIDIDNDNRTDNVILASQMLDGTIIMPGDIFSFNEVIGERSLETGFKNAPVIIGGSVQQDVGGGICQVATTLYNASLLTGLEIVERSPHTIPVKYAPHGQDATVFYGQIDLKIKNSLSNPVMINSIIENSKLMITIYGN................................................ 376
93 0.000e+00UniRef50_A0A162U3L6 VanW like protein n=1 Tax=Clostridium magnum DSM 2767 TaxID=1121326 RepID=A0A162U3L6_9CLOT  ali  25  2....RKRKYRITNTAKILILEFLLSSVGMLCGFTWRIQSEKKWDNLIYPGIKVANIDLSGKTKAEAKKLIQDPLLKNNTNVLINDKVYVLENSKLITNYDMDKVLNAAFNLGKNLNSYKKCELLKRSTT--HQYNVFFEYNENYIKAFINKVEESVNKEPQNATAKINDGTIKITDDIKGEKIEEEKLEENIKKEINSSENIKIQVPIEKVAASILSSELSSIDTNISSFSTSFELSTDERAHNIELATSLINGKILMPQETFSFNDCVGERTKDRGFVEVPILEGNVSESGFNGGISQVSSTLYNAVLKAGIKPVERTHNIMPFSYVQLGLDAIVDWNNIDFKFKNTLKYPIYIDAYTQKKSLYVNIYSNSSDLPEGQVSVVQTGYSGHKVVKRDTYENGIVTSSDVISYDLYPP... 446
94 0.000e+00UniRef50_E6LQF9 VanW-like protein n=8 Tax=Lachnospiraceae TaxID=186803 RepID=E6LQF9_9FIRM  ali  25  97.................................................................ALNSLQEKLDAKKFILDVKGEKIESSFAKLGAGINKDFILAEAEKFT-SGNMLERFEKSSELLEKPENITPDIVFNDDAVKAFLKNANGKNPDAPVNATIKRVNGAFEITPEKEGYEIDSESTVAKLKDAILKDGEETIVADVTKQKPKVTAEELSSIKDVLGTFTTNYSSSTSERATNIAVGTAKMDGVLLMPGETLSGYEKMQPFTIENGYKMAKAYQDGLVIDSVGGGACQIATTLYQAALRAEIKITERKNHSMIVGYVQPSGDAAIAGDYKDIKVTNNRSTPIYVEATTVGRDVTFTIWGKEDRKPRGYVKRESEGHKGSKLWKVVKE-NGVEISKDLISSDTYRKAD. 477
95 0.000e+00UniRef50_A0A1F6R856 Uncharacterized protein n=22 Tax=root TaxID=1 RepID=A0A1F6R856_9BACT  ali  27  36.............................................................................EIKLKVSEYEEKISSGELANWVDTQKISEENIRYCGSDYVFCRLTLTAEKTAKISKYE-KIKANEKNIRSSLEDMKRKVNRDPINASFAVEEGKVVISPSKNGIELDVEKGIEKISQQLKSNTATTIELPYKEIPPPLSSEDVEKINKLIGEGKSNFRGSPKNRIFNINVASSRYNGVLIKPGEEFSFVKVLGSVDGEHGYKEELVIKKDKTEPEFGGGVCQVSTTTFRAAIYSGLKVTARRNHAYPVRYYPQGLDATVYVPRPDLRFINNTPGYILIQTKIEGTELIFQFYGTDDGRRIEIIEKNPDGSMKATFTQNVYDKDGKQIISD-IFNSSYDSPNK 399
96 0.000e+00UniRef50_A0A1C6B5G2 Uncharacterized vancomycin resistance protein n=7 Tax=Clostridia TaxID=186801 RepID=A0A1C6B5G2_9CLOT  ali  24  1MVKRTAKNAAPKKKTLRVPLALKIVGGVAAALLVLLCGFTYLYPN-VFPGVTVGPIAVSGLSRSAAAAQIEKQYEDADVSVTIYEQTYRIPVRDVLENVDAAQSAENAYAVGRTGNPLARMWDVVTAVFGRGEGKPGVQFDTDAVEQALDKIAEQVIGEPVSATVNKEDGK-TIVPEKPGVQFDIDQAREIVGD----GTEQSYSVPITTTQPKVTAVDLQEFRDTLAQAVTYLDESNTARTNNVNLASAAINGTILNPGDEFSYNGVVGERTEARGYKPAHAYVNGQIVDEFGGGVCQPSSTLYMAVLRADLEVTERYNHSYTVAYTPLGEDATVDYGNLDFRFKNNTDYPVKILAQQSGGQMVMTLVGTKTSDKTVTTRTEVSGITGYRTYKQITE-NGKTTE-VLANSSRYDKRDK 515
97 0.000e+00UniRef50_I5ARI1 Putative vancomycin resistance protein n=2 Tax=Eubacterium cellulosolvens TaxID=29322 RepID=I5ARI1_EUBCE  ali  26  76.......................................KKKNGGRIY----IDNIDVTDMTEEEASAAVEKELSDSIIVFYADEQSYRTTAGKLGLGYSNRDVVKEALSIGRKGNVYKRFLAEQAMKNKEQIIKLFFTVSPEKVREVVEKSAESLNCDAQSNGLKLEDNSFTITGGRNGVDINVSESVEKVITYMEDEWTGGVELKANVTKYKNGRDQLSLVTDLLGSGRTAYATGNRSHDVNVEIAVRHIDGTVLYPGEEFSAEKVIGPTTAENGFLPGDTYEGTKVVKTYGGGVCQTSTTLYNAVIRAELEVTERHNHSYLVSYVDPGFDAAISEGSLDFRFKNNSDAPIYIQGITKDGYLTFNIYGHETRDPNRTISFESRGIQGCVAWKLIY-VNGEFSEEERVNSSNYQMMP. 485
98 0.000e+00UniRef50_W1U0E7 VanW-like protein n=3 Tax=Firmicutes TaxID=1239 RepID=W1U0E7_9FIRM  ali  28  32..............................................VVRGVKLQDRDVSGWQAEGLQRYLAEKYENAALNLTYQTYTWSIPMRDLKLAINAEKTAAAVSSYGRTGSWFRQWWEQWQSYLKPVQMNCTVAYDVAHLNEILRAKVDELAAPPRNASVSFNEGDVVIETEKPRLILDYVQVAKAAEKKINAQDFSPLILPSQVDLPTLRKAQLASINAILGEYTTYY-GGDENRSANIYKGSAAISGALLAPGETFSFNDTTGLRTYEAGYLSAPVFINGELVPDAGGGICQVSTTMFNAVLLAGLDVVQRTPHFAPVGYTEIGRDATVADNSIDFIWVNSAKSPVYVMATAGGGAINVKILGNSDDRPSGEDVIEEEGHDGYSVVRRVSWSDGRAL--TDTFYSVYDPV.. 430
99 0.000e+00UniRef50_A0A1G4FLH6 Vancomycin B-type resistance protein VanW n=1 Tax=Sporanaerobacter sp. PP17-6a TaxID=1891289 RepID=A0A1G4FLH6_9FIRM  ali  30  31........................................KLNTKTIYEGVKINNYDVGXXXXXXXXXXXXXXXXXKNMTLRYENKTYKIMLKDLEFNYDYKKGVEEGHNIGRSGSVLKRIRDIYDTKKHGAEIELQWTYNPQKIKKTVEGIAQAIDMEGKDADISFNGKNFSITEETTGRXXXXXXXXXXXXXXXXXXXXXTID--VEQSVPTKTKALLSRINGVIGEFSTSFKGSSRDRIENITISAKSINNKVIMPKESVSFNNITGPRDKKFGYKEANVIVSGEFTPGVGGGVCQMSTTLYNALVRADINIMERHHHSIPATYVNYGHDAAVSYGYLDLKFQNEFDFPIYIYTRVSGSRVYVYIYGDKDYDKPGTKQLVQKGRNGYKVTYKVVSKNGEVTKKELITSDFYTPKN. 437
100 0.000e+00UniRef50_A0A1H3YF10 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Lachnospiraceae bacterium NK3A20 TaxI  ali  24  59..............................................IEDGITINGQSVAGQTKEEARQFAQGIIDGRKITLNMDNATTTVSAGNLGLIWTNEDMIDDIAHYGHGCNIIERYKDSKDLEKNGYDFTIGMDFDKEIISQFITMNCTAYDVAPVEGTITKENGVFTVNGSAAGHAVNIDTSTEKIYQALMNNWSGTIDLNVETKEPKASPETLSHMTSILGSFTTYYATDNVERAANIANGCALINGTTVNPGEEFSVLDTITPFTAENGYELAGSYADNEIVNSFGGGICQVSTTLYNAVIRAELKITERNNHTMIVDYVDPSDDAAIAESGMDMRFVNNLENPVYIEGITDGGAITFNIYGVETRAPGRVVVTSTPGHTGYKAWKVV-SKDNLVVSKDIFNHSVYSMTP. 467
101 0.000e+00UniRef50_A0A1G9L6U5 Putative peptidoglycan binding domain-containing protein n=2 Tax=Romboutsia TaxID=1501226 RepID=A0A1G9L6U5_9FIRM  ali  29  94.........................................KYDNVVYPGAYIYKVNISNLNKDQLLKKLKSEIGDREIQIMAKDKTYKLKINKLAKDYNESELAQKILNEYNNKNIIQKFIAI--ISKKEKLYAFNIDINDKFLGEEINTISTKINLKSEEPKVIIDNENITIKDGKKGFKLDEKTLIKDIVMSLNSKNNISIKGKYIDDNPMIDTKELSQVNHKISTYTTTYSPGG-GRGSNVATAAKKIDDILLMPGDEFSYEDVVGPVTQDNGYTYAPVISNGELIQGIGGGVCQVSSTLYNTQLKAGILPTERRNHSKPVSYVPRGLDATLATGSIDYKFKNTHKYPIVINTHTGGGRLTIEFWSNEKALEGIDYKPVGYSGNVANTYLYGYNKDGKKIYEKHIDTSVYR.... 472
102 0.000e+00UniRef50_A0A1C5N5J8 Uncharacterized vancomycin resistance protein n=1 Tax=uncultured Blautia sp. TaxID=765821 RepID=A0A1C5N5J8_9FIRM  ali  28  38..........................................NDSVIWKNVQVNGISIQGKTKAQAREAIKETYEDKAIQVNLSDEVYQIDPGELLPQVTHPETVSSVISYEKVDTVVQPVCRITDDSLIIKKGKTGIKADTDALKEQLKAYYRQIYQEPEDAYMDEKND-YEIVPSRTGISFDVAKAVKEYGQA---KEGSVFTVAFEQILPEVTTGDLTSFRDVLGSYNT-YGGGTDNRITNLTLAAKAIDGIELMPGETFSYNETLGERTAERGYKAAGVFVNGQHAEGIGGGICQVSTTLFNACLYADLEIVKRTNHSGRVDYVPAGLDAAVSWGDPDFQFCNNTEYPIRISATYADGSVNVKIYGTKTNSNTVKVTTQQLDAQSYKTYRHVYDQDGNLLETEEICSSHY..... 481
103 0.000e+00UniRef50_A0A0X8G383 Uncharacterized protein n=4 Tax=Turicibacter TaxID=191303 RepID=A0A0X8G383_9FIRM  ali  29  38........................................LTYEDITFPNIKVNEKDVSEISKANLELVLKEELESRLIEVKIDDQTFSKTLKELGFSEDVNELTDEIFALGKDLEILEQAKRIEAAPV--VEYTIEYSYDESLVDEWIQSIAQQLYVDKEEPTFKVSAGNFEVTEGHAGYSIDADAIKEQVKTALNEVSAETIEVTAEVDKQAKDPELLKSVNYKISTYSSSFPVGIP-RSKNVELATSKINKTLLMPGDEFSYTDKVSPVIYSNGYVDATIFVNAQPVNGVGGGICQVSSTLYNTVLLAGIMPTERRNHSLQVGCVPVGLDATMAENAIDFKFVNTLDYPIYINAYTSGGTLTIEFWSNEDDGVTYKPQVKQVGQNKYQTYLLGYDTNGSLVYNEYIDTSTYK.... 419
104 0.000e+00UniRef50_A0A1F8EV79 Uncharacterized protein n=1 Tax=Candidatus Yanofskybacteria bacterium RIFCSPHIGHO2_01_FULL_44_17 TaxID=1802668 RepID=A0A1F8EV79_9  ali  23  1................MKYRLIILASSALFLGFVFVSGQIFYYTRKTAS-------DIGRSSLV-LNSKLTANLDNAKLVLESEEKQFIVESSEL--------------------------KKWTESYTRNYTGKEELRLNTEQIKTYLDSVAQKINTPPVNARLIINDGKAEFMSPRPGQKLNIQATTFNIANGLANNGPNKINLVLDKTDPEVTLEKINGIDELLARGESDFGGSPKFRTQNIHVGAQKITGTIVGPGEEFSFNKFLGEVTASTGFVPELVIKSGKLIPEYGGGICQVSTTLFRAAMEAGLPIIERRAHSLPVRYYPQGYDATIYPGVSDLRFKNDTSAHILIQSKITGSKLYFEIYGTKDGRQIYQYEIQANGAMKATISRTVTYTNGQ--DKKDVFNSSYKS... 381
105 0.000e+00UniRef50_F0Z3C2 VanW like protein n=16 Tax=Firmicutes TaxID=1239 RepID=F0Z3C2_9CLOT  ali  24  46........................................KFDSHRIIQGVSIGNTDVSGLTVKKAKEKVEAEVMKEKLDLTLEDGRHEVELSAMGITVDLDGTLQEALDYGRKGSTVKCYKIMKKAEKNENKFPVEYKVTEDSAKEALNHAMSHVLNLPENARVTQSDSGVTIVKEKAGEVLDLKKTVKSINKLLGDGKSGSVEAYLTYIDPEVTADDLKDVTDLLGSFTTFYGSDGSGRAQNIESGTKHIDGAFLKPGEEYSANAAMEPYTEENGFTNAASYEDDKVVESMGGGICQISTTLYNALLYAELEVTERSPHTMLVSYVERSRDAAIADDVKDLKFKNNQQTPIYIEGILADGNVTFNIYGKETRDAGRTLETEDAAGTYYTTWKVVY-LNGEEQSREIINNSQYVPVKE 462
106 0.000e+00UniRef50_K1TM15 Vancomycin B-type resistance protein VanW n=1 Tax=human gut metagenome TaxID=408170 RepID=K1TM15_9ZZZZ  ali  24  1..........MNKYRK-----GFYGILLLTLTMLFGMTAQAKTDDTIKTGIYAGDVELSGMTAQEATAVIEEHIESKDVEITANDHDVTTTAGDLGVTWKNPELVQEALELGTHGNVIERYKILMDLQHENYVYPIELDFDLQAINDLLTR-CTKYDQEAINVSLKRDGGKFTVVEGQTGYVLDVEKSIDAVYDYLTEEWNHEIPLEIVVDEPKGSAEELAQVTDVLGSFTTSYKTSGSSRSANVANGCSLINGTTLYPGEEFSTYKTVSPFSVANGYYMAGSYVSGKVVDSLGGGICQVSTTLYNAVLLAELEVTERYNHSMIVGYVDPSADAAIAESSKDL............................................................................ 335
107 0.000e+00UniRef50_R5AM62 VanW-like protein n=1 Tax=Clostridium sp. CAG:1024 TaxID=1262770 RepID=R5AM62_9CLOT  ali  26  98......................................DAIMHSGKYLPGVTVEGVSIGGMTRAEAESALQSLIDERTLTLSYDGKTYQFDLSTLVATSNLDVVLNDAGKLAQSNDMQTALSQAEDVEKNGKNYTLTTQYDFNTVTEYVKGLAAELNQSVKNASIDTVNHTVTMSDAVPGVTVKETELVSAMTNAILTNNHAPIAIPAETVEPEVKGEHLQMIE---ITAETSFKGSTSNRIFNIKKGADLINGKVLAPDEVFSTNDTLGVRTYSNGWKEANAYVSGTTDLQAGGGVCQLSSTLYNAVVKADLEVVYRRNHSMPVSYISKGLDATINGNIIDFKFKNNTGSDLVIFAWTSGKTVYFKIFNTTEYDETEVIDVPTSNGSVYQSYKH-YYKNGQKVRTEKLAQSTYRA... 512
108 0.000e+00UniRef50_UPI0006CF2FAC hypothetical protein n=1 Tax=Syntrophomonas palmitatica TaxID=402877 RepID=UPI0006CF2FAC  ali  33  9.....................................................................................................................................YPAKIVYKSEVITRMGHEWDAKLGKQAVDARLEMDPERLIVVPDSPGTKVNLSETMAELPRYWGEMDELRIPIIMNEKQPRVKAQDLQGMGE-LSSFSTWFNTSEENRSHNLRLAAAGINGSMIEPGEVFSFNSKVGPRTYENGFSDAMVIVGDKFELGAGGGVCQVSTTLYNACLLAGLEIVERHNHNLAVSYVPLGRDATVYYGAQDFKFKNNTASPVYLRAYTLGGKLIMQVYGNSKDLPPGKTRVDHAGIPGYSVYRSFYDSQGKLVRQEQIGRDYYRPLNK 321
109 0.000e+00UniRef50_A0A0D0QNF7 TWA4_scaffold00001, whole genome shotgun sequence n=1 Tax=Lachnospiraceae bacterium TWA4 TaxID=1392836 RepID=A0A0D0QNF7_9FIRM  ali  26  1...............MKFKNFGKTLAFVGVFLLVSTMHVEAAQEETIAKGVYLNDVDLSGMTKNEAKTAIQETLKDKMITLVTDSHKNTEKLKTLGFSATSSEILKEVMEIGENGNLIARFKELKDVETNKKVYELESSIDKKILESYVNEKLKGYEQDAIEPTITRKDGKFVITEEENGIKIDIDKTILAISDEVNKNWKETVNTVYSVEEPKHKAEELRTIKDTLGKCTTKYSRGQVGRTKSLELSTSRLDGTIVYPGETISISTLMGPRTKAGGYGTAKGYYGTAVEDTIGAGICQTASTVYNAALEAELDIVERHNHSMIVHYVDYAMDSTIYAGSKDLKLKNPYSDPIYIQSSASGGKCKFTIYGNDTRDKNREVKYVSKPYVKASLTKQIY-VDGKLTESKLLHTDVYNSANK 445
110 0.000e+00UniRef50_UPI00048BD1A4 hypothetical protein n=1 Tax=Proteocatella sphenisci TaxID=181070 RepID=UPI00048BD1A4  ali  34  30.......................................NSLSEDKILSNIYINDFNVGGLNKEEARELIKQNNSFKNLNVVYGNGDHIYNLSELGFDYGVDEAIDQALEVGRSEDFFENLSDFVNLKFLKNNKTFDAKVNPQGIEEKIEDIKSDIEKEPVNASVYI-GGSINVKKGTEGVKIDRSEFKKSLYDSIVPNQDVRVAVPIVSVAPKVTSEQLNDINGIIGSYTTNFSPNIAGRNENIRLSAQYMNDYLLMPGEVFSYNKVTKLKTVSNGYKNATVIVNGEIEEGLGGGVCQVSSTLYNSVLYSGLEIVQRRPHSIPSNYVNYGRDAVVSDNAIDFKFKNNYGFPIYLKTSVGSSSVTVNIYGDVNKVPDIEIIS-QVVSRKAREIKYIDDPNGKEVGRDEVRSETYLMVN. 415
111 0.000e+00UniRef50_UPI0005517603 hypothetical protein n=1 Tax=Lachnospiraceae bacterium FE2018 TaxID=1410624 RepID=UPI0005517603  ali  25  164.............................................RAAEGVYIENVNVSGMTRDEVQQAFESKLLSDKITLHMDEKTDVVPAGKMGMFCTNPEVVDLAMIIGRKGNILRKYRADKYLSQNGVVLTLDLTFDEKEIRKTLTGEQDRINIDPIPVKMILNDDTMTAVDKVDGLKMQIEESAGKIKAFLDQDWPGAVELISKVVPATGDISQLADVKDLLGSGSTEYDDSEVERFHNIELATNIIDGTVLYPGEEFDFNKIVGETTEEKGFVSAGSYENGEIVESFGGGICQVSTTLYQAVLRAELDVTERHPHSMTVKYVEPAFDAAIAEDVKNFRFINNTDAPIYVHGTAGGGVVRFEIYGKETRSPNRTLTFESRGRYGLVTWKLIYE-NGEYVDQVQVNESEYIMAP. 571
112 0.000e+00UniRef50_A0A1F4RMV6 Uncharacterized protein n=7 Tax=Candidatus Saganbacteria TaxID=1703751 RepID=A0A1F4RMV6_9BACT  ali  25  35................ILKIVGGFAITSVIVAMSFVSYDYIMTRHAFPAQTYIGNVDVSGLTQGEGIAKLKSQIFSPLITLETDNASFSFAPDELGVFVLYQDTVTNTFKITHKENYVAELKER--IAKGEFVTPLILSIDETRLKAVLEELANEIRSSPKNATLYEETGGYHIESEDLGRELDVHKSVDIFKTALNQGKT-SVPLELDFTYPHVREKDLRAPAYRLSAYTTYYKHDSPNRIHNIKLIASWIDDTILMPGERLSVADVIGDVTSEKGFKQAFVIVGGELVPLLGGGACQVATTLFNAVALADLKVLSRRNHSFYFSIYPLGRDAGVYPGQLDFQFKNDSGYPILIKSVYTNKRLSFRLYGTPDGKKVEFSPVSILGLSGGKVTRTVWDKEGKEIKKEVIS-SFYK.... 457
113 0.000e+00UniRef50_S0EW21 Uncharacterized vancomycin resistance protein n=4 Tax=Chthonomonas TaxID=1077265 RepID=S0EW21_CHTCT  ali  27  46.......................................HLHSEDVIASGVHLFTLDLSGKTPEAARGEILQWAQDRALTLHAQGISVSIRARTLGLGIDVDSTLQTAEDAGRTG-WLSKIVSLIRSSKPDYPIAPTVTVDQKQLHEALTHVAHLTQVPPINARIVLPKGGFGLKHEVSGRAIDVDAAASIVTRAWQQEDRLELNLPTQVIQPRITYNILHTIDSKLSSYSTWYAEGK--RGHNIEVATEKIDGTLLLPGQIFSFNNTVGPRVLASGFEVAPVIIHGQLQPGVGGGICQVSGTLYNAALKAGLKTVLRNHHSFPVSDIPTGRDATVAYGELDMRFQNSLPYPVYIVGRAHGGLLTFDIFGHADPDRTVQLVVEQKGRPDVTVWYQIVRVNGKVVSRDVIP-SHYEGQPE 480
114 0.000e+00UniRef50_A0A1G9UJC3 Putative peptidoglycan binding domain-containing protein n=2 Tax=Megasphaera paucivorans TaxID=349095 RepID=A0A1G9UJC3_9FIRM  ali  25  31.............PWKKGFIAFGIICALSTGGFLFA-------QSKTIDFVTLDGQPVANMTEDDIQQYLDERLHKKTLSLTAQGVDETLSLKKMNGHYDRQRINDDIFLVGRIGTPIQRIADVYTTLRYGKNVPLAIEVNDDMLTDFTNHIHDKYDVEEKNAYAVPNGSSVVLHNGTDRIVIDAGQLKNQILDELHKGNTGDIAITVQDKEPAIKEKDLKGIDTVLSYYTTHFDASAADRDENIKICQNLLTHALVPAGKAFSFNDTVGTRTRDKGYKDAPVYFDNKVVMDAGGGVCQVSTTLFNAALRAGLIIDHRSPHFAPAEYVPVGMDATVADGSLDFGFTNPFKHPIYIYTAMTGSALTVYILGNKHDDSVTDDVREQEGYDGHDVTRDVSYKDGDK-YTDKI-VSHYDP... 453
115 0.000e+00UniRef50_A0A1I1BEK6 G5 domain-containing protein n=1 Tax=Cohnella sp. OV330 TaxID=1855288 RepID=A0A1I1BEK6_9BACL  ali  23  82...............................................PDGVAAGSLDLSGLSADAAIAKVQARIEDGRVRLVTGRVEARPTWRELGLQLNAEEAL-RAIERYRDAGWLKR---RSAGRAIAKRFSIETVWDEETFAEKAEAMWGPLEKQPVDAVRTIDADQVVYSPETPGETLDISRLLAAFKNYAPKGEPLSIELPVIQVTPEITQASLQGIARKIAEFSTSFAASGEGRVHNVEATADALDGTMLMPGETFDYGAVVAEARRVYGYREAPVILKGKLVPGIGGGICQVSSTLYNAVLRADLKIVERHNHSLPVNYLPQGMDATFAEGYINFRFRNDTGKRLLIKAAVRDKRLTVKLFGTMADNVRYELETVQAGKSGAVVTYRLKYVDGQLHVRSKLNRSTYRAQD. 496
116 0.000e+00UniRef50_A0A231R9N1 Uncharacterized protein n=4 Tax=Cohnella TaxID=329857 RepID=A0A231R9N1_9BACL  ali  29  29...........................................DETLPEGFSVGGLDLGGRTPEAALETIRARISEAPVKVAAEGTSASVTLGELGLSITADAAV-KAIERHLDYSWWERAKLRAYGER-GAAYGIDATWDSERLEQAAKQAWGDIQEEGADASRTIDEDNVVYTPEKLGRRIELGPAIEAIRKLTPSGEARLVPAGIVETPPEITVAKLKGLERKIVEFTTSFSTSGEGRSHNVTAAALALNDTLLQPGEVFEYGKIVSKAEKEYGYMEAPVILRGKLTPGIGGGICQVSSTLYNAALLAGLEIVERRNHSLPVSYLPRGLDATFADGYVNFKFRNSTGKQLLIRTVVADKTVTVKLFGTMDDKVIYKTETAQKGENGYVVEFLVKQVDGKFAERKKLSKDTYRAQD. 457
117 0.000e+00UniRef50_R6Q8Q6 Uncharacterized vancomycin resistance protein n=1 Tax=Eubacterium sp. CAG:274 TaxID=1262888 RepID=R6Q8Q6_9FIRM  ali  28  8..TKKHRIRRKANKKRLINIAIVCIVGFGAIHFSWRPVLSQYYQMKINRGVLVDGMDLSGMTYEKALNTIKSKIKTEGVVFTIEKHKYEYTLDDFDIKFNIDDTVKQAVNFAQTSS--DNWWREFKTLESGTVNMPVMTYSPDKVNAAINKIKSDIIVEAKDATEKRVSGSFQVSQSQTGYNFDYEKVLNELTQSIKNNDNKTIKFDITETKPKYESSIFTGADKLIGNYSSQYKGNDENRVQNLRNACSKINGVILYPGEEFSTNAHFNPCTEENGWALAGTIVKGKIEDSVGGGMCQVSSALYDAVLYAELEVTERHNHSMKVGYSPYAFDATLAGDYKDFKFKNNTNKAVYIESYLTSSNVVVNLYGTDPDEPVGETEVVTPKGYKYELYKKVYE-NGVLKETVKINTSTYSPRQQ 468
118 0.000e+00UniRef50_UPI00083800E6 hypothetical protein n=1 Tax=Paenibacillus sp. GM2 TaxID=1622070 RepID=UPI00083800E6  ali  25  28......................................QHYAYRDTIPPGVDVAGIPVGGMSAHEAIQVLDRKLAEEKVTYSFRGGSEVLSWENSGVTFDIPDFRAK-LTALNNGSLWNRIQIRSRF---PKQWRLQARYDLQPLK---LQWGPEWEKAPVNAARTIADDSIRYTAGKSVYRIDWPVFMTLIQAALPAAHPVTISVPLVKLQPSVTLDNLKGITRKIAEFSTDLTTSGAGRLHNVEAAARSIDGMLLSPGGIFDYAKAIESAEQEYGFQEAPVIFGGKLVPGVGGGICQVSSTLYNAALRAGLEIVERRNHTLPVSYVPKGQDATFAQGYINFRFKNTTGKYLLIRAKSSNGRLVIKLFGTLAENVTYRIQSRTEGKPGYVVTFRLKQVDGITVSRTLLSRDTYPAQP. 479
119 0.000e+00UniRef50_UPI000C85B4A1 hypothetical protein n=1 Tax=Clostridiales bacterium Marseille-P2846 TaxID=1852363 RepID=UPI000C85B4A1  ali  28  73..........................................YDDTFVPGVYIGNVSLGGMTPEQAAAQLQTGMEGWHVNLTYQDVTKTITPADLSMRFEVGDQLNKAWAIGRSGSLYERYSQIQSAKKEPMAIIGEISYDEAMLDSILSQVQEGLEREVQNASFEPSSDTFAFTDEVYGRHLDTVPVKEQILEAVRSLESRDIVLEPELTAPTVTRAMLEENISAVVIVKSNISSSSAGRNQNIAVALEKLNGLVISPGERVSFNSAVGRRTEANGFTTALEIAYGEYVEGIGGGVCQVSTALYQAVARGGLEIIERTPHAIPSNYAEPGQDATVSDRGLDFIFRNTSDMPIYFKARVEDGSIEITIFGKPPDGIRYTLESTSKGRQGYVVTYLVTTKNSALMERELISTDTYKA... 490
120 0.000e+00UniRef50_A0A1H9F0T0 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Lachnospiraceae bacterium RM5 TaxID=1  ali  28  72.............................................VIPDGTTIGDLDVSGLTVDEASAKIDEYFTNKVLTLSMDENKADVTVGELGLYWKNREVVLNTLGCETKGSVIDRYKKALDTANGKKHYELDLNINKSVMSEAITNKCGIYNVPHVDASLSRENGEFVISPESNGRIIDMDESIKELTDYIENGENGSFELKVIDDIATATTADCELVTDVLGSFSTTFSSGSSNRNKNMENGVRLLNGITIYPGETLSVNSHLEPWTEDNGWANAGTYVNGQVEDSLGGGICQVSTTLYNAALFAELNIVERSNHSLTVGYVPLSQDAALAGTWKDLKLENNTDAPIYIEGIYESGRITFRIYGHETRDASRTLEVVSSGHTGYKARKKQVLINGVVQSEEIINTSTYAASN. 478
121 0.000e+00UniRef50_A0A2M7E3I8 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A2M7E3I8_9BACT  ali  22  42.................................IFFYLNKINFRDRIYPNIYIDGEPIGGLSYQQLIKK-ERYLSKTTITFIYQNAPATLSGQQINIHRNIKNLISESYKIGRHPNLFIRIQLITLMKLKKYSFISKIEYNVKPLQELIDIAQQRYEYPSINALFKFKDGRVIFSPEKNGLQIDKIRFWREIEKIISNLKNQVVVLHTIVIQPEITLKQINGIRELIAEGKSNYTHSIPERIYNLSLAAYKFDGVLIPTNKIFSFNDTVGDISSLTGYKPAYIIKQGKTVLGDGGGVCQVSTTLFRAALNAGLPINERHAHAYRVSYYEPGFDATVFAPTVDLKFTNNTPAYILIQVENDNNLLTFKFYGQKDDRKKGIVKQIDFPAWGAKTVFNYQVVAKKDISQNVKFYSNYQPW.. 470
122 0.000e+00UniRef50_A0A1Q3MHS1 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium 55-13 TaxID=1895717 RepID=A0A1Q3MHS1_9BACT  ali  25  29.............................................TIRPNTQIGMVPVGGLTKEEAAKKLRIWWESRELNLRSDQIRPAMTPGKLGVTLDDQASVAQAE--------IKDFWEAAQATVTGGNYPVKLDLKFKQIDASLKSLDALVREEPRAARVTYAAGAVVREPEVTTFELDVDKLGDAVLAALAA--NGDVEVPIKEAPKRVPDDELAKIVEVESEFSTRFPAYQTSRNTNIRLAASALNGQVLMPGDQLSFNGCVGRRTVAGGYKEAPVLKNGMHDTGIGGGICQVSTTLYNASLFADLKIVKRNNHSIPSVYVPVGRDATVDYGTLDLVIENNQDHPIAVSSTFENGKITFRILGKKDVSREVKIRVVEKGSSGITTYRVVYE-NGVEVRREVLNRSVYRGSPR 428
123 0.000e+00UniRef50_A0A1F7L045 Uncharacterized protein n=3 Tax=Candidatus Roizmanbacteria TaxID=1752723 RepID=A0A1F7L045_9BACT  ali  24  42........................................KKLTDRIYPQVYIDNVSVGRKTKAEVISLFEQKLLNTKIQIFYKEIIGTFSAQLLGLHTNTDEIFEKAYLVGRTPHTSSRIYQRITTLFGKFQFSTQVQYLNSVISENVERYKESYDKPAKNALFKFEKGRVVFRKEEKGNALLTEALLRDIDQSIRSLKYKVITLKEQPVEPEVLLAKANGIEELIGQGVSNYSHSIPGRIHNVILAASKFNGVLIPKNSELSFNETIGDISAQTGYQPAYIIKGGKTVLGDGGGVCQVSTTFFRAALNAGLPILEQHPHAYRVSYYEPGLDATVFAPSVDLKIQNNTPASILIQTEIDEEKLTFKLYGKKDDRKRGIVKQVDFPAWGGKATFTYKVSRKNEVLFDKKFFSSYKPWQ. 464
124 0.000e+00UniRef50_A0A117KX96 Uncharacterized protein n=1 Tax=Clostridia bacterium 41_269 TaxID=1635275 RepID=A0A117KX96_9FIRM  ali  28  3................RKKLCILTGLLGIICLVLFY--NVKVNQNVIEKNVSIEGIYVGGLTVEEAVKRLQEQILKKKVIFKCLGREFSCFFKEAGIEVDINGAVEQALRLRKKSSSL-----LIRDGKKEYVLKLPLVLNKKTAGKYLEKIAAEINHNPVDARYFLNNGKPKVLYSSSGRRVDIEATIEYFQKILNSTDSESIPVIVDTVEPRVKTKDIKKINVLRGTYTTKFNERFSSRVNNIAAAAEAINGVVIPPGFTFSFNETVGPRTEENGYEEALVIVKNEFVEGVGGGVCQASTTLYNAALRANLDIKERYKHSKLVNYVPPGLDAAVAFGFLDLKLSNNTESYLVINAQVENNSLTINIFGEAGIWPKVKIRVEQEGKVGYRVERICTFGN-KIITREIISEDKYSAEPK 437
125 0.000e+00UniRef50_A0A017RW28 Uncharacterized protein n=2 Tax=Fervidicella TaxID=1403538 RepID=A0A017RW28_9CLOT  ali  25  1..........MKKKQFISKILIYILLTFILSGPINSMAVEEPI--VISQEIYVNNINIGGLTKDEAYQKLKEELNEKKINFELENISFSAPYSAFGVFYDIDSAIKQAQQY-----TIDRLNDNTSV-TSPYYIELPMSYNENLILDYASSVSSKYSKLPVNAKLEYVKDYVVIKKEEYGINIDEIELSTNIVLAILNL-DESVKVPYIKISPEITSEKLSKSNFKIAGFSTPLKSLDANRTNNIIIAANSINGYIIKPKETFSANKAFGARTKENGYKDAPIFVNGKVEPGLAGGICQLVTTLYNTVLYSDLQVIERKPHGKAVTYVSPGRDATISGNAIDFKFKNTTNYPIYIQTYVDKKQVTVNFYSQPSGNTKIDISSKTSTHIYSKTYKKIY-VNGKLTKTVLVSSDSY..... 405
126 0.000e+00UniRef50_A0A168L779 Uncharacterized protein n=7 Tax=Paenibacillus TaxID=44249 RepID=A0A168L779_9BACL  ali  26  2...............KKNHITLIISTALVTGSVLVGLCHLYVNQNTIPKGVQISGWSVGGMTTEAVLKDLNDKFQQTSLHISAKNQDIEWSLTEAGVRYEAD-AFQSAIMKLNKGNLLERVSYRWHFERS---FDIKPHWNSSPMKLKFNMAWEKKNFGPINATRRISNDQVVYTPEVSAFQLDWETLTNRMVSLIPQNFYRKIQLPFIIANPELSVIDLKGINRKIMEFSTSLDSSSEGRLYNVNSAAQATDGLLLKPGDVFDYGKIVALAEDKYGFQEAPVILNGKLVPGIGGGICQVSSTLYNAAIRTGMDIVERRNHSLPVRYLPKGQDATYATGSINFRFRNNTGKHLLIHVAVQGKTLTVKFFGTFPTDVTYDIESIQNGKAGYIITYQIKKVDGIVKERKRISHDTYLPQ.. 444
127 0.000e+00UniRef50_D7CK31 VanW family protein n=1 Tax=Syntrophothermus lipocalidus (strain DSM 12680 / TGB-C1) TaxID=643648 RepID=D7CK31_SYNLT  ali  29  28......................................QAVYGSDLFPPGVYIGGASVGGMDRDGAAQALDEWLEPIPVTFICGDFVYRTNLGEIGGRVETQKVVDEVSYSVGEDSPWWNRIWSQRTQQGNRTYPVPITYDRAKVTRVLESLRPQVEIQPENCQVKVNNGTLNIVKEKEGKKLDIQATLEKLPTSLNTAGF-EVPLVCKAVTPEIRAEDFQDVLE-LASYSTFYDSSNVDRSYNLTTAARALNGAMVPAGQEFSFNRRVGPRELKTGYREALVILGDQFAPGVGGGVCQVVSTLYNACLLAGLEIVERHNHSVAVSYVPVGLDATVNYGSKDFRFHNNTGGPVYLAARAGGGKMTVKIYGQDKGLAPGEKKVKQAGVRGYAVFRIFYDEAGNVVRREALGRDVYKPLSQ 437
128 0.000e+00UniRef50_A0A226BXG6 Uncharacterized protein n=1 Tax=Natranaerobius trueperi TaxID=759412 RepID=A0A226BXG6_9FIRM  ali  27  16...................................FTIDFLYFENRIYHGITIENINIGGKTVSEVEKILEE------ITVDFEGNTHSVSLEDIGINLDKSSTIKKTYEVGRTSIYPINLLQRINILFSGHNINFVFGFDEDTLENNLENLTKKMSKEPKNARFETEGKDLNIISSKPGYNTNKEKLRDTIKNEILNDELKNVFLPYRLVTPEVTTKDLKGITNNISSFCTEFDAENKDRKHNIELASDMLDQLTISPKEYFSFNDYIGDTTEEKGYKKAPIMIGGQLDYGVGGGICQVSSTLYNAFLKADIEIVERNRHQMLVDYIEPGRDATISYGSLDLVAKNDNEHHILIGSEVTNGRLCMHIFGKPIDKVAGEEKIVQSGVNGHLV-KVEKLVNGT---SKTLSIDRYEPMKE 419
129 0.000e+00UniRef50_A0A2M7U0D5 Uncharacterized protein n=3 Tax=Candidatus Roizmanbacteria TaxID=1752723 RepID=A0A2M7U0D5_9BACT  ali  25  59..............................................IYPHTYIDGIDMGNKSKTEALKLLKDYFARAMIEVLYKDQIATFSGEQLKLTRDIDSKVDQVYQIGRSENISTRIAQQLNALFHYRDFIFTIRYSESPIKEFIKIAEETYNFSPENALFSFKNGKVEFKTHKNGAEIQSEEFYIEINSAIKNQPNKQVLLKEKVVEPTITLAQANGIEELIGEGISDYSHSINSRIHNLILAASKFNGLIVQKDAIFSFNTNIGDISSSTGYQPAYIIKEGRTVLGDGGGVCQVSTTMFRAALNTGLPIIERTAHAYRVSYYEPGYDATIFTPSVDFKFKNNTPGAILIQTEVDNKILSFKFYGQSDGRPAGSVRQVDYAAWGAKAYKVFDVNNNMTI--DKTFTSSYRPW.. 475
130 0.000e+00UniRef50_E4LAL1 VanW-like protein n=2 Tax=Dialister micraerophilus TaxID=309120 RepID=E4LAL1_9FIRM  ali  29  32.............................................KVIPGMKSGKSDIGGKTEKELNIFLNDELKEKKIILIYKNIKEEIPVKDLQLKLN-EETVEKILKTGRDGNAFENWYTRWKVLLSFEDAVSDYKFNKEVLNKKIEEIIQKYSKEPRDTLVIHDDGTVTFDDGVPYLKIDKDKLTEKITFAIEHGNLDAIEIPVSEEKPSLTKDQIKNITNVIGKYTTTF-GGDYNRSRNIEIAANSINGTIIMPGESFSYNHATGSRSADNGYLSAPVIVGGKMVPGTGGGVCQVSSTLFNALLYSGLEVLERTSHFSPISYTPIGQDATVAEGYLDLKFKNNLKNAIYLYTEYSPGIISIYILGAKEDEVVKKVDTTEYGHEGYRTTQRATWNDGRV--HEDTFASDYEPVN. 431
131 0.000e+00UniRef50_A0A1G5E7F6 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Lachnospiraceae bacterium XBB2008 Tax  ali  24  2...............RINHKLITGLMITVTAGLFTCINAQAAPGSNIETGVFVDDIDISGCSRDEAEKTVKNEWRASTITITDNDYSYSFTGADVDFNWVNKNVIDEALSLGKSGDIVSRYMQLADLKREPKVYDLEYSIDNELLSSIIAACAEEYDRDAVNASMVRAAEGFSITEGQAGRAIEQDTVLAGLTDYLINEWDGTYDLTVDVLEPLGSYEELSKVTDVLGTFTTSYSTSGSSRSANIANACGLINGTTLYPGEEFSTLEKITPFSEANGYFMAGSYLNGQVVDSLGGGICQVSTTLYNAVLLSELDVTERHCHSMIIGYVKPSMDAAIAESSKNFRFVNNTEYPIYIDGHTTEKQITFTIYGVESRRVTYESEVIQSAHIGYKAWRNTYE-DGVLTSRDEVNSSTYKMSPR 443
132 0.000e+00UniRef50_UPI000B44ADB0 vancomycin resistance protein n=1 Tax=Paenibacillus donghaensis TaxID=414771 RepID=UPI000B44ADB0  ali  25  31...........................................QQLVPENTQIADWDVGGLTFTEVRSGLNQRLESLPLILQAENSELTLTLKQAGLAYEAETFL-QGLKTLEEGGLLARVQARRSF---PHSWSLGVHLDITALQGSLSPAWEETFGTPVNADRQITDDRVIYKPEQTSYEVDWLALENTLRAAVPTGRGLALEVPLVVKLPEVTLASLKGIERRIIQFSTSLGASGPGRTFNVNAAAQAVNDTILPPGAVFDYGKAIIKAQQDSGFREAPVIVNGKLQPGIGGGICQVSSTLYNAALRTGLEIVERRNHSLPVSYLPKGQDATFAEGNINFRFRNTTGKYLLIRAAVQGRTLTIKLFGTFPRNVSYSVRVLQSGKTGYVVTHLLRHVDGKLVEKSRLSRDTYYPQPR 445
133 0.000e+00UniRef50_A0A1R1APT6 Uncharacterized protein n=6 Tax=Bacillales TaxID=1385 RepID=A0A1R1APT6_9BACL  ali  25  31...........................................QKTVPDGVDAGGIVVGGMQVTDALKLLEEYLQQRTITIHADSKQWTVN--ELGYKAEF-KTIREALLKLDEGEIWDRAVYRYQF---PKQYELSQAWNSDAFDAALRKQWSWIEKSAKNAVRRITDDQVIYEPHVDAFRLDTGKLTDQVNDVIIKRENIEAELPITVIHPEVTLEKLKGIERKIISFSTDFRTSAEGRAHNVTVTAKTLNDWVLAPDEIFDYDKLITRAEELYEYREAPVILNGKLVPGIGGGICQVSSTLYNAILRAGLEIVERRNHSLPVAYLPIGQDATYAGGAINFRFKNTTGKYLIIRTSVDDRKLTIKLFGTMKENEKYDIETVESGKQGFVVYRTFT-RDGKVISRDRLSRDTYKAQP. 446
134 0.000e+00UniRef50_A0A1C5LDZ8 Uncharacterized vancomycin resistance protein n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C5LDZ8_9CLOT  ali  30  75........KQMKKFDKKSKIISAACVGVIIVGSIIASNVTSKYKALVFPGTKLYEVNISKLDKDNLNEKIKNEIGSNKIKIKAKNDTYNLEFKDLIKTYNEDKLENEVMSYGKDGNTLQQFGMI--IIGIAKNYEFDIKVNENKLNELVNKIYDENSKAPEEPKISINGDDIEITEGKKGNVVDKESLVATLKNMIENNEAKNIEVSYIEEDPKISVDDLNKVNTKISSYS-TTYGTGGGRGKNIEVATNKVDDLLLMPGEEFSYEATVGPVETSNGYTYAPVISNGTLTQGVGGGVCQVSTTIYNAQLRAGILPTERRNHSKAVSYVPRGMDATLASGSIDYKFKNTYDYPLVINTYTSGGTIHIEFWSNKDATNGLTYEAVSYASNVANTYLYGYDSNNNKVYEKHVDTSVYR.... 487
135 0.000e+00UniRef50_A0A1M6CUM3 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Parasporobacterium paucivorans DSM 15  ali  25  1..........MRKRFSRIVLLFCMVLLMSIPVLATETASEETSGGVVAPGVSMDGMDLGGLSKEELQTAVDTYVNGKTVAVKIGENETTATLQSLGYVWSNPEVVAEVLATGNTGNIIKRFKDKKDLEKTGKVFEAQFAVDEGTLAAMMASYGTQYNVAHMNPGIVKEGSGFRVVGAATGVTLDQAASAELTRKFLTEKQYNELVLVVNADAATASLEACERVGDMLGSYTTSFSVSAWARNQNIKNAARLINATVVYPGETFSANAAMSPFTTGNGYYPAGSYENGRVVDSIGGGVCQVSTTLYNAVLRAELEVVERSNHSMSVGYVPLAADAAIAGTWKDLKFRNNTDTPIYIEAIFSSGSLTFNLYGYETRDPARTIQVTASGHTGYVAWKYVY-LNGVQQSVEQVNKSSYSASP. 454
136 0.000e+00UniRef50_A0A0J6WZ10 von Willebrand factor A n=27 Tax=Firmicutes TaxID=1239 RepID=A0A0J6WZ10_9FIRM  ali  28  5..RRRYREKKVRRYRWKTVLGVIAA--FCIMGFSSFFAAQSKAAGM----VTLNGQPIKNLTADDVQRYLEKKLTDRSVKLQSQDIDASIALPQIDAKLDRERIDDGLYLVGRTGSPGQRVADVIATLRFGKEVPLAVQVDEDKLDKAVSTIYNTYNIDPENAYAVPNGDTVSVTKEKNRIVIDADALKKSIFNELQQGKTETIEVPVEKREAAVKEEDLKAVDTVLSYYTTHFSDSDQNRNENIAIAQKRLNHAFVPAQKDFSFNQYVGTRTPDKGYKEAPAYFDNKLVPASGGGVCQVSTTLFNAVLRAGLVIASRSPHFAPAGYVPVGMDATVADDSLDFAFTNPFQHPVYVYTAIGNGSITTYILGNKHDDAATTDKVDQEGYDGHDIARTVSYTDGD-HYTDTI-VSHYDP... 444
137 0.000e+00UniRef50_A0A2N2A6X6 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-9 TaxID=2013790 RepID=A0A2N2A6X6_9FIRM  ali  27  115......................................QAIVYSDTILQGVTVNGVSVGGMTMEQAKAALEQNLAQRQIQLVYDNKLYPLDLSNMPYTVNTDAVLKEAFDLVKNADYTTLMQHVEDVKTNGRELTLSVSYDLSSLNAAVAQIASQIDIPAQEAQVDKDTHKLTFKDEVVGYVVDQPALINLIADAVKTNSKNPIELPIIVTQPTLTAAMLQGQYVLRASATTDFSTSTSERKYNVRKGAGLINGSVLKPGDVFSTNDTLGVRSTGNGWKMANAYESGAVVPQAGGGVCQLSTTLYNAIVKGDLEVVYRRNHSMPVHYVKEGLDATINGNIIDFKFKNNTTSDIIIIGYTSGNKLTFEVWGTTEYDVAGETYVAVTPRKGY-VYQSYYYLAGTLVKKEKLAVSTYKA... 542
138 0.000e+00UniRef50_A0A2N2ANB1 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-8 TaxID=2013789 RepID=A0A2N2ANB1_9FIRM  ali  26  35...........................................ENVIFPGVFISGVEVGGLDKEKAVKLLEQKLKDGGIILRYGDRKWMLSYRNLGVSYNIPGTVNRALNMGRYSSSFTVSLMMFQTRYRKPDLPLEYTINESLLKKQVAGVASEIDILAQNAFITGDAGHLKFVPETIGKSFHTEGNIGRIKGALGKMQVSPVMLEVSENQPGIKLSDLKGIKESIGLGITPYRVSDKGRTANIISAVKSLDGTVIGPKAQFSFNRVIGPRETGSGYSTEPLMIDGRLSMTSSGGVCQVASTLYQALLYAGIKVEERHAHMAPPGYATSGQDAAVANGKLDLKFKNTTGYPIYVKASVKNNRVVIELLGVKTRGQTIQIITRETSKPGASVYRQFY-VDGTAAKREVVSEDDYP.... 419
139 0.000e+00UniRef50_A0A1V5Y5X1 Vancomycin B-type resistance protein VanW n=1 Tax=Firmicutes bacterium ADurb.Bin182 TaxID=1852884 RepID=A0A1V5Y5X1_9FIRM  ali  26  2.........KLRDFAKKAAIYSVLAGFLFLCGCSLISSGKKIMGEKI----SIDGIDVSLMDFDSARAELSARQKNWKCTVSLDGVTKELTGDMLPVKFNSEEVLNDALNV----------QNWQFLDAEFRRFETRMSLDTDAAAAVLKKIKEELDVPFKNATAKYNDGKFDFTGHVYGKSVSIEKIAQMINSAMLAGKNEAIEAPFEPVEPEYTEEMARTDNSLISTYTTSFAKSPKGRVFNINKAAGIIDGYILKPGEEFNMNKVLGPRTEETGWEKAPGIRYGKYEMEYGGGVCQVSSTLFNTVMMADLKITDRRPHSWPLTYVPIGRDATISTDGPNFKFVNNTDSTILISASVDNKTITMEIYGQPKDGIYIRITSESRSGKKSVTYKEYYDKNGKLIDRVVAYEDTYPA... 436
140 0.000e+00UniRef50_A0A0J1FHA2 Vancomycin B-type resistance protein VanW n=1 Tax=Peptococcaceae bacterium CEB3 TaxID=999898 RepID=A0A0J1FHA2_9FIRM  ali  27  55...........................................QGNIPAGTKVDNLDLSGSETKAAQEKLKGWAKGKNLRLVYNGTEVPVSMRSLGANLDLNKT------------------WQAVSAHPGDAISSYWTVNKGQAEKTLKKKLSRFDLPAQNASYKIAADKFIVQPGVPGRTVDTQALIGRINGHWQDIDNKEIEIPMTTVAPKVSTESVQAFNSVIGEFTTKYAVAEKDRSGNLQRAAAALDKKIVLPGQTFSFNDTVGPRTESTGYKDAYVIVDNKYVEGVGGGVCQVSSTLYNAALLADLKIAARTPHAMAITYVPLGQDATVDYNNVDFKFQNNTDGLLYIRSQTKPGLLTIRIYGKQTGKPSGATAQEQAGNKGYTVWRVVKDAQGKVTE-EYLGQDVYAPTNQ 444
141 0.000e+00UniRef50_A0A2M7KNB3 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 TaxID=1973912 RepID=A0A2M7KNB3_9BACT  ali  23  60........SRVRASAWLRFAG-GMAVGGALGLGVFFSPLVLTPKDRLLPNVRIQGLEVGGCESKAVHTYLAECLTPAKLWLATPERTWTFPLAEVGGTVLLEEAVDNALALRNRGPLPDRAKRSWDTILHGCNLPVPVSWDRAKLRGQVRKVAWVTGKPVVNAALRRENGAFLVTPSRMGQQMDLEVTLERLTRDYR-VDNRRLEAVYKPLLPRVQEADLRCDLSPLAEFTTRFPAHKQNRTTNLSLALSRLRGAVVLPGEVFSFNHEVGERTHKGGYRIADIFANHEIVPGIGGGVCQVSTTLYGAVRRAKLKVVERHRHSLPVPYVPLGQDATVAYPRRDLKFLNNTPNALYVEGWVVGSALTVQLWGN................................................ 420
142 0.000e+00UniRef50_UPI000DCE90F0 hypothetical protein n=1 Tax=Paenibacillus sp. YN15 TaxID=1742774 RepID=UPI000DCE90F0  ali  24  33...........................................DSRMPDGLAFGGIPVGGLPLDQAEQLLDARLKQAGWRLRFASEEQTAVFGSTGLRWDASAP-RQALARLKEGSPFLRAWRKWQLR--KTDLPVGILYDEGAYAGFVKQTWAELNKQPTAAKRMITGDQVEIIPDIPVYRVDEKKLLDSLEQEAAKADPVVMTVPLSEVRAEVTYDSLQGIERKISEFATTILPGGEGRLHNIVSAAKTIHDRVLAPGDIFDYAPVIEETKSRFGFQEAPVIYNGKLVPGVGGGICQVSSTLYNAVLRAGLEIVERRNHSLPVSYVPLGQDATFSEGYINFRFRNNTDAHLLIRTFTESNKLTVKLFGRNPALRTGQREVLQKGKPGYVVYRT-KRENGTILSRELISRDRYQPQP. 453
143 0.000e+00UniRef50_A0A143XKB2 Vancomycin B-type resistance protein VanW n=1 Tax=Clostridiales bacterium CHKCI001 TaxID=1780378 RepID=A0A143XKB2_9FIRM  ali  25  1..........MKRYQWKKWLIGVAVSVMAVGSLVYASSEEAQSSETIPEGISIGQIDLKGMTVADAKNKLADQLLNRDVTVDMNGKEYKTTSKEIGVTWANPQVVDEAFSHMTKGNFVKRYKNQIDLKTEPVALNIQLNVNEQAVTNYAQSLVDACTVQVVEPSVTRSNGKFQVVEGKNGAAFNVEEIKTALLTPLTNTDAISIKPTVTETKPQNDPDIFSHFSEPLGSCTTKFNTSEANRCDNIELSANNMNGHVFMPGEEISTLAMFGEVTEANGYKSAGTYSNGKVVDGIGGGICQTTTTLYDAVLAAELEVVYRRNHSMLVDYVDPAKDATVDYSGSDFKFKNNTDYPIYIESYRKDNTITVNIYGTETRPANRKVEYVSK.................................. 402
144 0.000e+00UniRef50_A0A0F2PPY2 Uncharacterized protein n=2 Tax=Peptococcaceae TaxID=186807 RepID=A0A0F2PPY2_9FIRM  ali  29  38.................................................GVRLGGISLEGMTPWQARSYLHGVIPPADLKLVAGGRVWEIAYKDINAGYKLDEALKRAFAVGHTGSALKRFTEIVRAGGNSMDFPLPLHFDQELLIEKLNNINYEFRCQPKDAKLHWRDGKVEIIPSVKGYEIDVEGTLAKLAGSLQSGE--SMPMVVKIVNPAISEKDLYGIDNLIGYYNTEFDPKRLDRTYNIVLAGRALDGVLLKPGEEFSFNGVVGSIDRENGYKKATVIIGNKLMDDYGGGVCQVTTTLYNAGLLAGVEVLEHHNHSIPVSYAKPGLDATIAEGAKDFRFRNSSNHAQYISCGVDTVKGHVEVW.................................................. 364
145 0.000e+00UniRef50_A0A2G9Y7M1 Uncharacterized protein n=19 Tax=Candidatus Roizmanbacteria TaxID=1752723 RepID=A0A2G9Y7M1_9BACT  ali  24  37.....................................NYEQSFNNKIFSGVYIDKTEAGNKTKAEIINDFSKKLKNKNITILFNEAIATFSAETLNLKYDGETASVRAYLIGRSSNKLSAYLQIINLGWQKYYFDSEIEYDKSVVKDLINSAEEKYNQPAKNALFKFESGKVSFHKEKPGLKINSEELLSNFDKTIKQSTDKIIVLTSTIIQPEITLSQINGIEEELAVGKSNFSHSIATRVDNIILASSKFNGVLIPPKRIFSFNETVGDISSLTGYQPAYIIKEGKTVLGDGGGVCQVSTTLFRAALNAGLPIVERHAHAYRVSYYEPGFDATVFAPSVDLKIKNDTGNYILIQTEVDNNLLFFKLYGKKDNRKRGVTKQIDFPAWGGKASFNYKYKDDQLIIDEKYYSS-YKPWQ. 462
146 0.000e+00UniRef50_UPI00083020A2 hypothetical protein n=1 Tax=Clostridium nigeriense TaxID=1805470 RepID=UPI00083020A2  ali  29  49..........................................YANKVYPGVFIFDKDVSGLTKEELHNVLEENISSRKIDISINDKKFEESYSNFDITIDYESFENELLSYGKDRGFFEKLNIIK--EPENKTYEFNVIYSDEKVISFLDSINEEVLVNPIDATVNIYGGSISVIPGEIGYELNKEDLKTKIENVLLDVKGEEIVAELNEVQPYITAEALQSVDTKISSYTTHFPAGPSG--TNIIRGAGMIGSRVLMPGDEFSTVEAIGPTTADYGFVSANTYLNGKVVPGFGGGVCQISSTIYNAELRAGIIPTYRMNHEMTVSYVPQGLDATIGDEWPDLIFENPYDYPIVVNVYAGNGSITAEFWSNSQAKGGITYEPKQTGALSADTYLYGYNSAGECISEVYLDSSVYKP... 426
147 0.000e+00UniRef50_A0A068NTB7 VanW family protein n=1 Tax=Fimbriimonas ginsengisoli Gsoil 348 TaxID=661478 RepID=A0A068NTB7_9BACT  ali  27  4.....................LVFGLVLAIGGTTSVLCTAARHEDTIRPNTKVGPVDVGGMTPEEASRTLRIWWEGEKLTLKMPNGKTKLPPGELGLTLDDVASVKSLPLQ----SFLGDAKAVVKSDFTPEQHAPIFKSTGESLDAVAKVVRQSVG-PNRPASVHWVKGAVVRHPEVAGVALDTNALPARVAAAVMG--DHTVEIPLTEGAKHIPDAELSKIKEVVSEFSTRFSARNRPRSSNIRLAASKIDGVVLMPGETFSFNSVVGRRTLRAGFKLAGVYKNGQHDTGIGGGICQVSTTLFNSALFANLAIQRRSNHSLPVPYVPLGRDATVDYGNLDLEFKNTYQSPIALSALYVPGRLTFRVLGTKQPGVSVKVRVVKPGSTGVTTYRCVYE-NGKLVRRERIGFSRY..... 423
148 0.000e+00UniRef50_A0A154BTI3 Uncharacterized protein n=1 Tax=Anaerosporomusa subterranea TaxID=1794912 RepID=A0A154BTI3_9FIRM  ali  28  23.................................IIAVDTALSHDQHIFPAVRVGETDISGLTIEDARTALSNSINSTSLLITVEDKQWWIESKDIDLAFDEIGTAQVAYLQPRQGNLFHRFFALHSI----HDVKPVLFFNEAKLATLLENLAKEFYIAAKPASIRHENDDFVIIPGSKGRELDVNSL-QAVKNAIFNSQP-AVSLTTRDVVPAVSEEDLRHINYVLGEYRTEFNSAETARNQNIYLAANSLDATLLRPGQTLSFNASVGPRTEQRGYRKAPAYVNEELADDWGGGICQVSSTLYNAALLADLTIIERSPHFRPAGYVPIGLDATIDFDSLDLKIKNPLPDSVYISIETKTNELIVKVLGKSPDKPMVRIVTTQVGQKGFHVTARIRSVKGQELNREPLADDTYNPVNK 434
149 0.000e+00UniRef50_A0A2V5JWM4 Uncharacterized protein n=1 Tax=Paenibacillus sp. DXL2 TaxID=2211139 RepID=A0A2V5JWM4_9BACL  ali  25  34...............................................PAGVRLGDWQVGGMRAEEAKLALEDRLSNQKVSLGAADNRTEFTMERLGLSSNGEQLSTFLDSFAKEGSRLDRARRRWQLRHAA--LPLELTVSEEKLRQTLEAAWPGLMKPVKNARVVTADDRIEYKPEVRARTADTAVLAGLLVESARDVWDGKLDVPLRDVLPEMTLDRLKGVDRKIAEFTTTSHGSAPGRVHNIQATASTIHDMLLAPGAKFDYGTVIRETERKHGYREAPVIYNGKLVQGIGGGICQVSTTLYNAVLRAGLTVNERRNHSLPVSYVALGQDATFANGYINFVFTNNSGHHLLIRTETNESSVTVKLFGRMPESVTYEVESNQPGKPGYVVTYRIRKENGAVVGRERVSTDTYQPQP. 452
150 0.000e+00UniRef50_A0A1X6W077 Uncharacterized vancomycin resistance protein n=1 Tax=Chlamydia abortus TaxID=83555 RepID=A0A1X6W077_CHLAO  ali  23  31...........................................QNRFPRGMSLHGWSIAGSTVAKLEQA-AREFSQTKIALTSDRPEATLTMEQLGIRIDMDPFFT-VLQQLRSGNRFEQVRNRWRL--SGSSLKLTLFFNDNAMHNMLKSVWSDMYQTPQDARMITEDDRIEIIPEQTAYRIDEQELKRRIMEWFDKEWNGSIHLPLLAENPQVTAADLNGIDRKFSEFTTVFMTNEEGRMHNIQSAARIMDNMLLGPQEVFDYGQIVHRAETEFGFKEAPVIVNGQLVTGIGGGICQVSSTLYNAALRGGLEIVERRNHTLPVSYVELGQDATYADGYINFKFRNNTGHHLLIKTTLIENRLTIKLFGHTPSHITYDVESVQKGKPGYETYRH-KIENGQRTDSQLISKDTYAAQP. 444
151 0.000e+00UniRef50_UPI000B49B882 vanomycin resistance protein VanB n=1 Tax=Desulfosporosinus sp. FKB TaxID=1969835 RepID=UPI000B49B882  ali  26  47...........................................TGQIAKGIALE-IPLGQLSFADAKFKLEQKLYERPLQLTAGEKTFSLTMKELGFTYSYEEPLQQAYLIGREGNIFNKAAAKLRASW-GIAFTPDYKWNNQTLSGILTQHLSSLNSPAENAHFIFNDNSMQIVAEKAEKQVDVESLITSIKR-VPFEDIAQIPIPFKSIKPGITQKDLEKVKSLISEYSTIFDLNQKERTINLKLAAKAIDGLVLKPGETFSFNQTVGPRTVKAGYQEAMIIEGNSFVPGLGGGVCQVSSTLYNAVHLASVTVVERSRHSLPVTYVPPGQDATVAYPDLDFKFRNDSGDFILIRSDINGHSLSFKLYGK................................................ 379
152 0.000e+00UniRef50_A0A1H3ZBK0 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=6 Tax=Selenomonas TaxID=970 RepID=A0A1H3ZBK  ali  31  35..........................................NQNKIIMGVQAHGTTIAGMSKSEAHKYFASKLQRKAAVLTYKERNFQIDPADINLHGNVDEAVEAAYSIGRKGTAVENLISQMWCAIFGATVTMDASFDEQLLQNKLLQIKSAIDTPPINGTVTLQNGSIQKTSAVTGLTLDIAPLAEEMTPDFKSLNTVRKELVPAEQPPFVQNSDLAAIDGVLGSYTTSFYPGD--RGDNIGLAASHLQGALIRSGSTLSFNSIVGPRTYEAGYKNAGVIVYGQHAIDVGGGVCQVSSTLYNAILLAGLTPVERTGHFASSAYVPAGRDATVADGLIDFVFRNPLPHPVYLTIANSGNALTIYVLGTKADLGGKSIALVTEGSTRPSLYRLW-LQNGEVVDREYLHTDAYEP... 412
153 0.000e+00UniRef50_A0A1T4VY78 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Eubacterium uniforme TaxID=39495 RepI  ali  26  1..........MKFNRKHIACLFAMASVFCVFSSKTYANE----SQKALKGVYIENIDIANMTEADAKRAVKESISDQKVTLAIGSEKVSVQASELGYKWANKEVVDDAVSYGQSGNIVARYKANKDLEHGNKVYSVEMEVKKNMLESGLEKVIEEFGSTAKNASLELTDNGFKVIPEKNGYVIDKDEASKVLYDYMKEDWATDVKLPTTEEKAQVTSEDCEKVDEPLGSYTTTFSVSTENRNKNIENGCKKLDGLVLYPGDEISCNEMFLPFTAENGYYEAGAFINGEVSTDIGGGICQVSTTLYNALLRAEVEITERLNHSMTVNYVPLAADAAITGDYKDLKFKNDTDAPLYIEGIFSGGSIKFNVYGHETRKPEGYEEIVTAGYTGYVAWKYVF-IDGQLEDKILINTSTYKATP. 443
154 0.000e+00UniRef50_A0A2C6MCV8 Vanomycin resistance protein VanB n=4 Tax=Desulfotomaculum TaxID=1562 RepID=A0A2C6MCV8_9FIRM  ali  30  80................................................................................LTYQDKSWSMPLKELGFTVNVEDVLDQALR-----NDVNALFKRVQTYFHPVEITLSIGLNKEKLASALSPVAQAIERPASDAKLVVEDGQVIMVPDQRGLKVNLDQVYAGLLNTDIHQATIQLDLKVDEIKAGKTLADIENINGKIGEYTTHFDAKNINRTINIRTAANRINGVILAPGQEFSFNKTVGERTGKAGYRPAAVIVANKFEEALGGGICQVSTTLYNAALLANLTSVERHNHSLAIGYVPLGRDAAVAWNQLDFKFKNTLPGHVYLRTVVGQGFITIQVYGTVRSWVTETIEPDQPAYAGFKAERIIKE-NGIVVKREALPDSYYYPRPK 445
155 0.000e+00UniRef50_A0A0G4DAL6 Uncharacterized protein n=15 Tax=Bacillus TaxID=55087 RepID=A0A0G4DAL6_BACTO  ali  27  4MSKKFFNIIKKKIIRTKCLIFIFTILLVILISFKVMYHITSVNEETVLPKTYIESVDVGGLNRKQLESMNQEQINNKELTFLLGKTRKTYTYQEMGIKYNPTLVIDKIFQQNRNKRILWLKQLTAEIGLQKSKYRLEPKFDDNKLKHIIENEFTKFQEEPINAFIKVSNSEISYIDEKPGKKVDLNMLKKDILDAVNKEANI-VKVRYENVHPDISIRDLKKIKTPMSEYKTDLLGQNENVRKNIEKAALKLNGVIIPSNKEFSFNAVVGITDQAHGYKSAPVIVHDKIIQAAGGGVCQVSSTLYNAVLLANLDIVYRVNHSHQVRYVPAGLDATVADYGPDFKFKNNTDTPIYIKTIINNNQLTVKLLGKNSDNIVYTKIMEQTNSLKVNTYREVKNK--KVISFEVISASTYK.... 430
156 0.000e+00UniRef50_F9N5L1 VanW-like protein n=2 Tax=Veillonella TaxID=29465 RepID=F9N5L1_9FIRM  ali  27  29............................................NTIY-GLTIDGHSISHQSMDEVDTYLQERTQSQRIRIVDKGKETTVNLTDLGVTIDRVGTLTDVMDYGYESDVMTYVMHRVDALLHGKAMNIRYKVDGPMAESYFMNYAKAMGQVGANATVTLEGNTVVHQPAKVGRKLDVTATMKRLQEQLQEGKVETLELVINESQPTITDKDLVSITSILGSFTTYFDGSNTSRAHNIHLASQKIHQTLIPAGGIFSFNQVVGERTAEAGYDDAPVFMGGRLVPGIGGGICQVSSTLFNTALLSGMDIVERDTHFAPVSYIPVGLDATVAWGYIDFQFKNPYSHPIYVIAEEGAGYVTITILGAKEDVPVKEETVEEAGHEGVSVTRTIVYGDGR--SSTYTFNSYYEPVD. 428
157 0.000e+00UniRef50_A0A1Q5XVR4 Uncharacterized protein n=5 Tax=Paenibacillus TaxID=44249 RepID=A0A1Q5XVR4_9BACL  ali  24  2...............KIIHAALSTAIGLLLAGSLIAGGLHLYNQHTLPPKTLLAGWDVGGKEIGEVRTGLAARLKALPLVLKAQNAELPVTLQRAGITYEAEDFL-HGLDTLTGGGLLDRVRARWGFSRS---WELRVHLDLAELQKSLSPAWKETFGVPVNAERRITDDRVVYTPEKTSYEVDWHALELTLQAAVPTGKQILLEVPLTTQQPEVTLRALKGIERKISQFSTSLGASGPGRTFNVEAAAQAVNGTLLPPGAVFDYGKAIQKAQAETGFREAPVIVNGRLQPGTGGGICQVSSTLYNAALRSGLEIVERRNHSLPVGYLPKGQDATFSEGNINFRFRNNTGKYLMIHAAVQGRALTVKLFGTDPSLPRGGTRVLQNGKTGYIVETHITRVDGKAVEKRLLSRDTYYAQKR 445
158 0.000e+00UniRef50_R5T2J8 VanW like protein n=2 Tax=Dialister TaxID=39948 RepID=R5T2J8_9FIRM  ali  29  29...........................................KDTVIPGVRLNGTAVGGMGKEEFFREKNEELAAKKLALNHGAVHEEWSYKDLNVHFDKSRA-DELLRLGKTGNLLSDWITRWKAVIYGDVVGVVPLYDREALCTKVDELAVKYGQTPKEAMVIKDDGTVEFTEGVPYLVFDQPKLVEIVGNALVSEDTDAVEIPVTEEKPMLTKERLKNFNTVLGVYTTNF-GESPNRSRNIELAAEAIRGSVVDPGTVFSYNDATGERSPDKGYLEAPVIVNGKPQPGYGGGVCQVSTTLFNAVLLSGMEVTERSPHFSPASYVPIGQDATVSYGDLDFQFINNFKNPVYVYTKYEPGAVTCWIIGAREDKPEEEEKTVEYGHEGYNAEQYARWADGRVYERS--FPSYYDPVD. 430
159 0.000e+00UniRef50_A0A2H5ZSS0 Vancomycin B-type resistance protein VanW n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H5ZSS0_9BACT  ali  25  26..........................................HAGRILPGVWVGGLAAGGLRPGELEARLRREQLDRELVVRAGPYRWRVRTRDAGLRVDVGAAVRRAYQLGRHPNLLERAWERWRLWTGPVKVEVPWRVDHGRLRAFVRRVSRTVHVPPKEGRLVVVSGRVEVVPGQVGAALDEAHAVHALRTALLS-FSREVELRVKVLQPVWTAERLRGISGRVASFSTRVSP-DPDRTHNIALAASRLRGVLLPTGSELSFNEVVGPRTKEAGFRDAPVLVEDELVPGDGGGVCQVSSTLFNAALLADLAVTRRANHTQPVPYVPLGRDATVVYGSLDLRVRNEGP-PVLLWSELAGDRLVVSFYGRPRPQRRIRVLVERPARPGYRATREVWEA-GVLVRREVVARSVYRPVPR 431
160 0.000e+00UniRef50_R5X5B0 VanW-like protein n=19 Tax=root TaxID=1 RepID=R5X5B0_9CLOT  ali  40  29...........................................QEKIYKNIYIEDIDMSNMTKKECIDILKEAYPLEDINLKYEGKTWTIHPKDIDFRYKIEEATDIAMKYTKTSKRLENLKRKSKLLNERHHIPLDEEYDKEKLSAIIDCIANQIDREYVNATLAIEDGTFKRLPSXXXXXXXXXXXXXXXXXXXXXKNITDLNIPVKTTLPTLNSDDVQSVNSILGQFSTAFN-NHTSRGSNIHTAGESSGDIILMPQEIYSYNKATGPRVLSKGYKYAPVIIGGKYRNGEGGGVCQVSTTIYNAALLAGLEIVEVHNHTYISHYVSGGRDATVAYGYYDLKFKNPYSHPIYIKNIVGDGAITTKIYGCKDDIKRIYVRTEKKQKIIVKTYRVYLDQNNQKIKEELISTNKYD.... 404
161 0.000e+00UniRef50_A0A2N3ANQ8 Uncharacterized protein n=2 Tax=unclassified Atribacteria TaxID=1047049 RepID=A0A2N3ANQ8_9BACT  ali  30  36........................................YKNRNKILPGVSAFGVELEGLKKEDAREILQSKMIDSPRILVFEDKEFKIPHKELGAFIDLNRVVEETYSIARTGNIFRRLKDRIVVWRKGYEVSFQAEFNPQKFEDFQNKISSLINRMPRDAYV--EDNR--IIESKIGVKLNLERFKEEINKILINLDKEKLNIPVTTVDPKITTQNILAINGELGTYSTSIENKEENTIYNIRLSSEVINGILVKPQEIFSFNKYVGPAEKADGYKESTIIANGVFVNGYGGGICQVSSTLYNASLLANLPIVERYNHSVYTKYVPLGQDAAIFYGFKDLRFKNNSDHAIVIFSKVFRDTLQVSIFGGNEDKAEVEIISVQEGVPGYKTYRIVR-KDGEE-KIEFLAEDTYKSVP. 446
162 0.000e+00UniRef50_A0A198A046 Uncharacterized protein n=9 Tax=Paenibacillus TaxID=44249 RepID=A0A198A046_9BACL  ali  26  1..........MTRSFRNPILYFSVALGVFVTCGT--ALYLYGSQSTFSKNVTIAGWRVGGMSYAESEQRLK-RLAAFPVLLSYPEITAELPLGQLGISYD-KGPLTQSLQQLTNGSPFARAKARWTLRN--ANIPMNVSVDPTQLTTTIKNTWKELYKQPIAARILQSQDQVAYEPEQNVLRIDTVHLQEQLQSIAPSMGTLTLSLPVYELSPSVTMATLKGIDGKISEFTTSFPPSGEGRVHNIRATATSIQDYLMAPGDTFDYSKIIAQTEAKFGYKEAPVILNGSLVPGIGGGICQVSTTLYNAVLRSGLEIVERRNHSLPVSYAPLGQDATFASGYINFKFRNNTTSYVWIRTITTDSKVTVKLFGHQTPTVTYIVETIQPGKVGYKVYRT-KRENGTIVSRELISKDQYSPVP. 445
163 0.000e+00UniRef50_G9XAB2 Uncharacterized protein n=4 Tax=Peptoanaerobacter stomatis TaxID=796937 RepID=G9XAB2_9FIRM  ali  31  31...........................................KDTIYENVYINKINVQGMTKSEAYDTISKNCDFGTLSLIYNNKKWQTDLKDAGFNYEVQDAVDKAIAIGRNQDTFKNIWKIINLASDKEYINLDYTHNYKKIEEFCNKVGEELNSDPIEASISIENDKITITAGRDGKKLISTKIINELKEKIENDNEKDIDIPFDTKSPKLKYKELSQINGVISSFQTDYRTSGRSRAWNVELSASKIDNQLLMPGEEVSFLQKIGKITYSAGFRPAPVIVNNEYKNGIGGGVCQVSTTLYNALLEGNVEIKERSNHTFPAKYVPIGRDATVGDTSPDLKYKNNYLFPIFIKTYAQNGILTVKVYGDTTKAKKVQIYSERTSYYPYTIYKKIVESYGQLDKKIIISKDRYSAKPK 431
164 0.000e+00UniRef50_A0A1G5VJW2 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Allisonella histaminiformans TaxID=20  ali  28  62...........................................TDRAIPGVSYNGVRVSGMTREELGQVIERQAQSVPIQLHYKEVKENIDLRPLSVHLNKTGEEDRILGKGREAGLVDNWKIFWKSFINGLMVPARYSFNEQFLEQQIAGIVKKYGEPTEEAKPHISNGTVTFGQGRPYLQIDREKLSGMLVGEISSGSHKDMELPVDEDGAFLDTEKAARINHVLASYTTTFAL-NPNRSNNIRLAAESINGEYIPPGQTFSFNRATGKRIAERGYKEAPVLIAGKLVPGAGGGVCQVSTTLFNAVLLSGLKVRSRSNHFSPVHYVPLGRDATVADGIIDFRFINSLPHPVYIYAKYEPGRLTVYLLGNELDTPSGTVETVEKGHDGYRVTRKVEWPDGRTL--TDSFRSEYKAVP. 464
165 0.000e+00UniRef50_A0A1M5Z198 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=3 Tax=Desulfosporosinus TaxID=79206 RepID=A  ali  26  2.........KIKYIEKVRIRGPFFAGVLFLLILINGCNSSNLVPDKISDGTKIDDLDLSGTPLPEASVKIENWAKDKTRVLLYNDTEIPVTLSDIGIEVDTQKIIEK------------------TQISPGTALSSVLKVDSLIASQELREKLKKFNRPAKDASYKIEKDAVVIQPGESGRTVDVESLINQIQEAPLSDVPARIVIPMVEVPPAVTTESVKAFDAVIGEFSTNFSVKEKNRSANLTAAAKALDGKALLPGETLSFNEKVGPREPETGYKEAYIIVNGEYVQGTGGGVCQVSSTLYNAVLLSDLEIVERKPHAVVVSYVPSGQDATVNYPNIDFKFKNNTGSLVYLRTEVKPGVLTVRIMGKKTDKTVGQVIREQAGSKGVNTWQIIRDGTGSETKK-FLGRDWYAPTNR 440
166 0.000e+00UniRef50_E0NLZ7 VanW-like protein n=4 Tax=Peptoniphilus TaxID=162289 RepID=E0NLZ7_9FIRM  ali  30  30........................................VKDSGKIYSGVKVDSINVSGLTCEEAEKLVTEKTKSKKIEFKLGDLTYSRTLGELGFDKEIKDAIKEAFYVGRSENKIANFFRIISLPIANKNIESKTIISDEKVQESINYLVDKVYIKSENAKVENIDGKFVKSKEVVGRYLDASNLKEEIKNSI--GKVDTVEIKALPILPEVKSEFFDGIDAVLGSFITDFHRSEDNRKFNIELGASKISNIFVAPEQEISFNDTIGEMNEAGGFKAAGVIVNGEFDRGWGGGICQVSTTLYNALVRSDIEILERSNHSRPIGYVERGADAAVAPGYKDLKFKNNLKHKIYIDSKIVDDKIEFIIYGNSSDKPEGEVQVESQGNKGYDSSFKEYKKNGEVVKVEKYLSSHYIPKNR 436
167 0.000e+00UniRef50_UPI0004B3C799 hypothetical protein n=1 Tax=Eubacterium xylanophilum TaxID=39497 RepID=UPI0004B3C799  ali  28  34...........................................ADRITKGVRIETIDVGGMTGSEASAAVQSLLLEKKIEVDINGKSVVSNLGEIGYAYSVDKAIGEALKVGKRGGIAENYGEIKKAAAGEISYGFEVEFDKDVLTDFVKTECRKLCTKAKNASIKRKNGQFVYTNSRPGVKMEMESTVELIATKVNEEKSGDGLIKVVVPVEKYSKKLVKRCKDKIGSFSTEYNPGNVNRSKNLANAAKLINGSVIYPGKVFSVYKTIGPITKKNGYFEAASYNNGKVEETAGGGVCQVSTTLYNAVLRAELEIVSRSPHSMVVSYVQPSMDAAMAGDYKDFKFKNNTDVPLYIEGSVYNGTIYFNIYGEETRPEGRTIRVTQEAHKGCKAWKIVTE-NGKE-SKVQVNSSNYAASPR 444
168 0.000e+00UniRef50_UPI0009FCD7E4 hypothetical protein n=1 Tax=Clostridium tunisiense TaxID=219748 RepID=UPI0009FCD7E4  ali  25  34........................................KKYENLIYPGVYVNNISIGGXXXXXXXXXXXXXXXXXKVVIKVEELIYETNYKEFNINYDIESEINSAFSYGKNLNFFQKHKLIKWPKSITQQIMLK--VDEVAFNNAIEKLRKKVEKKSVDAKVQKIEGGFNITPEVIGRKLNTYGIMKELILQINKNTQETIMVVIEEDIPKIREKELKAIDTKISSFSTSFYNSSKSRVNNIKIATETINGTLLMPGDTFSFNKIVGKTTVDKGYESAKVILGNDFAEDIGGGICQVSTTLYNTVIRSELTVVERKNHSLPIAYVPLGQDAMIYYGYSDLRFMNDTDFPVYIEGIVNNSVVSFNFYSNDESLTNGEMIVEKEGKASYVVYRT-TYVGGKMLKKELVSTSKYKGRDK 443
169 0.000e+00UniRef50_A0A0U5P0T5 Vancomycin B-type resistance protein VanW n=64 Tax=Bacteria TaxID=2 RepID=A0A0U5P0T5_9CLOT  ali  27  30............................................DTLPDGIYVGEYNLGGMTEEEASQKIQNEMENQKITLIVDGQPVETQAKNLGFHWSNPEAVSQAASSWQGGNLIKRYLNKKDIEQNHVIIPLETALDDGSVAAFVADKCAQAVMEPKNATIVRGKGEFIVTPSAIGKTVDVAATKQALDAALANGEPVTATAVVLEVKPAITTDDLITIKDVLGTFSTSFSSSGASRSKNLQVGAGKINGHVLMPGETLSGYECMHPFTVENGYATASAYENGQVVDSIGGGVCQIATTLYNAVLRAELEVAQRQNHSMIVGYVKPSEDAAIAGTYKDIKFTNNYSTPLYVEGYTSGKTLTFTIYGKETRPANRTFDQVQSAHKGMKSWKVVY-VDGVEQSREILHTDTYNP... 435
170 0.000e+00UniRef50_A0A1H0NM32 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Clostridium gasigenes TaxID=94869 Rep  ali  27  90........................................KSFSNTVYPESYVLDKDLSGLTKDTLHTTLETELGNTKIKVNIGKKIFETTYKDIDVTIPYDEFEKKIFDYGKDQSFFTKINLIK--KPVKKDYEFEFAYSEEKFNNFLATIAADVNVAPVNSTININGGNISITESNGGYVLNSEELLANLKVAMKDISHK-VELTLDTVEESIKKETLQGVQSRISTFTTTYKTGPS--SVNLELATRNIDNILLMPGESFSCEQGIGPTTPENGFVLANTYVGGQIVKGYGGGVCQVSSTLYNTMLRGGIIPFERQNHMMPVSYVPMGLDSTLADGFIDLKFKNDYSYPIVINSSASNGSLTIEFWSNDSVLKRYEPKSVQKNSLSADAYLYSYDANGTMVSEQFLDTSTYKPFP. 471
171 0.000e+00UniRef50_A0A2M7A415 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28 TaxID=1973917 RepID=A0A2M7A415_9BACT  ali  24  2.......WKRVTGGVFWGRAGWVLCALVVVAGACLGPPAWWLRQGRICPNTHIETVDVGGLDQASALNRLEEGLLIPKLRLLSVQRSWYLSVQHCGGAPRFEEAVGEAFDVGRGGNPFAGAFNTWKTWYSGKYLSLPFEFDQTQLRKTLRPIAWSVNRPAQNASIQLVNGYVYAREGKWGYRFDPDITVARIVDKF-GINASSVSAAITPMPPNATAADVRSINAVIAKYSTRFNPRLQNRTRNIRVACAEMNGRILAPGEVFSFNAMTGERTYAKGYRMAKIFDRREIVDGLAGGVCQVSTTLYNCARKLKLPIVERHHHSLPVPYIRGGLDATVSYPYRDLKFRNALPASVALWTELKGNQLTIYILG................................................. 363
172 0.000e+00UniRef50_UPI0008377C07 hypothetical protein n=1 Tax=Christensenella sp. AF73-05CM02 TaxID=1851429 RepID=UPI0008377C07  ali  28  40..........................................HVNTFYDGVSVDGIVIGGMTYDEAKNALEELLMDARITVSYDDQKTTMDAEELGISTNLDSILKNAFTEGAQAKPLDQKYDDIIEMTEGKDFSIQLELDDTKLHNTVKKYSDDTQLRAKEATAKFDKDKFIYTQSENGRKIDAESLYEQLKQKIAEEDFSDISVLGKVVLPEVSTDELKENTALIGSCNTKITA-NENRNTNIRLMCEAVDGLKLDPGQTLSINDLVGERTAEKGFKSAPAIMDGKLVDDMGGGICQLSGTLYNAALKANMEIVERVHHTWPSTYLPIGLDATLNWDDKDLKIKNTSEWPIYISAELVSGECVVKIYGQPDDLPNGERQVKVTARKSYKVYRDYYEND-KLIKSELISDDY...... 444
173 0.000e+00UniRef50_A0A1Y4EWE9 Uncharacterized protein n=3 Tax=Clostridia TaxID=186801 RepID=A0A1Y4EWE9_9FIRM  ali  29  72.............................................TFPKGIVVEGIDLEGMTLEEATAAVKASLSTCNITLTSGDKSWTLTNSNFTYTYNTDEVLQEAFEYGKQ----ADEDLLSSLETQPKTYEITATPDTTNLKETLTTLTQEVNQAAKDATFDAASETFTFEEGQNGVTVNIDELTQQVEALLQEGGTGTVEVPVTETAYQVSTADLKANMKKLGTYSTV-STNTSNGNTNMRLALEAVNGTCIPAGGTFDYWQVVGNTTPEKGYKQANAIINGKFVPSYGGGVCQTSTTIYGAALRSAMEIVQRSSHSIKATYCPIGQDAAVSYPDLNFSFKNPTNYPVYISAGMSGKTLTVTMYGQSPDYDTIEIETIQPDSPKYTVYRRIYYKNGQVVKTEKLPNSYYRPAP. 474
174 0.000e+00UniRef50_A0A0B4N0X7 Putative VanW family protein n=1 Tax=uncultured bacterium Ad_125_D08 TaxID=1489285 RepID=A0A0B4N0X7_9BACT  ali  26  253.......................................QVVDRQTFYAGTTVEGVDVSRMTLSNARDRVEPRYAGRTVTLDSGE---TVTSGQLGYRSDYESVLTAAWSAGRYGSLEERYLLAAQRAQAPVAYSVRRTYDRDALDSYVQSVADALYVSASDAKFNAETYEFTFTPSREGRRLDADALKQDIARAIADG-GGSVRLSIETLQPRFSTEEVASHYGLIDYAITNASASTDARLKNIRLAMSIINGTRVAPGETFSFNETVGERTYERGFRKAPAYSAGDVTDQVGGGICQVSTTLFNAVVKADLEIVERHNHSMTVSYVDKGKDATVDWGNQDFRFKNTSSDDIYICCYTDDKRVRFGIFGVKHDTVYGETHVQQKGRDGYRAYKVRWDAEGNQLSRELLCKSVYRMRSE 665
175 0.000e+00UniRef50_E0IEA4 VanW family protein n=1 Tax=Paenibacillus curdlanolyticus YK9 TaxID=717606 RepID=E0IEA4_9BACL  ali  26  34..............................................VPQGVKAAGIPIGGMDIDEAVAALSQNWEQQQAIVKANDQDRVWTLKELGYSINVKDAVA-ALEKLHDGSIIERARYRRDFQSE---LHISFAADSTVLTNTLKKEWGWLEHSATNATRTISNDRVVYTPHQVAYRVDRDTIQAKIDQWAKNSQSKEVQLPIKTVEPEVTLEKLKGIDRMIMSFTTDFASSASGRAYNVTATAKTLNNVVLAPDEVFDYRKIVSATEKNVGYREAPVIQNGKLVPGVGGGICQVSSTLYNAVIRAGIDIVERRNHSLPVSYLPIGQDATFADGAINFRFRNSTGKHLIIRTVVENRKLTVKLFGTLPENVRYDIESVQQGKVGYETYRT-YFKDGVEVSRKRISRDTYKAQP. 453
176 0.000e+00UniRef50_A0A127EI94 von Willebrand factor A n=19 Tax=Clostridium perfringens TaxID=1502 RepID=A0A127EI94_CLOPF  ali  28  38........................................YSSKNVTYEGIYVENINVSNLNEKDLKEKLNEHLNNFKITFNYKDNNETFSAKDLGFFFDINNLSNQVFSFGKNSNIFSNTIERLNLKSNPKYFQFKPQSNSEVLSEKLSEISNKIDKEKVEPTISFSNDSISATKEQIGYKLDLEKLTSEIVNDLNNSHDSTINIPVEEIKPKLTQETVNNMV-ILGSYTTKLPSLTGGRTKNISNYLSKLNGTILMPGDIFSADKEGEDRTESNGYTYAPGYIGNKVVDILAGGICQGVTTLYNSVLYADLKIVERAPHSLPVTYAPIGRDATMASGVIDFKFQNNMNNPVIVQTYITSGQVKSNIWGIKEDPKEIVISVDQHGPKSSTTYKETYE-NGVLVKKEVLSKDKYN.... 420
177 0.000e+00UniRef50_F7V906 Uncharacterized protein n=1 Tax=Clostridium sp. (strain SY8519) TaxID=1042156 RepID=F7V906_CLOSS  ali  25  28..................................SYVHRHSGESGRLSQHVAIGRVVSAGTSEQEAERRIRDGLQEEPVTLQAGSRQIKTTAGELGLSWKNTDVVKQAVSYGKTGSLFTRFRQIRSLKDGKKTYPIVLASDPDRVERVIDRAGSRLTSKAVNYRLVEKKGRLTVAGGKKGWSVDTDGSVQAVDACFAKGWNPSIELKTVTIQPRGSREELSKIKDVLGTFSTDYSSSPSGRKANLANGAKKINGTLLEPGETFSVYAACQPFTKENGYEIAHAFENGTTVDSVGGGICQVSTTLYNAVIRAELEIVERSGHSMRVHYVDASADAAIAGTSKDMKFRNNQKNPVYISGKTDGSRITFTVYGVETRPPVGSVSLTSGGSSGATAWKVVK-VNGKVTSRTQFNSTTYRSTP. 443
178 0.000e+00UniRef50_UPI0006B52401 hypothetical protein n=1 Tax=Niameybacter massiliensis TaxID=1658108 RepID=UPI0006B52401  ali  28  46..................................................VYINDIPIGGLTPEEAKKEVTKQLENHAITLMNEDQKQTITLSQFLPETDLQTCLDQAYLVGHEGNYFERFKAARNKNSGPHHFTTKTTYDSAEIENILESKKEIFEIAPIDATMKRENRKFNFTVEEKGYTLDVIETAKIVADVLNSDDETPIQVVMKAVMPTVTKAHLAEAQTPLASFSTSYNNADLDRNENLKLASQKIN-IQLAPGEIFSLANQLEPITQAAGYRNSKVIVNGKLEEGIGGGVCQIASTLYNALLLSDVEIYSRANHSLPVAYVPLGRDATYASDIIDFKFRNNSEYPLFVEAYCENNHVIVNIFGYKGLKLEYQIETIEPPETKVKLYRLLY-RNGQLIDKQLINTSTYRAR.. 447
179 0.000e+00UniRef50_A0A134CFG2 VanW-like protein n=2 Tax=Veillonellaceae bacterium DNF00626 TaxID=1588754 RepID=A0A134CFG2_9FIRM  ali  29  1...........................MVALLVIGTTPFMWGNAEKMYPSISVESENVGGFTRDEWNQFVAQKYGEKEIVLLLGKTKDGWKLKDIHGAVDEEKT-EKIWEIGRTGDVFSDWYTRWELLIRGKDIDLPLTYDKKLLREKVNSLVEKYSQEPKDAVPVIDNGHVTFTEGVPHISLDAQKLYDTIEKALTEGKH-TIQIETTEEKPTLTVEEAKQFDTVLGVYSTAF-GGDYNRSENIRLATEAISHHVILPGERFSFNEVTGRRSPENGYLPAPVMVGSRLEPGYGGGVCQVSTTLFNAILLSGLPVTERECHYSPVSYVPTGQDATVSYGDLDLCFVNSFSHPVYVYAVYQPGQVTCYILGNETDKPSTEERIEEIGHDGYRTQRHAAWKDGR-TYTDTFS-SEYEPKD. 417
180 0.000e+00UniRef50_A0A0B3W148 Uncharacterized protein n=5 Tax=Peptostreptococcaceae TaxID=186804 RepID=A0A0B3W148_9FIRM  ali  26  114.....................IYIGIICFFLLIGIMYFGAKRYDNLVYPDITLYEEDVSRLDKNELDEKINDNINNNKIIVKVDDKEYEVLVSDIIEELDVKKVENEIMSYGKDKTFLEQFGLIY--LSVGRNYNFNIKIDKNYLQEQVKKIYADTHIAPIEPTFEMNGDNLNIIKGKNGKSIDDKKLMNDIIEKINSNEVGKTDIVIKEIKPKINDKDLKGVDYKISSATTYFGGTGYNRGLNIANATNKIDGTLLMSGDEFSYEDKVSPVELNNGYYMAPVIVNGSHKDAPGGGVCQVSTTLYNAELKAGIIPTERYNHSKSVSYVQRGLDATLATGSKNLRFKNPYDYPIYIHAYTVGGQVTVEFWSNKSDGKKYTPVSFVKGNV-ANTYLYGYNINGELIYKKFIDTSIYR.... 513
181 0.000e+00UniRef50_J7IQZ8 Putative vancomycin resistance protein n=3 Tax=Desulfosporosinus TaxID=79206 RepID=J7IQZ8_DESMD  ali  26  48...........................................RGQIVRGVELE-IPLEELTIEEARDKLEQEYYQRSVHFIADDKNFVINMKDLGFTYDYQEPLQEAYLIGREGTILDKAVSKYKASF-GIIKEPNYQWDDLILAEALTTHSSFLNMPAQDAHFLINDNSLDIIPENQGKEVDLDSLAQIVKTQALKGDN-SIVVPFKEVKPAITKKNLELVNDVISEYTTTFDQTLIERSLNIKLAAKAIDGKVLKPGEIFSFNNTVGPRTEEAGYQTSMIIEGNTFVPGLGGGVCQVSSTLYNAVCLAALSVVERSPHSLPVKYVPLGQDATVAYPNLDFKFQNLSEGYLLIRSIVNSNTLTFRIYGKPK.............................................. 382
182 0.000e+00UniRef50_A0A0C1UA87 Putative peptidoglycan binding domain protein n=2 Tax=Clostridium TaxID=1485 RepID=A0A0C1UA87_9CLOT  ali  30  37.........................................AYENIIYPGVKIEEYNVENMTKEQALAFIKEKLKNNFITLVCKGKEYNIPYNSLNINYNIEEIVEEAFRYGKDQNTRNKFLAIK--KPQEKQFTAKFTYDNKPVDEILSTIEKSLNKKAKNASITRKNGKFYITSEISKEEIEKKKIKDQIEDVIISGESYKYNIPLEIKEPKITKKKLENINQLIASAKTGYTPSTPARTKNISIATYTNNGILLMPGDEYSFNKIVGDTTADKGYLPATVIIGDKLEQGLGGGICQVSTTLHNAVLKTGIIPTERLNHNMPVGYTELGMDATVAYGTVDYKFKNTLNYPIYIEGAVTDNDVIFNIYSDSSLKEKGKEKIKNPGSTGYKVKVYRTYENGEKKDKILLNDDFYKPVKK 445
183 0.000e+00UniRef50_A0A137STR0 G5 domain protein n=1 Tax=Clostridiales bacterium KA00134 TaxID=1588750 RepID=A0A137STR0_9FIRM  ali  27  37........................................KKSGDRIFRGISVGGVDISELKKDKAREKLEEELDQKFLLFFNGDEVYKISYANLGYTINLDELIERAYAIGREGNIIKNIIKIGSLPVDRENLXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILVYENGQIKIIDSVEGRRLDLEKTRQEIIDYLS--VKKRIELPIEVEKAEVTSDDFKDINGLLGEFTTQYSKSGSGRKHNIALAASRMSNFIIKPGQEVSFNDHLGDISKETGYEDAGIIVNGEFDKGVGGGVCQVSTTFYNALLRADVKVTERSSHSLPVGYVPMGTDAAISTGYKDLKFKNNYPTNIYVLATTDGDYLNFKIFGKSDELYEGEQEVKKKGSKGYRTYKQVVKDD-KILKEEKISKSYYIPQDE 444
184 0.000e+00UniRef50_UPI0007858D9A hypothetical protein n=1 Tax=Clostridium sp. ATCC 25772 TaxID=1676991 RepID=UPI0007858D9A  ali  29  36.........................................KYESIIYPNIKIQGYDVGELTKDEAIELLDAKLEKSAITMELKGDEITIPYKDIKANYDINKVVEKAFNYGKDKNIYEKYKLIK--KPQEVNLNLSFTHDKNIVAAIINKLQENLNKESVDAKISLIDGNFIITPHINKEEIDKNTILMDIESLIISNRNAKYNIKVTEKTPNITTEKLKSIDKLIGSARTKISPGDDGRHKNIELCTNSNNDILIMDGNAYSFNELIGNTTAEKGYVSSKVIIDGKLEDGIGGGICQVSTTLHNAILNSGIIPTERKNHDMPVRYTNLGMDATIAYDYIDYKFSNTLGYPIYIQSYIENDEVVFNIYSNNSLKNRGDMKIKNPGSIGYKVYRNVYE-NSELIESKLLYDDYYKPVNK 444
185 0.000e+00UniRef50_A0A0G0XHU6 Uncharacterized protein n=5 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G0XHU6_9BACT  ali  25  30.......................................EYRYTNRVYPGVTIDMYDVSGMTSQDIQNIYQQKLSKTTLTLSAESNIATFSGTQLGISYNTDLAIKQAMATGRAGSFMSDVIFRLEFPSQKIIVKLNSTYNSEIIDETLTQFAEQVYVSPIEPQFEFNEQTLTFALGANGKALDRKNGHKMIDEAIKSGEQISLQIPINITSPKLDTDNL-GIVELLAEGISYYKGSIPGRIHNVALAASRVSGILVAPGEIFSFNEAVGDISAATGYKSAYIIKNGRTILGDGGGVCQVSTTVFRAALNAGLEIVDRTPHSYRVAYYEPGLDATVYSPSVDLKIRNNTDNYVLLQSEMDNYKLTYKIYGRKDGRNVGQINQVDWAASGAKTTFDYKTKNGEVLGA-KTFKSTFQPWQ. 461
186 0.000e+00UniRef50_A0A1H6SYL3 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=4 Tax=unclassified Lachnospiraceae TaxID=18  ali  24  1..........MKIKKILSIGFLAGAMVLTMPFALQRVYAEESASETVPDGVSVQGMDVSGMTYDEVNEVVDDYLDDVEFTLTAGDKNITVDSSDLGLTSSTD-VATKALNYGKSGNLLERYMDQKDLESGGKDFSVSLTTDTSTVKQLLSDNESELNTEASDSTLKHENGKFTYVAGTSGVTVKINKSATAIADYISNDWDGEIALVTEETAPKGSEEELSVIQDVLGTYSTDYSSSSAARKTNVANGASKLNGIVLYPGETISVAENLNPMTAENGYALAASYENGTTVETYGGGICQVSTTLYNAVMRAELEIVTRASHSMIVTYVEPSMDAAIAGTSKDFQFKNNQDYPVYIESSTNGSTITFTIYGKETRDSNRTVTTTQKAHTGYTAWKIVT-VDGVEQSRDVYNNSTYKVSNK 451
187 0.000e+00UniRef50_UPI0009EEFAAF hypothetical protein n=1 Tax=Paenibacillus tuaregi TaxID=1816681 RepID=UPI0009EEFAAF  ali  24  30........................................YAARNKIPAGVTVGGVDIGGLTYEEGQARLEQEFENEEIYFHHPGIKVQSSWRRAGVHYTADN-WEVAVRELREGSIWSRARARLQLS---KQWQLTVHWDKTALHKTFNPAWEKQFGEGVNARIIGHDDSIRYVPEVPVTRIDWQAFAQAFKSRIPLSASESIQIPLKSAKPAVTLDTLQGIQRKITEFTTGLATSSSGRAHNINAAAQVIDGMLLAPGDIFDYGKVIDTAEAKYGFKPAPVIIQGKFVPGIGGGICQVSSTLYNAAVRAGLDIVERRNHSLPVSYLPKGQDATFAKGYINFRFKNTTSHHILIKAGLIQRNLTVKLFGDIPTGTRYELEVVQEGKEGYIVTYRVKYVNGTAVERRKISRDTYPPQN. 450
188 0.000e+00UniRef50_F6DSM4 VanW family protein n=5 Tax=Desulfotomaculum TaxID=1562 RepID=F6DSM4_DESRL  ali  26  79................................................................................VVFEDQTRTVSLEELGFTVNVNDTLDQVFTP-RDHSLLQQWKAYFQ--PANREIALSVWLDKDKLALILNPMLNSIERPATDASFKIEDGEVLLIPDQKGRKVNYEQIYNDLVQAIRNGKELKIALKTDELEAGTTLQEIEKINGKIGEFTTYFDGENTNRRMNIKLAADKINNLMLKPGQEFSFNQTVGARTAAAGFRPARVIVGNEFDEALGGGICQVSTTLYNAILLANLTLVERHNHSLAVSYVPLGRDAAVAWDLLDFKFKNTLPGHAYLRTNTGRNYITVQVYGETKTKQDVTIRVVDAGYKGFKAERIIRD-NGEIVGREALPASRYYPKAK 442
189 0.000e+00UniRef50_A0A0U2VMD6 VanW domain-containing protein n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A0U2VMD6_9BACL  ali  26  34.............................................RIPSDVRVGDWVIGGLTLPEFEKQLEEKLSAFKIRLHVEGGSAERTLQQLGLEMNTQEVLARLEPLTY-GSPFQRAVYRWRLRHE--VLTLIPRFPEEKVQGALKEAFREVYRQPINARRVIPDDTIRHIPEIRVQHIDEEKLKEQLEKLLSSNQPLSLDVPMRTVDPQITLRTLQGIIRKISEFTTNFPNSSEGRVHNVRSTAASLQDVLLKPGEVFDYAPYIEQTEKRFGFKEAPVIVNGKLVPGIGGGICQVSSTLYNAVLRAGLTVVERRNHSLPVSYVPLGQDATFASGHINFKFRNSTEHAVLIRTATDRHSLTVKLFGQTPPDITYEVETISKGKPGYIVTYRYKKQNGRLVSKEKLSRDTYTAQP. 452
190 0.000e+00UniRef50_A0A1X7KXT2 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A1X  ali  26  28.......................................RYAYSTAIPDNVILSDWAIGGMEQDEFEQQLKERLEQTPVTFTFPGTEVSTTLAKLGVHYQADQLIA-ALKKLQEGGLWERIEARRQF---KANWALQFSWDNQVWKQRFHSQWEQTFGKPVNATRTITDDKVVYTPDQAVFRLDRMQMEQVIRVAIPSEWHKTIEVPLIKQDAPVTVKSLKGIDRKIIEISTFLKPGDAGRIHNVVSAAKTINDMVLKPGDIFDYEKVIAETEKAYGFQEAPVIFNGKLVPGIGGGICQVSSTLYNAVLRTGLEIVERRNHSLPVAYLPIGLDATFSEGYINFRFKNTTGKNLLIRTSSENNQLTIKLFGTLEDNVTYKMETKQKGKQGYKVYR-IKLVDGKEVSREKMYVDTYKAQP. 442
191 0.000e+00UniRef50_A0A1H4RTF3 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=6 Tax=Paenibacillus TaxID=44249 RepID=A0A1H  ali  27  32...........................................QQKLPAGVTISGWNVSGMAYSQFQKQLQEKLQRQQVKLRSSVKEVELTFGKLGMVI-HDKELNAALEPLFQGSIMERLKYRWNMRNAR--LELSITFDNDQLAKAVQQNWQQLYKKPISARIILANDEIQYQAERSALRIDIEKLNAGLAAHVESGESILMELPIYEQPPPVTLQSLKGIKRKIVEFTTEIAASGEGRIYNIRSTAASIQDMLLKPGEIFDFGKVIQKTTADYGYKEAPVIVGGKLVPGIGGGICQVSTTLYNAVLRSGLEVVERRNHSLPIRYVPLGQDATYASGYINFIFRNNTQQSLLIRTLATDTQMTVKLFGDIPDSISYDVQSSINGKPGYKVTYRYKRENGNLVQKELISTDTYSPEP. 446
192 0.000e+00UniRef50_A0A1F8TY18 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWB2_37_7 TaxID=1797677 RepID=A0A1F8TY18_9FIRM  ali  24  27.................................SYTARLQYKINNYLPNNLYVENIHLGGKTLEQAKDKLEKIQLKRTITIQYGDGNGTFTYAQLGYYIDKTSATSQINAVNKNNSFFKRYLNYRKIEKSRVDLLLSYNIHYDQFLKALEIYDDSNLKPPINAKYNIIDGKVQIVKEENGYAFDKDELYKYL---LAKRDLKTAKLKVKAVKASVTAAQLEGIKELLISFTTKFDAGNVPRSSNIRLAASIIDGTLLPPGATFSFNDIVGKRTEERGFKEAGVYINGKVDTGIGGGICQVSTTLYNAVLLVDLQVIERSNHSLTVPYVPLSRDAAVSWGSQDLKFSNNTVNHILVKTKTTRDSITFELYSTKTNKTVELISVVEKGHDGYQLIKNVY-VDGVKISTELVSKDRY..... 442
193 0.000e+00UniRef50_A0A1F7JV01 Uncharacterized protein n=8 Tax=Microgenomates group TaxID=1794810 RepID=A0A1F7JV01_9BACT  ali  21  33.......................................QKKYADRVYPQVVVNGVSFEGYTREDIERLYKEKLEDITLTIFYQDTVATFSGTTLRFAYDTQGISDHALLIGRSPHFPSALLQTISSFFRTYSFNYTFSYNLDPIEDYMALLEEIYNIYPQDALFEFKKGKVTFRVEKPGIRISSDLSLQEIQQYLAQHANRTFQIRSESVKPSVTIGDINGIEEKIGEGVSNFTHSSPEREYNLTHAAYKLHGILIAPGEVFSFNKALGDISQATGFKPGYIIKEGRTVLGDGGGICQDSTTLFRAALNTGLPIIERHAHAYRVRYYEPGFDATVFAPSVDFKFKNDTPAYILIQSIVDSRKLVFEFYGKKDGRPRGVTKQVDWAAPGAKSTFTVKDTDG-VITQDKTFFSSYRPW.. 455
194 0.000e+00UniRef50_A0A1C0AJ81 Uncharacterized protein n=1 Tax=Criibacterium bergeronii TaxID=1871336 RepID=A0A1C0AJ81_9FIRM  ali  30  4..TQSNDVKTEKSFQKKLTIILLILSTMVLVCSFSIFFYYLRANEFINPNIYINGLDVSNLTVENAKSLITKKLRTPNLIIQFEDKRKENVLQTLDFKYDYDVAANQAYQIGRSGNFIIDAVDIKQNLGAETNIPLDKSYDEKKLMSLCDSIEKALNKEPFNANIVVNQGEINVMSGKNGVKVNKEELKDEIVAYIDSNTNIDIPVPFIEIKPKITRNDLLKINAIKGIYTTTYADAAIGRAYNIRLTSSKITDKIVMPGEEISFLNSVGEISYKTGFQNDKIIVNGEYVDGIGGGICQVSSTLYNALRNAGVTITQRTTHSLPVHYVPQGMDATVAINGPDLVYKNNFDYPVYVKSYTTSGKITVEIYG................................................. 378
195 0.000e+00UniRef50_A0A2G3DZL8 Vancomycin resistance protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A2G3DZL8_9FIRM  ali  24  1..........MKKKLFGLLATAVAAMTLLVNPSLTRAETAEEET-RIVDGIYIGTVYVGGMTKDEANNAISDNLMSTTFTLKVDDSSVEATAEQMGIRADAGDSVDAALAVTHSGNLITRYKDSVDLKTEQRVLPLSLEVDKQETARFIYKAHDKLSKAAVDASLKKKGDTFEYIPGTDGEEVVEVDSVYAINEFLADGKKTEINLVTQTVASRGTREELAVVKDRLGSFTTVYNNSGSSREQNVENACDFVNGTIVYPGEEYRTHENLEPITEENGYAMGGTYLNGAIVDSVGGGICQVSTTLYNALIRAEIEITQRFNHSMTVTYVDPAADAAMAGDYKDLRFKNDTGYPIYIEGYYDGTNITFNIYGTKQDDPSGYYNIDQYAHIGMTAWKVVKEG-GKEVSREIFNTSTYRSSPK 444
196 0.000e+00UniRef50_UPI0008326F4E hypothetical protein n=1 Tax=Desulfotomaculum intricatum TaxID=1285191 RepID=UPI0008326F4E  ali  25  44............................................ERVMPGVQLRGLDLSGADRTAKLKTLEEKLQKQSVNIICQDTTKTVSLKEIEFTLNAEETMNTAFAVGQNYNFLQRMWQSVRPVTHAIXXXXXXXXXXXXXXXXXXXXXNTV--PPKDARLVINQDRVSIIPGEPGLHADIDKLYNDLVSNLSEGNTNPVNLTFSQIKPDKTAEEIRGIDYLLGSFTTQFKSWQSNRNKNIAIAAQALEGLYVSPGETVSFNKVVGPRSAEAGYKSAGVIVGDEFNEDLGGGVCQVSTTLYNAVLLANLGIVERHNHSLPISYVPLGQDAAVAYEYLDFKFKNTTEQYIYIDTNVGSNYITFNVLGNKKYKKDIKIEVEKAGSNGYKVSNRLFLENGVVVKTEKLPSSNYLKVDR 450
197 0.000e+00UniRef50_A0A1M7BR77 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Anaerocolumna jejuensis DSM 15929 Tax  ali  28  5...............KRMIRIVFLLSLFLLSAGSYTKAFAADEDNAITKGVYIDAVDISGMTKDEAAKAVADYLKQRTVTVDIKGEKEQVKISDLGFTDKKNNYIEEAMEIGKVGNLIKQYKDLKDTQENKLVYHLEFSINEPKLKTFAKRLSKH-NVKAANATVSRKNGAFVYTDETVGQKVDTETTVAAIKDAVLNNWSGELSAEVKEVAPKYTRSMVEECNTLLGTFHTTFTTSTADRAANLANGARLINNTVLYPGQVFSAYEKLAPFTTSNGYYQAGAYSNGKLVDSIGGGACQVTTTLYNAVLLSELEVVERANHSMTISYVDLSRDAAIAGTWKNLRFKNNTDAPVVIEASTYGRTITFNLWGTKGRKVKFETVTTQSAHTGYVAYKIVYE-NGQEVSRTRVNRSVYNASPR 443
198 0.000e+00UniRef50_G5GIH7 Uncharacterized protein n=1 Tax=Johnsonella ignava ATCC 51276 TaxID=679200 RepID=G5GIH7_9FIRM  ali  25  2...............RLSPLMTKSALIAALAGIGLFINIDNSYAATVPSGLNVGNVQIEGLTPQEADEKIADSIENRTIEIEVNGHKASTTAKDLGVEWKEVDMAKQAVNDYTAGNIVNRYMKQADLQQNPVNIDCKIETDRTKFDEFMDKNFDMFASKVSNASITRENGQFKIKDESDGVKIDKDSTKLKLDEALKSVQDGSITADTEVDKAKIKRSDLEAIKDVLGTYTTDFSSSSAARANNIRVGSNKLNGHLLMPGEVLSGYENMKPFTAENGYQIAHAYENGQVVDSVGGGACQIATTLYNASLRAEIGIKERKNHSMTVSYCPASADAAIAGTYKDIKIVNNKDTPIYVESYTNGGKLTFTIWGKETRSADRKVEYVSEGHNGRTSWKVVT-VNGAQVEKTLISTDTY..... 434
199 0.000e+00UniRef50_A0A173SD64 Uncharacterized vancomycin resistance protein n=6 Tax=Lachnospiraceae TaxID=186803 RepID=A0A173SD64_9FIRM  ali  29  50........................................KVDEEYICKNVFIGKTDVSGMTKEEAVKAVDNTLRNKQLVLKVKDQGADVSIEEMGAEVNIDKLAEKAVGYGKNGSIWSHYQKIHNLDKKKYVIDESFKVDEAKLRELIQERAVPLEQKAVNASASYNGSGFDLTDEAEGYTVDVDKSVKKIKNFMNKKWNAEVELKLDMEKPTIKKADLESLQDELGSYTT--NAGWGDRVQNIRRATELINGTVVMPGEEFSVEQATLPYTEENGYVAGSAYENGQIVESIGGGLCQVSTTLYNAVLYAELEVTRRAPHSMSVSYVEPSRDAMIAEGISDFKFVNNYDTPILIEGYIDGNQLGFYIYGKDTRSAVGSQETEGAGMDGSTAWK-ITYENGEEVSREVINNSTYQ.... 458
200 0.000e+00UniRef50_A0A095XRV1 Vanomycin resistance protein VanB n=12 Tax=Peptostreptococcus TaxID=1257 RepID=A0A095XRV1_9FIRM  ali  37  34...........................................SDKIAKGVSVANVDLSGMTKSQALGKLESLDNLKNVKMYYGDKSWKIPVSDIDLNINYKSTVDSAYNYNRSNAFFTNIVRTLKSDFGSKSIPLDMTYNDGKLNESLKQVKSKLDSQVKEATLDYDAKKTIIVADEPGITMNLQASHDKLVKNLHADKFYT-EMVVKLEKAKFTKEDLKGIDTLLGAYSTIY-GGMYSRNYNIEKSARDSSGVVLKPGQEFSFNGLTGDKTIARGYKAAPVIESGKLIMGIGGGVCQTSSTIFNAALLSGMEITTRRSHTIPSDYVNMGRDATVYDGNPDFKFKNPFKHNVYVKNYTYGSKMISEIYGAASDYKNIDIVVEKYSRPGYNVYRQYKDDKGNIISSEKIGYSNYPAQ.. 437
201 0.000e+00UniRef50_A0A1M5WN99 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=2 Tax=Clostridium TaxID=1485 RepID=A0A1M5WN  ali  29  34.........................................KYSTLIYPGVSIESLDLSGLSKTEAADKIKEPLEEKKIVINTPIKSYELSYDDISASLNTDEALDKAFNYAKDLSLIKRVNLINS--HPAYSIDINFNFDSTPVDNLVATIEGETNRESSNAVLNRVSGNFSVTPSVTSLTLRRDELKDLILSKISRNAEQEIEAPITEEAPEITTDTLNKVNSKISSYTTKMD-NVAGRNHNIALSTSYIQGTLLLPGQEFSFNNVVGNTTPDKGYKPANVIVDNKIKEDYGGGICQVSSTLFNSVIRAGIPATEIHHHTLPSCYVPLGLDVTIDYGNADYKFVNTLDSPIYIEGYTTPSSVTFEVFSDSESKTVETIKIEVIGTPGYRVYKLIKDGNGNVVNRELSYKHFYEPVTR 443
202 0.000e+00UniRef50_A0A1I6IYQ7 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=2 Tax=Lachnoclostridium TaxID=1506553 RepID  ali  30  28.....................................TYADSNTDTIADGIFIDNVSLGGMTSSEAEDAVNEELKQKTLTIKVDEHEVVSTLGTLGYHCLENDYVEQALNLGKKGNLIKRYKELQDVQNENLVYTLEFEFDDKLLEEFVSTECSAYDVEPVDATITRENDEFVIGEHVLGRKVDTGETVAKVKNSILNEWNKEVEAVVIDAEPVYTSEVMARCKDVLGKFSTTYTSSSNSRAANLANAARLINGSIIYPGEEFSTSGKMAPITKENGYETAGAYLNGKVVDSVGGGVCQAATTLYNAVLLSELEVTERYNHSMIVGYVEPAMDAAISEGYKDLKFKNNSDVPVYIESFTVGRTITFVIYGEDTRDPESYMKVDQTAHIGYKAYKIVYE-DGVEVSREKVNYSSYAAEPR 445
203 0.000e+00UniRef50_UPI0005A5DA98 hypothetical protein n=1 Tax=bacterium MS4 TaxID=1120746 RepID=UPI0005A5DA98  ali  27  18...........GKKRARIAAVIAGVVLLATVGGLFGKQLYEAYRDTFYKGIVVAGVDLGGKTMEQAKAALRDKYD---IRIVYQNKTWQLTEDDLNFQFNTDAVLKEAYAYARTGDREERYQQVLALQTAPKTYNVINTMNYDNLDAKLKETVKGISYDPVDATFDTNTATFRYTDGKNGLAVDENRLYTQVEALINGPRTGTVEVPTTVVPFSKTIAEVKSHLQKLGTYSTT-STNNANGTHNMALALSKINGTSIPAGGTFSFNGIVGDSTKASGFLEAGAILNGRLIQSYGGGICQASTTVYGAALRSNMKITQRSNHTLQSTYCPIGQDAAVSYPDLDFKFQNPTEYPIYIVSGIKGKVLTVTFYGYQSPDYDSITVTSQKARTGARATQRVFYKNGIVVKTENLSSSYYRAQP. 471
204 0.000e+00UniRef50_A0A1C5RD99 Uncharacterized vancomycin resistance protein n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C5RD99_9CLOT  ali  30  304.......................................KKLNVDTFYQGIYIEDVDLGGKTXXXXXXXXXXXXXXXXXTLTYQDQTFEYTEDDFQFTYDTDEVLEEAYQTGRDGYVWFRYFKVLMLKNNPEKFSLSHELDTSVLSKQIAEIADQVNAEPKDAKFDPNAGSFTISDAVTGVEVDQTKLAEDCKAILDGKEKKTVAIPASETSYTMDKEEMLSHISLLGTYST-ISHNNANGNHNMKNALGRITGTVLQPGETFSFNGTVGRRTAANGFRTAGVIKNGELVDGLGGGVCQASTTVYGAAIRAGMEVVERGNHRWPSTYVPIGQDAMVSWGSQDMKFKNNTDYPVYIKSYMSGTKLQVMIYGSPPSLPKGTEKVKIKARAGSTASQRTYYKDGKKVKTEALPSSRYNPVNE 725
205 0.000e+00UniRef50_UPI00094EC005 hypothetical protein n=1 Tax=Colibacter massiliensis TaxID=1852379 RepID=UPI00094EC005  ali  26  3....HKRSRTSGGRVAAARRFLLGAVSLSVAGIILFFGGQYAAAQRVL----LDGRDVSHMTRDDADAYLESEITARAFTLKAEDLQVELPLSQLDAHLDRERIEQEVYGIGREGTLTERISEIATVLFYGRNVPVHLQADEGKLTAVLTEFLKHYDRAPVNAYAEPTEGGIVLHEEEDGIVIDAEALRDDIRDKLAAGETGTVELTVSEREASIKKKDLKEIDTVLAYYTTHFNGCDTNRSENIGIAQDRLNHTLVRAGESCSFNETVGTRTRDKGYKDAPVYFDNKLVMDAGGGVCQVSTTLFNAVLRAGLVIDGRSPHFAPAGYVPVGMDATVADNALDFIFSNPFRHAVYIYTTYTGDTATVYILGNHEDDPSVTADTEQEGYDGITIKREVYYRDGS-TYTDFI-VSAYEP... 437
206 0.000e+00UniRef50_A0A0J1FSI1 Vancomycin B-type resistance protein VanW n=16 Tax=Peptococcaceae TaxID=186807 RepID=A0A0J1FSI1_9FIRM  ali  23  57...........................................SQVIPQGTKVNDLDLSNIPVSEASRKINDWAKDKSRVLLYNETEIPITLKELGFEVDVEKTLENAQQR------QNQPQSQSQNQNNVNVIPSVLKANPELAAKVLKEKFKKFNQPAKDATFKIQNDKVVITPAQKGRKVEVDQLINNLQNSSLSEVPSKIKAPLVEVPAKVTTESIESLSSVLGEFSTKFAVGETNRSANLTAAAKALDGKVINPGAVFSFNNAVGPREPQTGYKEAYVIINGEYVKGTGGGVCQVSSTLYNAVLLSNFEVVERKHHDVAVSYIPAGQDATVNYPNIDFKFRNNTGSLAYMRTEVKPGVLTIKLYGKKTGKPRGRVKVDQIGTKGVNVWKVIQDEKGHVTKQ-FLGRDSYEPANR 456
207 0.000e+00UniRef50_A0A084J886 Uncharacterized protein n=2 Tax=Clostridium sulfidigenes TaxID=318464 RepID=A0A084J886_9CLOT  ali  30  44..........................................YADKIYPQVFVEGIEVGGRTKEESIKLLNEKLINNDIKVKVKDKEYKIDYESLNIKSNLQETLMEALDYGKDLSVREGYKLIKN--PKKVDFDIEYSYNINFVDSLLDEVEKTLNKEVKNATIIKEDGKLKVSDSSSKEEINRKDFISQVEEVVNNKGDVTLRLPISIEKPEISTEDLKRINTIISSFSTNFV--DDVRATNIKVATEAASGIVLMPEEEYSFNKLVGESTKEKGYVEAPVIKDNKLQPELGGGICQVSTTLHNTIIRAGILPTERTHHSMAIGYVDKGMDATIYYNIVDYKFKNTLPYPIYIDGIVENNKLIFNIYSYKEYKKDITLDVENPGSKGYKVKVYRKTENKKEVKEEVIYDEIYEPVNK 451
208 0.000e+00UniRef50_A0A1J0GLC3 Uncharacterized protein n=1 Tax=Clostridium estertheticum subsp. estertheticum TaxID=1552 RepID=A0A1J0GLC3_9CLOT  ali  29  31........................................KKWTSLVYPGIKIGELDISGKTLVQAKDMVTQKYQSKNVNIKTPQKTYSLNFAKMNAKYNIDEVVNEAFNYGKNLSLYEKYKLIR--KSEGKVITMKFTYDSKPLTDLISNMKKEINSTPKNASIYMNGDTFIVTPDTKGSTLMDDKLKKEILSKLNSPADISVSAEIKTTLATVTKEKLQTVNTKLSSFSSDFSTSAYGRSTNITLATKSINGTILMPGESFSFNDTVGERTADKGYQPAPVDIGTKVSSDYGGGICQVSTSLYNAILRSNINSTERNHHSIPSTYIPLGMDATVDWGNLDYKFTNTLGYPVFIESIVNNKILTFNVYSNSSTLPVGSIVQEQFPLIGYKV-RTYKNQNGNVINRELISNDSYQ.... 438
209 0.000e+00UniRef50_UPI00085BFCA2 hypothetical protein n=1 Tax=Cellulosilyticum sp. I15G10I2 TaxID=1892843 RepID=UPI00085BFCA2  ali  27  6.........NKTFIIKLLFIQLLCGMISLSLGLKWGISDLLRYENKLYKNMIVAGINVGNMSRDQALSVIKEAILEKELTLILEDKLFTALIKDFFIDSNVAEMIDAAYDYPNDLKPLERWFFL--LNDTEKHFDVTLNFDETAIDLFVAEIVSSITHEPNDAAIFVNKGGVIVSPHSDGYILDKHKLIDQINLSLKTYSESTINILAAKREPLYTTSLLENIDTCITTFNTSFIP-NTNRATNIILSAEAINGTLLAPGDLFSFNTIVGNTTSEKGYKSAPVIVNSKISQGIGGGICQVSSTLYNAILSAGLSPLTRRPHSIPVNYVPLGLDATVSFNNIDFKFENTLDYPIYIESYVEKNQVYVNIYSNHDRSYKLKSEVYQSKGYKVKVSRETYEKN-VLIKTETISLDTY..... 442
210 0.000e+00UniRef50_A0A2G3PXX1 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium TaxID=1898203 RepID=A0A2G3PXX1_9FIRM  ali  28  47.........................................KFDKVFASNIWVEDFSISGLTYEEAQEKLEAYCKEKSLILSKKQVAVDIPFNALGFTYAIKEVLDEAYEIGHQGNLLERYHYAKMEKPTKHTFELTKTYNKNKLTEIIASKKEAFYIAPIDATITRKNRAFIITSEIPGEELDLPLTVERVAAALENEVPIKVEVVTKEVPVQFTKESFNPIQQPIASFYTSYNNADPDRNINLKVAADKINKQLL-PGETFSLAQQLEPINFEAGYRNSKVIVNGKLEQGIGGGVCQIASTLYNALLLTNVDINMRQNHSLPVAYVPLGRDATYASGAIDFQFKNNSNLPLFVESFCENNKVYVNIFASPTLKPENTIKFTSEDGKRVKLYRLFYDKNNKLINKEIINSSYYRPR.. 457
211 0.000e+00UniRef50_A0A1C0BLQ8 Uncharacterized protein n=2 Tax=Clostridium sp. W14A TaxID=1849176 RepID=A0A1C0BLQ8_9CLOT  ali  26  6...KALQPQAVGKPGRKTKAAVAGALVLLIVAGAVLGVSAAIDTDAFYSGIVVQGVELGGKSMSEAQAAVEAALSQSPVELRIAGKTWRITNKNLKFQYNTNDVLKEAYAWARSGDREERYRQVQSLKTSPKTYTVTGKVEESSLESALNAVADEVDTAAQNPRFNTETKQFSFANGKNGVSVDREKLLAGAKSVLESGGVGTVSLSTGEVPFKGTLDDLKAHMKLLGTFSTV-SKNNANGTYNMTRALLSANGVCVEPGATFSFFGTAGECGQAQGYKQAGAILNGKLVQEYGGGICQASTTVYGAAVRAGMKITERYNHSIPSSYCPIGQDATVSYPGLDFKFTNPADYPVYLVTSVKNRVLTAAVYGYHPDGYKGVIKMTSKARAGYKVKQRIFRRNGTSVKTEDLPSSYYRPQP. 467
212 0.000e+00UniRef50_UPI000DCD1629 hypothetical protein n=1 Tax=Paenibacillus contaminans TaxID=450362 RepID=UPI000DCD1629  ali  26  32...........................................RQTVPAGVIVSGWHAEGVSLQGFRAKLEDALARQQVRLKAEGVATSLTLEQLGLRSNADEIIAQ-MEALKSGSLWQRAQLRKKLTNRA--LGLQITFDKEVLQRTVDQTWIALQKEPVNARIISPQDEVRIDPGRNGYRIDTEELLRQLDGRFPPKDPIPLTLPLLAIKPAVTEETLKGITRKIAEFSTVFPASGEGRIHNVSSAAQTVHDMLLPPDGIFDYSKIIQETEKKFGFQEAPVILNGKLVPGVGGGICQVSSTLYNAVLLGGLQIVERRNHSLPVSYVTPGLDATYADGYINFKFKNNTGHHLLIRTSMDNGRLTVKLFGQTPSDITYEVVTKQQGKPGVETYR-VKKQNGNVVSTDLVSRDAYAPQP. 447
213 0.000e+00UniRef50_UPI00099506D8 hypothetical protein n=2 Tax=Bacillus cereus group TaxID=86661 RepID=UPI00099506D8  ali  26  1MSKKNYNIIKKKIKRTKCLIYIFTIILVTLIGFKVMYYISSVNEEVVLPNTHIESIDIGGLNRKQLESVNQEQINQKELTFLLGKTKRTYTYQEIGINYEPNLVIDKIFDQQRGSKWTGWLKQLAEIGFRKPHYRLEPKFNDSKLKHFIENEFTKFQEEPTNAKLRRSNSEISYVDEKPGKKVNITMLKKDILDAVNKETNK-VAVKYINIHPDISMQDLKKIKTPMSEYKTDLLGRDENVRENIEKAALKLNGVVIPSNKEFSFNAIVGITDQAHGYKNAPVILHDKIVQAAGGGVCQVSSTLYNAVLLANLDVVNRVNHSHQVRYVPAGLDATVADNGPDFKFKNTTDTPIYIKTIIKDNQLTVKLFGKISDDIVYTKTTEQTNSLKINTYRTVENKNEKVIKRELISSSTYK.... 429
214 0.000e+00UniRef50_K4Z8X4 Vancomycin resistance protein n=13 Tax=Paenibacillus TaxID=44249 RepID=K4Z8X4_PAEAL  ali  26  28........................................YASQSTIPPNVHLSTWNIGSQSMDTFREQLKDKLEQTSFELSFKGTNIETTLADLGVTYDADPIL-RALDKMKEGSLWERIQARYNF---PTSWTLQFRWNKEVWAKRLADWEAQTFGKPVNAKREITDDSIRYTPEKAVYRIDRVQLEQLIRASINDGRTIALEVPMKKTNPPVTVASLEGIERKIIEFSTSFVQADDGRTHNVNAAAQTIHDMVLKPGEIFDYDKVIAETEKKYGFKEAPVIFNGKLVPGIGGGICQVSSTLYNAVLRTGLEIVERRNHSLPVSYLPIGLDATFSQGYINFRFKNTTGKHLMIRTAAENDRLIIKFFGTMDKGVSYRMETKQRGKQGYTVYR-IKLVNGKEVERKKMFVDTYRPQP. 441
215 0.000e+00UniRef50_A0A1H3MP22 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=4 Tax=Tindallia TaxID=69894 RepID=A0A1H3MP2  ali  25  9............RIRSAFGLLLVFSLQVILASLLSFPP----YKNELPTGTKVNGKSASGLTGQQVILMLNEALPEIEVEFIVEGKTWEIPMEEIEAGYDQKEILEDIQRLL-NPHWKDRWIQQLSGGIRSSVITYPIKYNEELLEEWSDDLERKLLVESIDADLKVIDGEVIISAHRKGYQVKSSDVKEKMKESLHHKDFDDVQVAVHILNPEVTTESLGNFDQLLAIYETSL-GSNQKRNTNIKLGAEKINGLRLEPEEVFSFNETVGKVSAEDGYQPAPVIQNGRLVQGLGGGICQVSSTLYQATLYSGMEIVERRNHSLPVGYVPLGMDATIAYGIQDFSFRNPHSFPVVMGAWVAKEELHIAIWGDRDYEKEGVEVVRQKGQNGYRVYRITGDRENN-MKEELISRDYYRPVAR 440
216 0.000e+00UniRef50_A0A1Q9JXK1 Uncharacterized protein n=1 Tax=Anaerostipes sp. 992a TaxID=1261637 RepID=A0A1Q9JXK1_9FIRM  ali  28  35...........................................NGRILSNVFVDSVNVGGMSXXXXXXXXXXXXXXXXXXLKADQKTKTIAVKDMGIDFREEKAVKEAYGVGREGNIVSRYFAVRKLKKEAHVVKLQASITEAQAEKILKNNEKALIVKTQNASLTRKNGKFKIIDEVEGKTIVYDKSVSTMQNAIADQWDKDIKISVKKEEPKYKAEDLKDVTDVLGTYATSYGSSGYSRCRNVENGCSKINGTMLYPGETLSVYKKVSPFDAENGYYKAGSYSGGEVVQTYGGGICQVSTTLYNAVLRSELKVTERSNHSMVVNYVPLSADAAIAGTHKDFKFKNNTKTPIYIEGETSGGMIRFTIYGKETRAKNRTIEVTQSAHTGYTAWKVIY-IDGKEKERIKVNSSHYNSSPQ 445
217 0.000e+00UniRef50_UPI00055721B3 hypothetical protein n=1 Tax=Clostridium ihumii TaxID=1470356 RepID=UPI00055721B3  ali  26  27........................................YKYSTRIYPKIYIENIKVSNLKIEEAKEKLEKNISNKKIEIRVEDKLFKTSYEELGVKFDTQRAIEDAINIGEKENFIKKLYMI--LFPKKINIEINLTYNNEAVDGVIYYIEGDVNIKPIESKMTLENGSFTITDEENGVRINNESLKSQLEKSINKNINEEIQCELEQWIPEKRKQNLSKINGVICSFSTSLQNSSEQRRTNIKLATKAVDSYVVMPNEIFSFNDVVGVRTESKGYKRAHVILGNQYVDDVGGGICQVSSTLYNAILKTDIEVIERKPHSKKINYVPLGQDATVNYGAIDFKFKNTLEVPIYIRGQVQDNYVGFQIYSTSINLKRYQIEVEKEGKIGYVVYRVLY-KDGKMIEKKIVAKDIYKAVN. 437
218 0.000e+00UniRef50_A0A2H0WMN7 Uncharacterized protein n=1 Tax=Candidatus Shapirobacteria bacterium CG09_land_8_20_14_0_10_47_13 TaxID=1974481 RepID=A0A2H0WMN7_  ali  21  1..........MKKRQSFFRGAILGGLFLLFCFKTEHLSLAL-------PKLMVFSQVVSGKTTDELESFLADKFLGRKVVFSWQDNRWEVIPQMIDFSLDKAKMAAAVVDAGKTEGGFSHLWDFGNFFRPEKVILPLFNFSQDKLVQITNQISKEVNQPAQDALFDFKEGKVSFQPSRAGWLFKGSEFERLVTDSFQSQADFAFDLPVVEVRPKVTTDQSNGIKELLAMGESFFNDSIPTRIYNIALAASRLHGIVIPPGETFSFAQNIGDISTATGYQQAYVIKNKQTILEDGGGVCQVSTTLFRAALNAGLPITERQAHYYRVGFYPPGLDATVYPPSPDLKFKNDTGAYILIQTKIDKKRLAFEFYGTSDGRPVGTEKRIDTTHWGAKVKRKIFTSTGEL-KEDRTFWSNYVAWP. 446
219 0.000e+00UniRef50_A0A1T4V378 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=8 Tax=root TaxID=1 RepID=A0A1T4V378_9FIRM :  ali  30  3...............RRGKLLILMMIVIIFMLTNNKIIYAINLNGKILNNIYVQDINLSDLTKEEATKKINSYIENNEFELFYNNESILVNKETLGVDYKVDELVDRAYSIGRDKDLITDMKTKISLKKEKKIIPLTCSYNIKKVDNLIDKIYSKLYISPKDASAKIVNGNIVVYEEHKGQAVDKENLKDIIVYKIENLDSSQSEIPLDVLNPKYTYDQLMKIDTLLGSYETYFNPKRKNRVNNITVAAKSTSDILVNTNEKFSFNQQLRDNDAYNKLKVASIILNGKHDKGVGGGICQVSTTIYNAALYAGMDIVKITNHSIPSPYVTKGRDATVSNGSMDFVFKNNNNNPIIVHNEIFENKIVSKIYGCSSDKRNIEIEVEQEGRLGYTVTFRLYKSNNEILKKELVNTSYYPPCDE 434
220 0.000e+00UniRef50_A0A0C1R6H4 Putative peptidoglycan binding domain protein n=1 Tax=Clostridium argentinense CDC 2741 TaxID=1418104 RepID=A0A0C1R6H4_9CLOT  ali  27  30.........................................KYDKLIYPNVHVENIPVYDLEIEESKRDLEEKIYNKTLEILVEDEIYRTDYMELGVKFNVDKALNEAFDYGRDFNIFKKMSII--TKPNYINIKVELTFNEQAIDGIIAKIESQTDVKAVDSKIKINNGEFQISDEIKGKKLDRDLLKKEIIKNINTSIDIEIHATINEINPKRTREELSKINASITSCSTNFNSSSSERSNNIRLATNAIDGTVIMPDEIFSFNNVVGERTYSKGYEKASVIMGDEFINGLGGGICQVSTTLYNAVLRSELEVVERRPHSLYITYVPLGQDATVNYGTTDLKFKNNLPYPIYIHGYTKNNTLSFDIYSNKMKKKSYKIEVEKVGKNGYNVYKYIYEE-GKLVEKKLVSKDKYKATD. 439
221 0.000e+00UniRef50_A0A1F6A180 Uncharacterized protein n=1 Tax=Candidatus Gottesmanbacteria bacterium RIFCSPHIGHO2_01_FULL_47_48 TaxID=1798381 RepID=A0A1F6A180_  ali  21  1..........MQRLFTLLHLAFFFCLGALILLSVAYLVFMSRYQDRAFPGVKVASVDVSGKTEEEIATVLTTTYRTPPLTLHFSSPEASLTAQELNLALDTRLMASRALSIGRTPNPYFNLLQIVAAYNHAINLPLEISYHSRLLGQKLDAVAPLIEKEPVSAIFDFNKGRVEFSPSKNGLALDRPKIIPSLVSQTKGGDSLNIPLYTKTVYPSVQTSAAEGLHDLLGQGKSYFYDSIPGRVYNISLGTQKVSGRLVAPGEIFSFNESIGTVSAVFGFQKAYSIIKGKTVLDDGGGVCQVSTTLYRAVLNAGLPVVERVAHAYRVGFYEPGLDATVYPPSPDFRFQNDTGHWLLLQANFDKKQLTFDIFGTADGRQTTQVKQVDTAHAGAKVYFKRKVTRGDEVLIDETVNSNYIPWP. 470
222 0.000e+00UniRef50_A0A1C5V4H8 Uncharacterized vancomycin resistance protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1C5V4H8_9FIRM  ali  25  53...........................................DDVICDNIYINDLNLSGMTKKEAQKALENQKESKTVTLTVRDEKVEAFLKELGFSEDEEQLVDEAVSYGKKGNLWMRYRQMKRLEKEPFVIDEEYSVSRKKLKSLLKEKAGDILQGPENASLSRDDGKVSIVAEKEGEIIDYKATVKQLNDDLNDNWDFEEQVVIKTEKPEVTKADLKDMTDELGAYSTD--AGGGERWTNLKTGSSMLNGIILQPGEELSVYDSTAPYDEEHGYAEGTAYENGQVVPSYGGGICQVSTTLYNAVIYAELEVVERHPHSMTVDYVEPSRDAAIAGGLMDFRFKNSYDTPIYIYGEIDDNQLRMIIYGKETRPKNRTIEFESEPHTGAQLWKVVY-KDGEEVSREVFNTSYYQKADE 464
223 0.000e+00UniRef50_A0A1I1UBW2 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=3 Tax=Bacillus TaxID=55087 RepID=A0A1I1UBW2  ali  28  2............KLRNLIIGSAIAGGVLLCAGSVSAYQYVSKLNHQLLPHTTFEGVSIDGKTKADVQKIIQQKLNQKSVNYVLKDEKHTYTWQELGIEYNSTDIADKIFK-EQKGNITNRYNMRKQAETGKRDYKLEPSINTAKYDAFIKEKYNDSLVDPVDADLSISGTTIAISESKDGEKVDKEKLKTLTTEAVKTNK-QDIQVPITAVKPERSTEDVKGIQEVIAEYSTPLAGRNSSQTFNVQRAVNTLTGVFVKPDETFSFNGRVGITDAAHGYKSAAVYVNGKVEQSAGGGVCQVSSTLYGAVLRADLGVVDRSNHSLPVHYLPLGQDAAVADYGPDLKFKNNTGKYIYIQAVTNGSSVTTRIFGTNTGKNVEKVISETDKSIVAVTYKKVT-QNGQVLSSGQISKSTYK.... 415
224 0.000e+00UniRef50_A0A1M6NS95 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Hathewaya proteolytica DSM 3090 TaxID  ali  28  44...........................................NNKIYPGVKVAHIDLSGKTKDEAKKIIQEGYVDKHIVINAKEKDYSVWYKEIGTDYDVDEIVNKAFQHGKEKNLFKKYKMIKN--KEKNVLDINFSYDIEKVQPIIEAIKNDVNKNPVNPKLKREGGEFIVIPGEKGYSLREEELKKIISSSLSSNSEIVIEAPIDTLEPKATKEDLEKVDTKISTFTTTF-GSNKARTKNIKLSTDSINGLVLLPGDEFDFNKVVGERTAERGYETAHVIVGDKFVDGLGGGICQTSSTLYCAMLRANIDASVRDSHTIASSYVDIGQDATVSWGGPEYKFINTLKYPIYIEGYLGGNSLTFNVYSNSKNLEEGKTQVVKEAYDGATVYRETYE-NGVFVKKQKLYDAKIAPVN. 449
225 0.000e+00UniRef50_R5NH52 G5 domain protein n=2 Tax=environmental samples TaxID=2231195 RepID=R5NH52_9FIRM  ali  26  45..............................................ITKGITIGDIDVSGMTEEEAMNKANEYINSKVITLDVDGNKVQVTAGELGYYWKNTDIVKDAASHCLEGNVIKRYEEAKDIEHNGLKYEFEVDVNDEVMTNTINEKCGQYNIPHVNAQLIRTDSSFSISQESTGRMIDMDTSISALHKFLLDEWNKSFTLTVVDDKPVATVADCERVKDVLGTFSTKFSTSNYNRNENMRNGIKLLNGITLCQGETMSVNSFLEPWTAGNGWKAAGTYVNGKVEDSLGGGICQVSTTLYNAVLLAELEVVERYNHSMSVGYVPLSMDAALAGTWKDLKIKNNTDTPIYIEGIYDSGKLTFNIYGEETRPSNRKVEVTSRGHTGYTAWKKVY-VDGVLQSEEVVNKSSYSASP. 453
226 0.000e+00UniRef50_F4LUD1 VanW family protein n=1 Tax=Tepidanaerobacter acetatoxydans (strain DSM 21804 / JCM 16047 / Re1) TaxID=1209989 RepID=F4LUD1_TEPAE  ali  25  30..............................................IPSGLYIADIDIGGLTNDEARNKLTEEKINNSIILTFYDKQWILKISE-YVEIDADESIENMASYIKKKGVIKGFIYRQRLKKSPLRIEPIIKYKQDKLAQLFDEINKVIMVKPINAVFKTDNDIVHIITDVKGQILDEDMLKEKIKEAIWT-KNQTLVIPVKVWNAEMTKEDLEGIRVKIAEYSTEFDKTLKNRTENIKVASEMLNGCIISPGETFSFNKVVGERTSDKGYKKAPAFINNEVIYDIGGGICQVSSTLYNLALLTDLEIVERMNHSLPVGYVPLGRDATVSYGTIDLKFKNNTGGYLLLTSEITNDKLIVKFFGNKKIDKYVELFSEEQGNAGYVVNLWKRYANEKNEHKVLISSDTYNPTP. 431
227 0.000e+00UniRef50_E0QG60 VanW-like protein n=3 Tax=Peptostreptococcaceae TaxID=186804 RepID=E0QG60_9FIRM  ali  34  34..............................................ISKNVYINNVNVSGLTKEEAIAKVNADVKLQDLTLIYGKYKFSKEFDEIGFKYSVDKAVNEAFSVAKGINFFENVNTLIKLNMGDKDIRLSYEYDEKLLDKFIAEISKKLNTKPKEATIFAANGKVTVTAGKDGKVVQKEKLINDINEAINTAATVEVKISFVTKSPKLKYSDLKQVNGLIASYQTRYSTADYGRAHNIENAAMILDKQVIMPGEEVSFLNRLGDINWYNGFSSANIIVNNQYVKGMGGGVCQVSTTLYNALIQGGVEIKERKNHSLAVHYVPLGRDATVASGSVDLKYKNSYDFPIYIRNYASRGVMRSEIYGDTTKVSKIQIYTTYYG--GSVVT--YKIQDGK---KTIISSDWYS.... 398
228 0.000e+00UniRef50_UPI0003725053 hypothetical protein n=2 Tax=Sporomusaceae TaxID=1843490 RepID=UPI0003725053  ali  25  31..........................................FRDGISHGVTLGSLDLGGLTEEAAVAAIRSRLAHQTIRFIYGDQQWESTTDELNIHADAAALAHEAYMIGRTGPVWLQLQEWYMATQKGRQIAYRLAYEPVKVKALLDKIVHEVERPSRKAHINYQQGQVQIVPEIIGQHLERTELETTWQAAMADFQSLQISLPVKDDVPEIRAEDLSGINRLLGSYSSYFNAYDNNRSKNVYLASRSIDDTLVRAGSVFSFNSQVGKRTQENGYKEAPVFINGKLVPDWGGGVCQVSSTLYNAVLLADLEIVERTSHYSPPGYVPLGQDATVADDQLDFQFTNTSRHNLYISSKIEGNRLTVQVFGSADDPVEVRIVVEERGESGYRIKIKIRLHQGVEISREIISSDDFPPSER 437
229 0.000e+00UniRef50_A0A099S425 Uncharacterized protein n=1 Tax=Clostridium sp. HMP27 TaxID=1487921 RepID=A0A099S425_9CLOT  ali  28  40..........................................WSQLIYSDIKIADIDLGGKTKEEARNIINDNIYNKKLYVTIDGKTYSINKLQLIKSYSIDSAIDKAFSFGKDLNIIKQHELINLGSNKAYN--LDFTCDDGVIRAFISKIEKEINKNPINAIIKMNTEKIQIQDDIKGAIVEKEKLYEYIKSMIESGTSGDIKAPVKEVEAEIKKSELSGINTCISSFSTSFKSSSFMRVNNIKVCINAINGTILMPGETFSFNDVVGERTKERGYMEAPVIIDNKIESGIGGGICQVSSTLYNAILKAGIQNIERINHSLPSSYVELGLDATVDWQNIDFKFVNTLNYPIYIEGHTENGNLYINIFSNSDSKKVYVIENDNDSVYKVKVIRKTYE-NGMLINSEFISNDTY..... 419
230 0.000e+00UniRef50_A0A1F7JQT8 Uncharacterized protein n=12 Tax=root TaxID=1 RepID=A0A1F7JQT8_9BACT  ali  23  38........................................KKYKNNIYPNVYLDNIDLGGKTKKQAKDLFSKKFDKVKVEVIYRDEVATLSAKTLALHTDTDEVIDRAYLIGRTNHLLIRQQTVVFFNLEKFHFLTHVIYTQAAINDFILAQQDRFNYPAKNALFEFTEGKVVFKPDEKGLEIQSEKFKEDLEAALQQLNNQTVILTDKIILPEITLGHANGIEELVGEGVSNYSHSIPTRIHNVILAASKFHGVLIPKGAMFSFNNTVGDISSLTGYEPAYIIKNGRTVLGDGGGVCQVSTTLFRAAINTGLPIAERHAHAYRVSYYEPGFDATIFSPSVDLKFQNNTPASILIQTAIDKNILTFKFYGKRDDRPKGEVKQVDFPAWGAKTKFTYKVIKGNETSIDETFFSNFRPWQ. 460
231 0.000e+00UniRef50_A0A1F7GKX3 Uncharacterized protein n=2 Tax=Candidatus Roizmanbacteria TaxID=1752723 RepID=A0A1F7GKX3_9BACT  ali  23  26.............................IGTLTFYLNRKQADRGKIYPNVYVDNIHFGYKNRSEVEKYLKNKLSHVFLRLTYDTKEATFSAQALHLTLDTKTPTDQAYLIGRVGNNASQIAQQIRSLFGRFDFYSSIDYDKTIINNYLDTLDASYSRPPENALFTVENNRVSFKIEKNGLQIQKKETIAKIEKQLNKKGGIVVPVSYEISKPTVTLSSINGIVEKIGEGTSNYAGSIPGRIHNVILGTSRINGVIVPKDSVFSFNNTIGDISAATGYQPAYIIKEGKTILGDGGGICQVSTTLFRAIMNTGLPVLERQAHAYRVHYYEPGFDATVFGPTVDLKFKNDTPAAILIQTKVDNQIVTFEMYGKSDGRPKGTQKQVDWAAPGTKALFHYKVERGGQILQDTDFYSNYRPWQ. 462
232 0.000e+00UniRef50_A0A095XE26 Uncharacterized protein n=2 Tax=unclassified Tissierellia TaxID=1737407 RepID=A0A095XE26_9FIRM  ali  29  54.......................................ETLSKEVIYDGISIGGVDVSGLSKSEAESKLRDKFSERKIVVYIDDSSATKTLAELGLNPNFDVAINKAYQIGRDGTEEERFNQINSLKENKENIDLSLNVDEEKVKDFVNTISANMNVVSTNSDVTFVDGKLQVGESKSGKEVDKEELLENIKKAINENNDVSFETKTKTIEPSVNKDAIARVNGVIGTFTSNLGRGTAGRNANIVLSAKRISNIVVMPGETVSFNQKMGPITEANGYKQASTIQGGVYTDALGGGLCQTSTTLYNALVRSDVTITERHPHSIPAPYVPYGEDGAVWVGAKDLKFTNNFDFPIAITSSVNKNIITFTIYGKSDELFVGETKVVKKGRPGYRSYK-VYKNGGKLIKEVPYMKSYYPKSDQ 469
233 0.000e+00UniRef50_V2Y2G3 VanW-like protein n=1 Tax=Catonella morbi ATCC 51271 TaxID=592026 RepID=V2Y2G3_9FIRM  ali  27  36...........................................EGVICEGISVNGIEMGGKTEEEAEKLLSDRVKSKELVVSVTENSESISFKDLGVKVKSNNIVDEIVQIGEKGNIIDRYKAIKSAKENKPEYNIEFKYDSKKVDQFIKSIAEKYDVVPENATLRREAGKFIVSGGKEGRSLNQKEAFASAKAVVEGEDETNVELALETKKPKYDKEALSKVTDLLGSYTTRYNPSG-GRGQNVANGCRLINGSVVMPGETLSANNKMAPYTVQNGYGMGTAYVDGKVVPDMGGGICQVSSTLYNAVLFSELGVVQRFNHSLTVDYVELARDAAIAGTWKDFVFKNTTAYPVYVEGITNGGQITFNVYGHETRDVELSSVVLSRGGSKAQLYKLVYE-NGVLKDRILLNTSTYKP... 429
234 0.000e+00UniRef50_A7VPA6 VanW-like protein n=3 Tax=Clostridiales TaxID=186802 RepID=A7VPA6_9FIRM  ali  29  63..................................IAMVDRALNVDTFYTGIQVEGIDVGGKTMEEAKALLEKHLPDVKIKAVYGQKEYTVDNTYLSFESTLEAALEEAYQYAREGERDERYALVEALETQPKNFEVKAEFDEKKVGELVKKIEKELNCEVTEAHVKFNPDSFVYEGGSPGIKVKAEELKQSLVKALEAENKSELKIPVTETQPKTTVEDVKKQTVKLSEYTT-YSTNTENGTHNMALSLAAANGTVLKPGEIFSFNETTGDTTTALGYLPATGISNNKSVQVYGGGICQSSTTIYGAALRADMEIVTRYNHRWPSSYVPIGQDATVDYPSTDFQFKNSSDYPVYIKAYMDGRTLVVQIYGHPSDEDTIEVESWQTGVYGYTAEEKVFYKNGQEVKREPIDSSYY..... 481
235 0.000e+00UniRef50_A0A1F7K9A3 Uncharacterized protein n=1 Tax=Candidatus Roizmanbacteria bacterium RIFOXYA1_FULL_41_12 TaxID=1802082 RepID=A0A1F7K9A3_9BACT  ali  21  5...............KNKLIILLSAALFLVCWTVVANTQTIHSSNIILPNIYLDQILVGGLTKEQAIKLLNKRYRQNKIELKFDNKNATIAAKNLDYQLPIHSAVDQAYIVGRGQGLSALYQQILKLGWESYNFDLNPIYDQKYLNNLLNELAQSYKKEPLDARFDFADGRVQFQVEKNGYQLDMASVQTEIEKALKDQRFKKVSVAKQILKAEIKLKEINGIRELVGMGSSHFAGSAPERVHNIVTGANKINGMIIKPKQTFSFNEFLGEISGRTGFAPAFVIKNGRTVLDDGGGICQVSTTMFRTALNAGVPILERTAHAYRVGYYEPGLDATIYLPTVDLKFENDYQSALLIQSEVDLNKLTFYLYGTKDQRPEGVTKQVDFAAWGTSAKFTYKYPNNEVKQQE--FVSNFRPW.. 451
236 0.000e+00UniRef50_R5EM64 VanW like protein n=1 Tax=Clostridium sp. CAG:590 TaxID=1262825 RepID=R5EM64_9CLOT  ali  27  1.......MKRITKLR--AITFLLIAGTLAVAAGT--ARAKESDNDTIYAGVYLDGVYVGGLTKEEAMEEYDKYIDDLKITFATDVGTCSTTLKDLGVSVSVEDAVDKAYNYGRQGNILSRYKEIKALEAENVVLVPEKEFNEDSLKEYLENETGDITKDAKNASIDRVDGEFVVYKGEVGTSIDVDKTVKKVEDVFAAEWDIKIDAAVDEKEPQYTSKDFYSIDSVLGQGSTEYSQGNTERCQNLATGASKISGTVLMPGESFSMLDTVLPFTEENGYANAGQYEKDDLVDGLGGGICQVSTTLYLAVLRAELDVNERYPHTFPASYVKHGMDAAISENNMNFRFTNNTEYPIYIDGYAGGGTISFAIYGHETRPSNRTIETERAAHTGYYVWKHVY-VDGEETEKYIVGRSNYQAQ.. 449
237 0.000e+00UniRef50_UPI0006BB85B4 hypothetical protein n=1 Tax=Neofamilia massiliensis TaxID=1673724 RepID=UPI0006BB85B4  ali  26  28.......................................NVVNVDTIYRGISVDGIDVSNLTLTEAMKKVEGKIPDKKLVLTYEDYKFEYPYSELGYKIDYGYGVLQAYKYAREGSPGDRFVQVTKLSSNPINFELEGSFSEAEIDKVIGDLNNMISRPAVDANFSVVNGKKQVVEAIDGLNVDNKKTKDLIYKSLETGED--VKIVVDKKPANLYASAFDHLKGPIGTFETDYSSSVLNRKKNIKKAAEILNGLIIKPKEQISFNKVIGEISEEAGFFPATVINEGNFDTGVGGGICQVSTTLYNAAVKADLSIDERRNHSRPVNYVPRGTDAAIAIGYLDLKISNPFDFPIYIGAEADDKKIRFTIIGDKDYDVSLIVEVSQKGYDGYQSYK-VKEKNGEFLEKDKFYRSTYPARN. 433
238 0.000e+00UniRef50_A0A1V4SXM6 Vancomycin B-type resistance protein VanW n=8 Tax=Clostridium TaxID=1485 RepID=A0A1V4SXM6_9CLOT  ali  30  50..........................................WNYKIYPGVTVKGIDLSGKSAEEAKNILNDKISNKDIVIKVDDKEYKGKYKDIEGKYNVDKAVDDAVKYGKDKSIFKQNKIIKG--KENKELEIEFLYNDKKLGKLKENAQKNLNIEPKNATINIVGSSKNITEETLGKKLEVEELNNSLKENLNGENPTIINLNYVESKPKVTKEELSKIKDVMGSFESSFATSTPERSANVQAAVGFVDGTVLMPGEEFSYDKATS--TDKSKYKQAPVYINNKVEMDIGGGICQVSSALYRAMMRANIRPTERHNHSLTVSYAKPSLDATVAWGYLDYKFKNPYDFPIYIKGTSDGKVIRFYVYGDKSNLEEGKRVVQSKGQAGYVSKYQLTYENGKLIKRELVSTDTY..... 451
239 0.000e+00UniRef50_UPI00058B3838 hypothetical protein n=1 Tax=Clostridium polynesiense TaxID=1325933 RepID=UPI00058B3838  ali  27  38..........................................NKGRLPKFTYVDNIDVSFMTYEEASEKIKEFLQNSFINMKYKDNTVTKALSDFNAEYHIDKALKEINRISRERTFLKTISLLFIKEKPKYSIPISFSYSKEVIGELSKEVSNKYNKLPVDAVLKKKGSSFEIEKEVSGVNIKEQELKDKIIKAVESPLNIEILIPFEITNALITEEILKDSHSLIAEFKTSLSPTG-NRTSNIITAAAAVNGTYLKPQEVFSLNKALGSRTAAKGYKSAPVFSNGTVSTAIAGGICQLATTLYNTALLSNMDIVERKPHSLTVGYVPPSLDATISGNNPDFKFKNNKETPIYIESYVSEGSLYVNFYGKKDEGPTSSIISQKGGYLKSRAYKHTYE-NGKLIKTEILSTDTYK.... 423
240 0.000e+00UniRef50_A0A1V1I268 VanW-like protein n=5 Tax=Peptostreptococcaceae TaxID=186804 RepID=A0A1V1I268_9FIRM  ali  30  104............KLTKKTRNLILVGCTIILLSSIYVGKTVSKYENKIFPGTLVYEQDISNLEKEEVLNKIEKNIEDKKVQININNKIYDIQIKNLVSKYNNDKLYEDIIKNQSEKNIFSKFISI--ASKKNTNYNLYIEIDEKKFNDLKDEIAQDVNIECIEPKVIINDEKISYKKGEDGSKLDEEALYNDIKEGINSKENIIINAKLIKDSPKISIDDLKLINHKVSTYTTTY-GSGNSRGSNVENAANKIDDLLLMPGEEFSYENAIGPVIASNGYKYAPVISNGKLVDGIGGGVCQVSSTLYNTQLNAGIIPTERRNHSKAVNYVPRGLDATLASGIIDYKFKNTYEYPLVINTKAINGKLTIEIWSNEDALKGIEYKPVSYSGNVANTYLYGYDKDGNKVYEKHIDTSVYK.... 511
241 0.000e+00UniRef50_A0A0J1J0R9 Uncharacterized protein n=7 Tax=Clostridiales TaxID=186802 RepID=A0A0J1J0R9_9FIRM  ali  29  35...........................................DGTINKGVYIGDVDVSGMTKDQAEEAVKAKMESASITLQVGTDTATATAGELGAKWANTDVVEQALELGKAGNLIKRYKENKDLQHEPAKFELEYTADASTARNYVETKCKVFEKEAQEGSLTRENGEFEVVPGVIGQKINVEDSVYAITNYMNSGESGTVTLSVNQDKPKFSDEELSKVEDVLGTYT-TYYGSTTGRNQNVERGAELLNGHLLYPGESFSVTDAVVPFNAENGYEMAPSYESGRVVDSYGGGICQVSTTLYNALLLAELDVTERSNHTMIVTYVEPSMDAAIAEGLMDLVFVNNTDAPIYLAGSAYGGELTFTIYGHETRPADRVLEQTQSALTGAKLWKYVTE-NGETTKT-QVNSSYYQAAP. 442
242 0.000e+00UniRef50_A0A0J1FW26 Vancomycin B-type resistance protein VanW n=6 Tax=Desulfosporosinus TaxID=79206 RepID=A0A0J1FW26_9FIRM  ali  26  47...........................................TGQIAKGI-VLEIPLGQLTFADAQSKLEQKLYEHPLQLTAGEKTFSFTMKELGFTYSYEEPLQQAYLIGREGNILNKAEAKFKASW-GITFTPDYTWNNQTLSGILTQRLSSLNMPAENAHFIVNDDSMQIVAEKVGKQVDIENLITSIKK-VPIEDAAHIPIPFKSIKPGLTQEDLEKVKDLISEYSTIFDLNQKERTINLKLAAKAIDGLVLKPGETFSFNQTVGPRTVEAGYQEAIIIEGNSFVPGLGGGVCQVSSTLYNAVRLASVTVIERSRHSLPVAYVPPGQDATVAYPDLDFKFRNDSGDFILIRSDINGHSLTFKLYGK................................................ 379
243 0.000e+00UniRef50_UPI000BE3653F vanomycin resistance protein VanB n=1 Tax=Clostridium peptidivorans TaxID=100174 RepID=UPI000BE3653F  ali  26  40.........................................KWSQLIYNGIKIADIDLGGKSKEEARNIIKTQYRNKKLYVTIDDKIYSVDKSRLIKSYSIDSAIDKAFNFGKNLSIIEQHKLVK--IGSNKAYSLDLICNDEDIKRFISGIEKEINKSPANATIKMSNGTIQIQADTKGSIVEREKLYQCIEDVIKTGRSGDIYIKVKKAEAEITKSKLSGINTCISSFSTSFKSSSFMRANNINVCVNAINGTLLMPGEVFSFNEVVGERTKERGYMEAPVIINNKIESGIGGGICQVSSTLYNAILKTGIQNIERINHSLPSSYVELGLDATVDWENIDFKFTNTLDYPIYIEAHTQNKNLYINIFSNSNLRKKIYVIEQDENVYKVKVIRKTYE-NGVLIDSEFISNDTYTPV.. 423
244 0.000e+00UniRef50_A0A0B3WUS4 Uncharacterized protein n=5 Tax=Clostridiales TaxID=186802 RepID=A0A0B3WUS4_9FIRM  ali  33  5................RKLKIAIFLSLLIVSLGNVVLSNAIEFEGKINKNIYVRDINLSNLTKKEAMEKINKALENNSFSLIFDEKEYSFCKNDVGTSYDVEEVVEKAYNIGRDKGIIANMKTRSSLAMGKKVIDYSITYDEKKLDKYLKELNKKIYIKPTSATIRIINGKIVITKEKNGYKLNEDELKNTIIRKIKDMDNKDEIIPTLSVKPFYSYKELSKINTVLGSFETYFNANNYNRFNNIKLAANATSNILLDKGEIFSFNSCIQKSHINKYLKEAPVIVNGKPEKGIGGGMCQVSSTIYNAALYSGMKIINVRNHSIPSPYIEMGRDATVSGGTIDLKFSNKFDNPIFIYNRIVGNKIVCTIYGNKKDNKDIEVITEQEGRKGYKVYRVYKDTLGKE--TEYIGQSYYPPQDK 434
245 0.000e+00UniRef50_A0A161PVD4 Vancomycin B-type resistance protein VanW n=2 Tax=Thermovenabulum gondwanense TaxID=520767 RepID=A0A161PVD4_9FIRM  ali  27  34..........................................NNDILPYNVRIGPIDVSKLRKEDASLKIQSYIEEKKIIFRYNNKKYEITVGELII-FNPEKSIKEALLIKKEEFFLKSFYLDKFNKRKVTIIPLNYAINEQNLQSIITKIEKEICTLPQNARFTFRQNKLQIIDEKEGTEIDKELLKTMISNKIFD-DEIIIDLPLKKIKPFYTKEKLKNIKYEIASFSTRFNLNQKDRINNIKLASEILNGIIIAPTEVFSFNETVGERTKEKGYTDAPIYFNNEVIQGTGGGVCQISTTLYNLVLLADLEVIERHHHSMPVGYVPPGRDATVSYGILDLKFKNSTGGYLVLSTEIIGNNLVMKFFSNEKFNKKIDIISEEEGRPGVKVWKIINYQD--RIEKKLVSIDTYKPLN. 436
246 0.000e+00UniRef50_R4KBR6 Putative vancomycin resistance protein n=2 Tax=Desulfotomaculum gibsoniae TaxID=102134 RepID=R4KBR6_9FIRM  ali  25  3..........RRKNKFKLIRSGFLLMLFLVLGSGAIVNQASLSNNVIFPGTKVLGVDLSNLTXXXXXXXXXXXXXXXXXXVTYQGVAHDVTLGAMGLTLDGAKTIDQALAHFNKIGLIKRWQSRLHLTEQQ---PAVINLDRDMTKAVLQKIVNPLYIPAVNARLTVNSEQVGVEPSQEGFHVDIDKFRNQLIELLNNNHSLALELPATKINPELSTEEVTGVTGLLSQYTTQFNPTLAGRTQNIKISADILDDLIVPPEEIVSFNQVVGPRVAEKGYQNAGVIVGNTLTEGLGGGICQVVTTLYNAVLLADLDIIQRGNHNIPITYAPIGLDAAVAYDALDFKFKNNSSNHLLIKTSMHGNSLTIKIYGNDGEKNNVQLESLQEGAQGYRVKQRVVTVDGKEIRRDALPDSYYLPVEQ 444
247 0.000e+00UniRef50_B6FWG9 VanW-like protein n=1 Tax=[Clostridium] hiranonis DSM 13275 TaxID=500633 RepID=B6FWG9_9FIRM  ali  36  29...........................................SNKIAENVIVNGINIGGMTKEEAKNKIK-VFDTNEFTLKSEERSWKLNLDELNFEYDIDKTVENAYDVDRKGNIFSNMFDMKSMLGHETNVRVAIKYDXXXXXXXXXXXXXXXXXXXXXAKINTDNDKITIVPEKNGVVLNEAETNKAIEKRLSANKFK-AEAVVKLDEPKIKKSDLEGMDKALGTSVTTFK-NNYNRTENIKIATNASSGVILKPGQEYSFNAIVGKRNKANGYKSAPVIVQGEMQEDLGGGVCQVSSTLYNAALKSGMEIVNVKNHTIPSSYVGMGRDATVTDSGIDFIFKNPYKHNVYIQNYVTGGSIVCQVFGSKADEQNIEIEVDKASRNGYVVYRIYKDKDGKQIKKEKIATSSYPKQN. 428
248 0.000e+00UniRef50_A0A1T4QD25 Vancomycin resistance protein VanW n=7 Tax=Halobacteroidaceae TaxID=53434 RepID=A0A1T4QD25_9FIRM  ali  25  33..........................................NQDVIFSGVRIEGYDFSGLNRTEAVEYLKEPILNNPIVLEGRNNSWLLAPHKIELDFKKETAINEAFKIGRRGNILTKSIEIWKTARDGYDIQLELTYNEKKLKDRLKKISRKVNSEYKNAYLDLGTGKV--IDGKKGRKLNIKKSKNKIIGRLAELEDLPIRLVIEEKDARVNKEEVKGLMNQLSFYVTVFDIEDKNRVKNIKEASQRINGLLLMPGEVFSFNEVVGPRTLKAGFKEAIEIVNQEFVSGVGGGICQISSTLYNSVLLSNLKVVERQNHSRPVGYVSLGRGATVYYDYLDFKFKNNLSIPIMILSKVIKDRIIVSIMG-ESQNYEVQISTVREGRNGYVVVKKRVLINGEVVNESIVSKDIYQPIDE 437
249 0.000e+00UniRef50_L1Q474 VanW-like protein n=6 Tax=Clostridium TaxID=1485 RepID=L1Q474_9CLOT  ali  30  124.....................................NLVKSYNDKVYPMSYILDKDISGMNKDQLHKTLEEILEEKEIEVTIGDRKFEIARRALDLDIDFEAIENEVLNYGKDNKFFEKLKLIRD--PEEKNYEVKLTYNEEAINEFIQKIATEVYVEPSDASININGGEINITDGQIGSELDSEKLTNEIKSVVEDGGNDVVTLEIKDVDPNITAEALQSVNGIIGSYTTYFSAGPSG--TNIALGALDIDNTLLMPGDIFSTVDAIGPTTAEYGFVLANTYVDGQVVPGYGGGVCQIATTLYNAELRSGIVPLERTNHMMTVGYAPIGLDATIGDYEPDLVFENPYEYPIVIKAYTSEGSLTVEFWSNTNATNGITYEPKPSGSLYAETYLYGYDADGNVVYEEYLNSSSYRP... 506
250 0.000e+00UniRef50_A0A0K9NEG0 VanW like protein n=14 Tax=Clostridiales TaxID=186802 RepID=A0A0K9NEG0_9FIRM  ali  25  52...........................................EHKICDNIYIGNVNVSGLTKKEARELMKEHLQKDKITMKVGDKSADATLEEMGLSYDIGKVVDKAAGYGKKGRLFTRYRQIKGLKKEKLVLGEGLVLDAEKTKAVIDERVEGLADHAVDASIAKSGDSFEITKEKKGETVDEKASLEMMVDYLNDRWDHKVKMAVKTEEPSIKAKDLESIKDELGSFSTD--AGGGERWKNLKAGVDRINGTILMPGEELSVHDATAPYDAEHGYVEAGSYENGQVVDSFGGGICQVSTTLYNAVLYSELEVLERYPHSMLVAYVDPSRDAAIAGDYLDLKFKNSYETPVYIAAEIDSNQMRFTIYGKDDRAEGRTVEYESSPHTGARLWKVVY-QDGAEVSRDIINNSTYEKSDQ 461
251 0.000e+00UniRef50_D7N8Y9 VanW-like protein n=5 Tax=Peptoniphilaceae TaxID=1570339 RepID=D7N8Y9_9FIRM  ali  29  31...........................................SEKIHRGIKISNIDVSELSVEDAILKIEEENKDAKLKFSTEEMNYFIPYKDLGYTLDVETAVKEAYLIGRSNSIIKNFFDIIYTSIVHKNIELSESFSVEKVDATINFLVEKVYKKPKNAEISYSENGFNLSKEEQGSYLDSKKLKELIFHDIDKKED--IQLPILKSEPTVYIKQFEGIDGLLSEFSTDYSKSEDNRKDNIALGASHFNDFILKSGEEVSFNNVVGDISLLTGFKDAGIIINGEFDRGVGGGICQVSTTLYNALIRADLDIVERYNHTRPISYVPLGTDAAVSQGYKDLKFRNNLNHNIYFKAFADGNELKFQIFGNKADREEGKEEVKKPGAKGYVTYKNI-IKDGQIVETQKISSSNYIAQDK 436
252 0.000e+00UniRef50_G4D546 VanW family protein n=1 Tax=Peptoniphilus indolicus ATCC 29427 TaxID=997350 RepID=G4D546_9FIRM  ali  26  4.........KISEKMKDKRVVAAMCVGVIFLISLLYYGNVSKSTN-IYGGVRVGDIDLSKLSKQEAYEKLSKQLKNKNMSFLLEDKTIEIPYEQLGYNADIKTAVERAYDVGRTGNVFIDYINIVTPFYQK-NITLNEGFEVSSLDKSLAYLTDKVFKEPVNADVVTTKEKFKVLKSETGRYLDVNTTRDSILSNISKNE--VIPLKVNISYPKVTEEKFEGIDAILSEFTTDYSTSAAGRKANVAIGAQFFNGLVVEPSQNISFNGTVGEISVKNGFQKAGVLVNGELEQGVGGGICQVSTTLYNALLLSNLQIDERHNHTRPIAYVDIGTDAAVVEGYKDLKFTNNLPHRIYLKSEADGKKLTFQVFGNKADKYENEEEVESSGAKGYSYATYKKLKKGETETTEKISNSYYLPKDK 440
253 0.000e+00UniRef50_A0A037ZBE1 Vancomycin B-type resistance protein vanW n=3 Tax=Clostridium TaxID=1485 RepID=A0A037ZBE1_CLOTT  ali  29  28......................................YTKSWENKIYPLTFINGIDVSGKEKNEAIQILKSNLKDGSILIKTEKRNYTLQLSKTNPQYDIEGSVNKALLYGKDLSFFKKASEIKN--PKKKDLYINIKYDKNYIEKFIANIEKDINKVPINASIKTSPGKLHITRDVEGIRLDKKNLMDNIIAKINTSNNNEIIAKTESYSGNITEKKLKEINSIISSFSTDFSASPEGRITNIEIATNALNGILLLPGDIFSFNKIIGNTTAEKGYREAPIVINNKLEQGLGGGLCQVSTTLYNAVTMANIKPLERTNHSIPPAYIEPGFDATVSYKEIDYKFKNTLTYPIYIEGYTANGKLIFNIHSNSSNDIYEKIEPTQSSKPGYKVKVYIGYENKKEISRHLISNDIYKPVDE 438
254 0.000e+00UniRef50_A0A1J0GCJ9 Uncharacterized protein n=1 Tax=Clostridium estertheticum subsp. estertheticum TaxID=1552 RepID=A0A1J0GCJ9_9CLOT  ali  30  44.........................................KYKLKIYPQVWIEDTNIGGKTKTEAKNAIIQKIAKKNITIKINNKQYTIALSKLDMKYDYTLAVDEAYDIGKEGNSLKKYFAI--TSPGKKNITLNHTYNYDIVDTVLKDIIKDNNKKAVDATIVRNNGELIVTKEEYGRSIDSASLKKEIKENIKQEQNLLIESKLINIEPKIKKNNLEGINTLISSSTTNFGNSNESRSENIRVASDSINGHIVMPGDLFSFNDVVGERSAKKGYKLAKGIVNDKVVDDLGGGVCQVSTTLYNAILRTNIASVERYHHSLPCSYIGKGLDATVSFGLLDYKFKNTYSYPIFIESGIQNENLTFNVYSNASSNKKYKIYNKVTGNH-VNVFR-ITYENGNRLSKVLLYTDK...... 420
255 0.000e+00UniRef50_UPI000289FF9C vancomycin b-type resistance protein vanW n=2 Tax=Clostridium TaxID=1485 RepID=UPI000289FF9C  ali  30  31..........................................FEKVVYPNVYVEDIYIGKLNEEDAIKKIEKKILDKNIIIQVEQEEFKISFKELGIEYDIQKAVKEAINYSKDLNVLKKFITLIKGDKNYINIDLK--YNEKAVDGIIYSIESDVNIKPLESEIKIDNGVIQITEDATGIKLESELLKKDILKEIESKQIEEIVGNLVTWYPKKTKEKLKTINRNITEFSTEFMNSAYSRKKNIKLATEAINGKVLMPEETFSFNEVVGPRTASKGYERANVISGNRYIEDIGGGVCQVSTTLYNAVLKSDLDVLERRNHSLRVKYVPLGLDAMVSYGASDLKFKNTTDYPVYIYGEANENYVTFKIYSNNSAKKHFEIETKKAGKPGYKVYKK-TYVDGKLVEKKLISKDIYK.... 436
256 0.000e+00UniRef50_E0QHZ7 VanW-like protein n=8 Tax=Peptostreptococcaceae TaxID=186804 RepID=E0QHZ7_9FIRM  ali  37  48........................................LMNTNTIYDNIFINGVNVSKMTVEQAETLLKDKFKYGELVLKKEDLELTQDLSQVGFSYDVSGSVKKAYGIGRNGSFFGDIFQVIGLKTGKKEIETKEGYD--KLDKFYEQVSKKVNRPAKNATITIDGQGIVVTDSETGFALDLEKLKKDVQTAIKQTEDKEVTIPVTSTQPKIKTEELKQINGLIASYSSEYIQSNVERSYNVALAASKVNNQLIMPGEEVSFLNTLGNVSQKNGFKISKIIVNNEFQDGVGGGVCQVSSTLYNALLMSGMGITSRTNHTFPIVYIPTGRDATVANDGPDLKYKNNYDFPIFIKNYAYNGHMVSEVYGNVEKAKRYEIVVEDKGHIGYTTYRII---NGQKL---VVSRDTYAMTPK 451
257 0.000e+00UniRef50_A0A2M6XCX4 Uncharacterized protein n=1 Tax=Candidatus Shapirobacteria bacterium CG08_land_8_20_14_0_20_39_18 TaxID=1974883 RepID=A0A2M6XCX4_  ali  23  38.......................................KKQYSGRVYPGVNLLSDSIAGKNRQELDDILAEKTLDQKIVFIWKEKKWEIEPQEIDFSVDTNAIIDEAMGLGRE-TDGGNYLGIYRLLVSPKNLELKYKFDQVKLTTIFNAMSLQINQAVQEPLFDFKQGKVIFKVSKEGRKIDREKIQQLLILTFSRLSPSKAELPVLVVKPHA-ESDLSGINDLLGEGESFFLDSIPNRVHNIVLAASNLHGIVIPPGETFSFAEKIGDISQKTGYQRAYVIKSGKTVLDDGGGVCQVSTTLFRAALNAGLPIVERQAHAYRVGFYPPGLDATVYPPNLDFKFKNDTPAYLLIQTEIDKKRLVFKFYGTSDGRKVEMQKPIDSAHWGAKVTRKVWFSNGEL-KEEKTFISNYTPWP. 462
258 0.000e+00UniRef50_UPI000DE51FA9 hypothetical protein n=1 Tax=Vallitalea guaymasensis TaxID=1185412 RepID=UPI000DE51FA9  ali  29  45...........................................RDVIYEGISIEGIDIGGLSKEEALDKIDEKIFDKEIKISYEDKIYTKPYNYFEFKSNYKEIVDKAYNLFKTGKLKERYNKINKLKEDKIDYSVENVYNEEKIKEFVSSIKNDFNIEPKNAIIHRKNSEFIIDKEVNGLKLNVDTNVANLKNAIDNFK-QELELVVEVTKPKYTKEYYSNIKEVIGEYSTA-HNNNEARTQNLRIACNKINGTILYPGQDFATHVAISPISSKNGYREAPIIISGEVKDGLGGGICQVATTLYNAVLMAELKVIERQNHSMPVSYIEKGKDATMSGSHVDFVFENSSNYPIYIESYVYGGKLCMRLFGNDERNSSRKIKTKRKAINGYKVYKLIYVND-KLTDKQLVNTSYYKPV.. 449
259 0.000e+00UniRef50_A0A1V5NV97 Vancomycin B-type resistance protein VanW n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1V5NV97_9FIRM  ali  26  32.........................................KSDGLIPQGVSIKGIPVGGLSTAEAARKLENSLASNNLIIEGAGNNCFINLADIDAQYDCPTSVNNALIYYNKVTYANQLINILSLRARPVEQTLKISFSREKIEERIKGIKDDWDKPAVDATVTLSGDEVVIIPATMGYQLDFEKTVKKTIDVLSEG-NLQVTAAGQILKPGITSEVLAGIDSLLAEFSTTFDEGAVNRSHNIALASSTLNGCLVKQEEIFSLNKRLGPRLADTGYLLAPVFIGDHLDLDIGGGICQVATTLYNAVILADLPVLERAPHPLPVSYVAPGRDATIAGDYLDLKFANNNDTPVYITSKAENGTLTIAIYGQKDSLPEGEIKEINSGKHGYKVYKEV-LKNNEVISKTLIS-SYYEPENR 437
260 0.000e+00UniRef50_Q0AZP7 Uncharacterized protein n=3 Tax=Syntrophomonas TaxID=862 RepID=Q0AZP7_SYNWW  ali  26  43..............................................FMPGVKIASTTVGGYTNKQAASRLERDLEDTPVIFYYQGYSFASKLEELSYPINYEEAVNKVWQQEQERDWPSKLTNLDGSR--EIFYPLKLEYKPEIKAQMIDEWNKVLGVAAEDARLEIDKQKLVLIPARKGLKVDPEQTFANLPQEWGAMKEIKIPITMQEEWPQVKDEDLSNMGE-LSSFSTWFNVNEINRSHNLYLASSAINTSMLPPGEIFSFNRRVGERVIETGYRDAMVIVNGKFEPGLGGGVCQVSSTLYNTVLLAGLEIVERHNHALAVAYVPVGRDATVVYGLQDFRFKNNSPYPLYIRAWAQAGKLTMTIYGNLTEKRNGQEKIDHAGIQGYVVFRNYMDDEGRLLKSEQLASDYYKPLDK 443
261 0.000e+00UniRef50_UPI00038180B3 hypothetical protein n=2 Tax=Selenomonas bovis TaxID=416586 RepID=UPI00038180B3  ali  31  34..........................................NHNRVILGVQSEGQSLAGMSETEARQKARTKMKKTALIVTNGPQHWDIQAADIDLTPSVEQAVREAYDTGRNGSPLTNTLTQMRIALFGKDVRLTATYSDDKLQSKLSAITASLARAPKNASLTLSKGNIEHHMALTGRQADTSALYDTVAPKLSALATVRTEIPVEETEPVITDDALASIDGVLASYHTQYTPG--NRGHNITLAAGKLNGTLVKPNDIFSFNDTVGLRTAAAGYKVAGVILDGQLADGIGGGVCQVSSTLYNAILLAGLTPTARTSHALPSAYCPPGLDATVADGQIDLQFRNQLAHSVYLLTNADGHTLTVYILGTRADLGGKTIRLESTGSRHPSVYR-LYLAGGQVIEREFLHTDSY..... 409
262 0.000e+00UniRef50_R7CCK7 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=R7CCK7_9CLOT  ali  29  35...........................................RGLICNGVFVETVNVGGMSEDEARTAVADEYLQRTVEVDVNGKTVSATLEQLGYNCEVGDVIAKAMQVGKDGNPFTNYAKIREIATTPLVYKLKYDAKEKKIRTFVNKKCKKKCEKAKNAKVKRENGTFVYTDAKEGSTIDVNSTAAQIRKAVESGDAIRVKADVTIQEPTVTKDLASRCKDKIGSFQTNFNAGNVSRSKNLSNAARLINDHVIYPGETFSVHDTISPLTEENGYYAAPSYSNGEVVDSIGGGVCQVSTTLYNAVLKAELEVVERSPHSMVVSYVKPSMDAAIAGDYKDFKFRNDTEVPIYIEGGVYSGTIYFNIYGEETRKPASYTKVTQEAHVGYKAWKIVKE-NGK-TKKTQINSSTYQAVPR 444
263 0.000e+00UniRef50_UPI0004114645 hypothetical protein n=1 Tax=Ruminococcus gauvreauii TaxID=438033 RepID=UPI0004114645  ali  24  1..........MQKSRVATNIAIFIICLFFSMISARQVFADAETSPVILEGVFIDGVDVSGMTREEAVLAVADHMEDIKIQMHIGDHIVSATAGELGLYWKNEDVVDKALAFGQAGNIVSRYKAKQDLQQETVRFVLEYGVKADTAKAMLNEKCVPLDCEPQNASMTRTEDGFQIVKETQGVKIKVDESVEVLSEYLSNLWRGVVELPAEITEPEHKSSELEQVQDILGSASTDYSSSSSARAQNIVTGTGFLNGSVLYPGESFSVESALVPFSAENGYEPAPSYENGDVVDSYGGGICQVSTTLYMALLRAEIEITERYNHSMIVKYVKPSMDAAIAEGSKDLQFVNNLDAPVYIEGYTDGGEVGFVIYGTASQDPLGTIRQTSSSHTGYTAWKTVT-VDGVEESREQVNSSTYNMTP. 441
264 0.000e+00UniRef50_UPI000405C88A hypothetical protein n=1 Tax=Veillonella magna TaxID=464322 RepID=UPI000405C88A  ali  30  27...........................................TGRAVQGIYLDSKDVSWYTPEELREEIDRQFESGPTTLVIVDKKQTVSSKDIGVRANREATVEAIMAYGYEQDLWTYVTHRLQALLSPVRYHLVYEINEPTGESFLRELGNRLDAPGKDAFLTYESGKVIHHKAVPGKRLDIKATLAALKENARAGQLETLPLVIDTKKPKIGDSDIAPITTLLAVYTTQFNPGDENRTHNIQLATDKINGVLLGPGKTFSFNDVVGERTAEAGYDDAPVFMDGKLVPGIGGGICQVSSTLFNTALLSGMTIDERTPHFEPVGYIPAGRDATVAYGYLDFVFHNPYTHPVYIRAVTEGDSLVIYMFGTEADKPKVTVETIREGHNGMSTLRHITKADGS-IKTDR-FESVYDPVD. 428
265 0.000e+00UniRef50_A0A1I6YEH2 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=10 Tax=Selenomonadaceae TaxID=1843491 RepID  ali  29  35..........................................NQNRVIMGVQANGKSLAGMTKKEVHDFFQQALKRPAAVLTYKNRQWSIAPADIDLHGKVNEAAEAAYAIGRNQNGISNMITQMTCALVGRNVTMTAAFDKDKLDAQLAKIQQQLDTPPVNAEAQLKNGTIKKTPGVIGLTLDTKPIAEELAPQFEALKTAKVDLQPQEHPPFVMDADLAAIDGVLASYTTRFYPGD--RGDNIGLAASHLQGALIRSQSTLSFNSIVGQRTYEAGYKDAGVIVDGEHKIDVGGGVCQVSSTLYNAVLLAGMTPTERANHSLPSAYVPAGRDATVADNLLDFVFRNPLPHPVYLRVSNTGSALTIYVLGTKADLQGQTIALVTEGSAKPSLYRIWK-RNGQVVDREYLHTDHYS.... 411
266 0.000e+00UniRef50_UPI00094ED3F8 hypothetical protein n=2 Tax=Ezakiella TaxID=1582879 RepID=UPI00094ED3F8  ali  27  37.......................................QILSSDLIYDGISVDNIDLSKKTRDQALEEVKESILNKNFKIIIDENNYESTLKDLGLEIDYTKAVDDAYNFGRRGSSESRLAIINEARENPINFETKTSINSDTLKAYIENINKQLLKEPVEAHVEFTEEGFNIIEGENGVEIDAEDLAKKIKDAVKSG-DESVTADVKVKEAKTSNEMLGRINGVIGEFQTPLGNGTQGRNENIRLSCKRISDRVIMPGESISFNDEMGEITAQNGYKMASTIVGGKYVDSLGGGLCQTSTTLYNALVRADVEIIERHPHSIAAPYVAVGADAAVWKGAKDLKFRNNWDFPIIIKSWVDNKNIYFKIYGTPRGRVERQTRVISGGRDGINASTKIYKQNGQKIKELGYLKSSYPMQN. 444
267 0.000e+00UniRef50_A0A1G7SN60 Putative peptidoglycan binding domain-containing protein n=1 Tax=Thermoanaerobacter thermohydrosulfuricus TaxID=1516 RepID=A0A1G7  ali  32  37..........................................NSKVIAKGIFVNGISIGGMTKEEAVNFLKNKIKSFSITAKYQDKDFVITSEDINLSYSYQEMVDEAYKIGREGNPIERVREIYVTEKEGKYFSFYPKYDENKLKEFVDKISQEIDKEPVNAKIKITGGVKQITPDVEGVKVDKEKTLKNLKQLIDETEKTEVEIVAEKVEAKISKSMLEMINGRISTFSTVFNLQDVNRSGNLAVAARAVNGTLLLPGETFSLNKTLGPRIIENGYKEAPVIVGNKLVPDLGGGVCQIATTLYNAILRADIAITERYHHSFPVAYVPPGQDATISGDVLDLK........................................................................... 345
268 0.000e+00UniRef50_A0A174UB16 Uncharacterized protein n=4 Tax=Clostridium TaxID=1485 RepID=A0A174UB16_9CLOT  ali  27  39......................................QVKAWDNKTYPGVTVKGVDLGGKTKEEVAQILNEKLSEKAINITVENKKLSYKYGDLNAKYNIDEVAEEAVLYGKDTSAYNKNKLIKNKSKETHEIQMSLVYDETQIGNIEKDIKKAVDISPVNATISKSGDSFNISSDKVGYTLDSTDLDAKMKEALNGNLGESTDLTLKEVQAKVKKSDLAKINGKMSTFSTQYKSSTEDRSYNIEFVTSLLNGTVLMPGEEFSYGE-LSQRGKGK-YKIGTMYVNNKVVPAEAGGVCQVSSTLYNAAMQANIRSTERRNHSLPVGYVAPGLDATMAWGGVDYKFKNPYDFPIYIEGYTQNKVVTINIYGRPSAKGTEVVEVKGAAGRKARAY-LVTYKDGKQINKELISTDTYAPQQ. 450
269 0.000e+00UniRef50_R9MQY3 Uncharacterized protein n=2 Tax=Dorea sp. 5-2 TaxID=1235798 RepID=R9MQY3_9FIRM  ali  26  20........KNRRKLKLLAIRGVISAGIVYCTVYGILYHYVKLPKDRIFHNIYIGGTEVSGMTADEAEKALLSRLEKKKVVMTVDGSTVEATLEELGLRYDIGRTVQKAESYAKTGNIWSRCWKIRRLAKEKVVLGENLVLDHGKAEGIMKERAVPLTDHAEDAQISHEEGQFRITPEKEGRTIDIKGSVSAIERILNEDWSRAVTMKQKTEKPAVTADQLKLIQDELGTFSTD--AGGGRRWQNLKTGADRLDGSILMPGQELSVYGRTSPYDADHGYVEAGAYENGRVVDSYGGGICQVSTTLYNAALAAELEIVERYPHSMLVSYVEAARDAAIAGDYLDLVLRNPYDVPVYIEGGIDDNQLRFTVYGKESRDPLGSVECVSDPHTGKTAWKIIY-QDGQETGKEKVNNSKYDKTDK 465
270 0.000e+00UniRef50_A0A243ILH2 Uncharacterized protein n=2 Tax=Bacillus cereus group TaxID=86661 RepID=A0A243ILH2_BACTU  ali  28  1.......MEKKNLKKGIIISFLLVVGIMIFQCYSYVISINKQLETKVLQNTTFEGTSLEGKTKKEVEQIIQNKLKNKKMIIPLPNKKQEFSYEDIGIFYDKRNIADQIFASQKKDGQWERIQLQKAAKKGKEDYSLTPCIDKEKLNQFIDKQLKEYTIVPVDAKVTLSADKFEVTKSKNGQQINKDQLSKILLDALKNKQEQ-VTIPVEEAQPKLTTEMANEIHNVMTEYKTSLANRNSNAATNVKIAASKLNGTLLAPGEEFSYKKTVGRANAENGYKESTVFSNGKVEKGIGGGICQVVSTLYDTAMYADLTITSRTNHSRRVEYVPIGLDATVDDDGPDLRFKNSYNHYIYIQSIVENGELVIRIYGKPMTKEVTLISKIDKETDKYSSYRTVK-QNGVVIDNQFIAKSTY..... 419
271 0.000e+00UniRef50_A0A1V4SKG5 Vancomycin B-type resistance protein VanW n=4 Tax=Ruminiclostridium TaxID=1508657 RepID=A0A1V4SKG5_CLOHU  ali  30  50..............................................FYEGVYIDGVNVAGLTKAGAFEKLENNYRQSSVELISDNSRWTLSLDSINFRFDFQSSIDNAYRLGRTGNWVHRISTIRSLAEKPVNFVVTAQYDKARLYSILSKIKKQIDFSGSNSTYEYNYGKIVYTKDINGTKMDIETNTRLIEAKLLNRDFSDICLDVEVIRPMIAVGDVKELKDVLSVFTTRFNSNNYSRAHNIELAGNRINNYLLLPGEEFSMDCALGPRTSSNGYMQAPIIMRSQFVAGTGGGVCQVATTLYNAVLLSCLEVTKRVHHSIPLGYVPPGQDATISEGYIDLKFKNNRDYTICIVSEVKDGTVTVKIIGRKRADQQVRIRVKERKGLKVILYRDSYNVQGALTNSEIISEDIYKPV.. 454
272 0.000e+00UniRef50_A0A1M6J237 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=2 Tax=Hespellia stercorisuis TaxID=180311 R  ali  26  53.......................................RKYNTNTILEGVRIGTLDVSGMTQKEALAALDAQYGGAALTMKLDDRSADAAYAELGLKYDEKALVNEAMNYGRTKSLWSRYWAIKKLKKEEKVFEPEYTLTKKSVQAMVDERIAPLLNPPVNATLSRSGETTVVNEGTPGEVIDTAASIKSVEKILNKNWKGTVMLADTEQEPEITGKDLSGIQDLLGAYTTFYSADGTGHAQNVEQGAKNINGSLVMPGETFSTNDTIGPEDEEHGFAKAGSYENGTVVQTFGGGVCQVSTTLYNAVLLAELEVVQRDQHSMVVAYVEPSMDAAIADDVKDFKFKNNLENPIYIESTLQDGNITFNIYGKETRDPNRTVEQVIQAYPGISAWKIVYE-NGEEVSRDVVNTSHYQATP. 466
273 0.000e+00UniRef50_R5D6I6 Uncharacterized protein n=7 Tax=Clostridiales TaxID=186802 RepID=R5D6I6_9FIRM  ali  26  56........................................KYPEKKICDNVYINVVNVSGMTREEAKRAMEEHFEKQAVVLKTGEKETETTLKDLGFQYKKEDAIEKAVSYGKKGTLLSRYRKLRRLKKEKTKINMKLALDADKTEKVLKKQAVPLAPHATDATIARVNGEFQITSEKKGKTIDIKETKKLLVQTLNRKWNHEVTLPQKTEHPRIKAADLKNIKDCLGTFSTD--AGGGERWKNLKNGAEKLNGTILMPGDVVSVHDITSPYDAEHGYALAGSYENGQVVDSYGGGICQVSTTLYNAVLYAELKVIKRFPHSMAVAYVDPSRDAAIAGDYKDFRFQNNYKDPIYIEGGIDGNQLTFSIYGKETRKESRKLQFESEGHTGARLWKIV-IQDGKQVSRKVINNSTYNKSDQ 468
274 0.000e+00UniRef50_A0A0G1KDK6 VanW family protein n=11 Tax=Candidatus Gottesmanbacteria TaxID=1752720 RepID=A0A0G1KDK6_9BACT  ali  23  41..........................................YENRVFPPVVMQGIPFGGKTKEDVVSYWNKAFDDIEIQLVFETHSATLSSHVLAPGYDATLSATQAYLVGRSPYYLSNMNDR--LLKKRVDLTPVFLWNKDYVHSAIKTLAEKINIPAQDPLFHFSGGKVAFQPSKDGRAVNEQKLFSLVENSMASEKTLTIPIPVEVTRPTSQMTDVNGIKELIGRGYSQFTGSIPGRIHNVALAAAKLNGILIKPGETFSFNQTIGDISAATGYQSAYIIKNGRTVMGDGGGVCQVSTTLFRAALNAGLPITERHEHSYRVHYYEAGLDATVFDPTDDLKIKNDTPAHILIQTDTDNLTLTFELYGTSDGRPKGVIKQVDFAAWGAKASFRYKVRDGETII-DQTFNSNFRPWQ. 458
275 0.000e+00UniRef50_A0A0G1ZH12 VanW family protein n=5 Tax=Bacteria TaxID=2 RepID=A0A0G1ZH12_9BACT  ali  23  42..........................................YAGRVLPGVQFLEINLGGQTTEQSQILISDRVGQTQIKLEYSGQLWELDPNQFGFELDAVKLANEAMRVGRRGGVWQQLEERGYAILSARQTDLVHTFDQAKLITYLQEIATAIDQPQRNAHLIIKNSRAELVTSQDGLALDVDATVVLIAQNILSA--SAISLPVTVTKPSVTLADILGINTLIARGVSDFSGSPKNRRHNIGVGAGKFDGVIIAPGDTLSFLRVLGTVDSSTGYRPELVIKGDETTPEFGGGLCQVSTTAFRAILNGGLPVVERRNHSYRVAYYPPGTDATIYQPYPDLKFTNDTPGSILMDTYIEGSKLYFDFYGTDTKREVGETKQVEIAHRGADAYRRVY-QNKKLIRNDT-FKSHYIPWP. 453
276 0.000e+00UniRef50_A0A2K9EBA0 Vancomycin B-type resistance protein VanW n=8 Tax=Clostridiales TaxID=186802 RepID=A0A2K9EBA0_9FIRM  ali  26  9.................KKTKVTLIIFIVIASALFFGAFKFLNKKTFYKGVLIEGIDVSGLDINGAREKLDNFISSNSIRLRYEDKVWEIPLEDISYRFLLENTLIDAYKLGREGGVFARTGELINLMYYGKNVLVDSTYSXXXXXXXXXXXXXXXXXXXXXAKAEYENGRVKHDKEVIGKIMDVDKNVEMIENRILRRDFSAIDLQVKEVTPEIQLKDISHIQEVIASFSTSFNPNNVNRTYNIKLACERINNSLIMPNQVFSMDKALGTRTKENGYKNAPVIIKNQLIEGVGGGVCQVTSTLYVAVLKAKLGVVERVNHSIPLGYVEPGQDATIAEGYIDFKFKNNKEYPILLNAEVSGGQIIIRLIGKKEPVKEGEMVVEKRPVEGVAVYRETYDEKYKLIEREKISEDLYRPV.. 441
277 0.000e+00UniRef50_A0A1H9R775 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=22 Tax=Lachnospiraceae TaxID=186803 RepID=A  ali  30  29.............................................KIPNGVTIGSVDVSGMTHDEAYAAVSDTLSSANITLKGDEDVVTVAAADLGLTWTNTDVVESALNIGKEGNVVQRYKQLKDVANGGVALDLEYAFDDTMIMDVFAGKCDTFNVAEVDYGLTRENGTFSVVDGNTGYELNQTASIELLQNYITDGWNGSIALSVDVTEPKGSAEELAKVGDVLGTYSTSYKTSGAARSGNISNGCKLASGITLYPGDEFSMLENITPFTEANGYFLAGSYLQGQVVESFGGGICQVSTTLYNAVLRAELEVTERYNHSMIVNYVDPSEDAAIAEGGKNFKFKNNTDYPIYIDGYTTSSKITFTIYGVETRQPVGYVKVTQSAHNGIKAWKIVT-VDGKEESREVVNSSTYTMVPR 441
278 0.000e+00UniRef50_A0A1F3BCI1 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium RBG_19FT_COMBO_69_19 TaxID=1797289 RepID=A0A1F3BCI1_9BACT  ali  27  26......................................DAAFHAGRIFPGISIETLPVGGLTPAEAEGRLAEARLGRPLVVHLATEEVVFTHAELGLRVGTEGAVQRAFELGRLGPWWQRARTRLRIARGGASVPLRVELDRRALRRLIESLSKEISPVPQEAEVFVSRGEVVVRPGRPGRTLDVGASVRQIAAAIAAGATDT-DAVVAVTDPAFTTAKAQALRTPLARAATTMV-NNPDRIHNIELAASFVRGRLLAPGEIFSYNAAVGPRTIERGFKEAPVLIDDELVAGDGGGICQVSSTLFNVALLADFEILSRTNHSRPVAYLPLGRDATVVYDWLDFRFRNTSGHHVLLWAEVRGRRLIITAYGTATEAKGVEILVTDDAQPGYKTWRVVT-LDGVEVRRDFIGTSVYRPVAR 435
279 0.000e+00UniRef50_A0A1H6GLD0 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Selenomonas ruminantium TaxID=971 Rep  ali  28  35..........................................NQNRVAMGVYYGANRLSGMSREQVQDFFREKLDKDALILTYKDKTWKYSPEDIGLEVHADEAAEAAWRVGHEKNFAANAAEQLESASVKRDIALEVTYDAQAVEEKLAAIGREINVQPQDAYLTLQDGSFQLHPGHNGSSLPQAELMEKIGLYLKELHPLKLAITPEVNAPSIKNSDLSSMDTILASYTTSYAPGD--RGHNIELAAGKLNQRLVRTGEVFSFNNAVGTRTRENGFRDAGVIIDGRLAQDSGGGVCQVSSTLYNAILLAGLTPVERTAHFFPSTYCPPGRDATVADGLLDFTFRNQLPHNVYLFSSCSGTTVTIYVAGTRADLNGCQITLQTEGSSTPSVYRVWT-KNGQGISNEFLHTDHYDTPQE 417
280 0.000e+00UniRef50_A0A1I6YBV0 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Lachnospiraceae bacterium XBD2001 Tax  ali  25  1..........MNKNMKKSLI--LSAFLMMVGGLFFSQSVEAKAADTIAKGVTIEGMDVSGLTASEAAEKVGDYLEQATFTLNAEGKSIDATGADLGIH-SLTDVAAQAADYGKKGNPLACYMASADLEAGKKDFGVSVAADIHTMKTFLAEHEEDLVTVVVNNGLKRENGAFVYVPGTAGKKILINESVAATADYILKDWDGSIDLEVVSKEPEGSEEELKSVQDLLGSFHTSFGSSTTPRGINVANGTSKVDGTLLYPGESASVEEKLGAMTAANGYAPAASYENGKTVDTYGGGICQVSTTLYNALIRAELQIDERSSHSMVVGYVDLSMDAAIAEGVKDLKFTNNTDYPIYVEGYTEGGNVYFNVWGKETRDPNREVVLVEKAHTGYKAWKIVT-VNGQEVSRDVFNTSSYRATN. 441
281 0.000e+00UniRef50_A0A0K8J369 Uncharacterized protein n=4 Tax=Lachnospiraceae TaxID=186803 RepID=A0A0K8J369_9FIRM  ali  27  1..........MGKKFMFFYTVIALSVFMLFTGKTS--NVYAAEDPTITKGVFIDEVDVSGMTXXXXXXXXXXXXXXXXXXVMVDNSRVTTTLDELGYSYKINGVIEEALKIGTSGNLIKRYKEMKDIAHGGIKYPLEYSLDENKVREFVSVKVSEYNVEPVNASVYRNEGKLIYTNHVPGKQVNVEPTVLNILDKIKNSWDRTIEAYIQNVDPIYTRDIVEKCNTILGSFTTEYANSAEGRAANLANGAKLINNTVLYPGDIFSGYEHLAPFTEENGYFSAGAYSAGKVIDSIGGGACQVTTTLYNAVLEAELEIVERHAHSMTISYVDLSRDAAIAGTYKDLKFKNNTDVPILIEAYTKGRKITFNIWGCETRDPETYKKVTQSAHTGYRTYKVVYE-NGVEVDRILINKSYYSPAPR 443
282 0.000e+00UniRef50_A0A0J1FVW8 Vancomycin B-type resistance protein VanW n=8 Tax=Peptococcaceae TaxID=186807 RepID=A0A0J1FVW8_9FIRM  ali  28  69...........................................QHTIVDGVKISGINVSNMTQSQAKIAANKELLNQTVKLTDGQHSNDVKLRDLGLSISADKALKDAYDLSRTGSIYHRIVAKMDAA-KGVSFKFSSQWDDKKMQESLDKLFGQYNKPAIDATYKITNNTMLIEHEQTGLIYDVDALKSQIKAINYLNPVSELKVNFKEQQPKVTAAQLEGITGLLASYTTHFDPSQTARTENVQLAAKSLDMAVIKPGDILSFNNIVGERTVAGGYKDAYIIVNGKFIPGLAGGICQVSSTLYNTGLLADLSVVQRTNHDLAITYAPLGQDATVAYPDLDLKFRNNTGGYVLVRTRTTSNTLTIDLYGKKPGQEVGESVVKQQGQPGYVVNSIRTVKDGKVVSSEPLQKSVYKALPK 475
283 0.000e+00UniRef50_UPI000560C35E VanW domain-containing protein n=1 Tax=Butyrivibrio sp. MC2021 TaxID=1408306 RepID=UPI000560C35E  ali  30  30.............................................TIANGVYIGTVDVSGMTVSEASAAVEEELRSRKLTLAAADQSLTVTGSELGIAWANKGVVNEAYQLGHNGNIVQRYKVLKDLQNSSKVFDLNLSYDNEALTAILDRCSENFNQEKVNFLLTKTAEGFNITDGQAGCFVDTAESAGIIKNVIGSEWSQDIQLSVKEDKPLGSHEELALVKDVLGTFTTSYKTSGSARSANVANGCSLINGTTVYPGEEFSVLEKITPFTEANGYFPAGSYLNGLVVESVGGGICQVSTTLYNAVLLAELEVTERHNHSMIVNYVSPSADAAIAEGGKNFKFINNTEHPIYIDGYTTPDKITFTVYGVETRPSTYESEVTQSAHLGYKAWKIVRE-NGEVTEKTVVNSSTYKMVPK 440
284 0.000e+00UniRef50_A0A1M5RRK8 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=2 Tax=Clostridium TaxID=1485 RepID=A0A1M5RR  ali  29  44....................................YSQVKKWDTLMMPKVIIQGVDYTGKTKEQVLDDLTAAYGDKQVEIKAGDKTYTIGYSELDAKYNIVETLDEAFSYGRDLDFMEKYKLIKN--PEEKEFNLNFTYNEEPIKDVIATIESEINKESAEASIKYGNGKFEVQDDIEGAKLDSEKLSMDINEKIQSETDEVVEAPIEVLTAKKTGEMLRSIDSNVGSYSTSYTTSSYERSTNIALATKAIDGTLLMPGEEFSFNDVVGQRTAAKGYQVAHVILNGEYVDGIGGGICQVSTTLYNAVLIGGLEITTRRHHTYPSTYVPVGRDATVDYGNLDFEFKNNKEYPIYINAYTSNKKVYFTVYSNSELTKVGKEVVDKAPHTGYKVYRTSY-VDGKKVDSETVSSDYYVPVD. 456
285 0.000e+00UniRef50_C9LS51 VanW-like protein n=4 Tax=Selenomonas TaxID=970 RepID=C9LS51_SELS3  ali  31  33...........................................RGRILYGVQSEGRSLFGLTQKEAEQYFKKKLASQTVSLRSNGAVWKIQPQEVNLQPAAAAAAEEAYNSGREGTFVLQAVTQIKNAIYGCNIPFTASYDESLLQAKLEGIAEKLLVQPVNAACEISNGAIHHIPGKSGKKLDIAASLKALDKPLKEMQAANLELPLEENPPFVRTEDVANVNAVLGTYTTYYRHGA--RGDNIAIATQQLNGVLIRSGANFSFNNIVGTRTANAGYKNAAVLVNGKSVPGIGGGVCQVSSTLYNAILLAGLNPTERFSHFIPSSYCPPGLDATVADNLIDFQFMNPLPHNVYILASADGRKITVQVLGTQADLQGKHISIETVGSSRPSVYR-VYSANGQVVEREYLHTDSYS.... 407
286 0.000e+00UniRef50_C6LD51 VanW-like protein n=2 Tax=Clostridiales TaxID=186802 RepID=C6LD51_9FIRM  ali  25  2............KLKKRFLGTLVFAFVMTGAFCAAAEDDV-----RIDNGICIGDIDVSGMTYDEAYALVKQRIRSAVITVQVGEDSIETTASELGLQWNNKSVVQDAIDLGNSGNPVKRYKERKDLDQETQVLSLEFSANANAVRDFIEEKCKQFEKEPQNATISADGGGFDLQEGVTGQVINVDESVKAVQDYIANGEDGTIALSVEIEEPEGNTEDLESIQDMLGTYTTYY-GSTAGRNMNVERGAELINNHVVWPGETFSVCDQLVPFTAENGYELAPEYSMGQVVQGYGGGICQVSTTLYNALLLAELEIVERHNHTMTVSYVPYSMDAAIAEGSMDLKFCNNLDTPILISGYAYGGELTFTIWGKETRPADRTINQVQSAMAGVSAWKEVTY-NGETT-TELVNTSYYQATP. 436
287 0.000e+00UniRef50_A0A1F6JIK3 Uncharacterized protein n=2 Tax=Candidatus Levybacteria TaxID=1752719 RepID=A0A1F6JIK3_9BACT  ali  25  50......................................YQGIYKNYIYPGIIMEGRDFGGKTKVDVKNYFNEKIGKSSFVFKSDYGIATVSAKEIDFGYNSTLLSEQVYLLGRSENFLSNASLLLQAYIIGVRLPTSYSFSEAKLGEILKPIKVQIDKKPVDAQFKFENGRVTFKPSENGRGVDDELLEEQLREKTLTVASAPKPISVVITIPNVTTEQVNGIKELIGVGSSLFYHSIPSRIHNIALATGRISGVLIKPGEVFSFNKALGDISAFTGYKQAYIIQNGKTVLGDGGGVCQVSTTFFRALLNAGLPIVERHAHAYRVGYYPPGYDATIFSPSVDLQFKNDTGSHILVQSEVDNLSLKFYLYGTKDGRPVGTIKQVDFAASGASVYFNYTEKNGKTIINEKYF-SNYQPW.. 472
288 0.000e+00UniRef50_A0A0F2PHN9 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c8a TaxID=1629715 RepID=A0A0F2PHN9_9FIRM  ali  23  7...............KTGIIAALICVQTASALTAWTMLNNFRGDGGIPRGIKISGVPAGGLTKLQAEKLFEETFGGETLIIQAAGQSVHIRPEAVDARLDYAYAIKQALDLKEQATGLTGALRELALLAGLYDIPLTLQFNHDKMTGQLAELKNLVDKAPRGATLTGDENGRILVPEQTGQYIDVPATLDKLRT-IRPPLPDTIQAVVVRKEAPVKTGDLEPLRNILGECVTELNPNQVNRTANIALAVNALHDTLVKPGAVFSFNDQVGERSAENGFKNAPVIDGTRTVQGLGGGVCQVSTTLYNALLAANLDIVERQPHTRPVGYVSPGLDATVADGQIDLRFRNDRSFPILINGTLEDGNLRVRLWGVKSDNPRGSQVVQNPGKRGYVVYKVAKGSYGET--RQLITRDYYQPESK 437
289 0.000e+00UniRef50_A0A1C5SAC6 Uncharacterized vancomycin resistance protein n=2 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1C5SAC6_9FIRM  ali  29  82.......................................EALNTNTFYDGILIGGVDVGGMTKEEARKALEEKLPQADAELTYGEKSWHITKENLTFTSNLDEVLEEAFEYGRKGTDEERLEQVRALEKKPKDFEVKTELDEASIDAALEPICAEINREPEDATISASTGKFSFKEGVKGVQVDEEKLKQDVRAVLLDSEDGTVAITTKEIDFNINSSDLEGNIQKLGSYSTV-STNTVDGTYNMTKALLSINGTCVKAGETFSFLGTAGPCGKAQGYRPAGAIVGGRMSQAYGGGICQASTTIYGAALRSNVQIVQRSNHSIQSTYCPIGQDAAVNYPYQDLKFKNTSKYPLYIVTSVNGRTLTATFYGYQSPDYDRIEVTSQRAKEGITTAQRVYYKNGKVVKTEALTSSYYPP... 494
290 0.000e+00UniRef50_UPI0009DF47AA hypothetical protein n=1 Tax=Lachnospiraceae bacterium V9D3004 TaxID=1410632 RepID=UPI0009DF47AA  ali  30  72...........................................QGVIKDGVFIAGTDVSGMDYAEVNQALDNYIVSGSVELKVNKKTVTASLEDIGTECDTDSAISGAFALEEAG-----------------KVDLQFDIDEELFKEFIDRECRQYEVKPKNAKLSRVDGNFVVKKGKVGKTIDEAATRELLVNEINSSANIKVAAVINEEDPEYTSEDFGRVKDVIGKFSTNYQESQVQRSSNLKNAVGFIDGSIVYPGETFSVADTIYPLSADNGYKDAPSYQDGQVVDSLGGGVCQVSTTLYNAVLRAELQIVQRQNHSMAVSYVQASMDAAIAGDYKDLKFTNNTDTPIYIQGYAAGGTITFTVYGHETRPSSRKIEVTQSAHVGCVAYKIVYE-NGVEVSREKINSSRYQAEPR 467
291 0.000e+00UniRef50_A0A2S8SXH5 Peptidoglycan binding domain-containing protein n=2 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8SXH5_9BACT  ali  23  28........SKARTLRWPLWLGGVFALGACGVFAASGAYSSWASSSRIAPGVSIAGVAVGGLTQSEARAQLQKRFGELPLILKTGARGFEATLSDLGGQPSINATVKKAAKIGRDGNAIGNFVRVYGAKAAGERLSLPIEWNKSQLIAKLKAFDQSYTTRAVDARLKVDENGVQILPDQSGRKLNLGATAQQIQSKYFVGVH-EIKAFTRETPPQISAADLAGEDVLLASYPTRFNPGLTGRTANIRVACEAIEGKVLMPGETFSFNEMTGERTFRKGYRMAHIFEEAEVVDGLAGGVCQVSSTLFNAVRRANLKIVERNTHSLPVTYVPAGLDATVAWPYKDFRFRNKFSHPIYLRTTIRRSKLIIGIWG................................................. 401
292 0.000e+00UniRef50_B9J3X3 Uncharacterized protein n=564 Tax=Bacteria TaxID=2 RepID=B9J3X3_BACCQ  ali  28  2............KLSKILIGSAITGGILLCVGGIGGYQYVSKLNNTALPNTTFEGISLDGKNKKDIQAIINQKLDQKSLTYIFQNDKQTYTWKDLGINYKEKDVIDKIFK-EQEGNAMNRYKMRKQAENGKRDYKLTPQLNTTAYKSFMKDKYNETLKNPVNAELSIEGTTVNISQSQNGEKIDKEKLTDLTRQAITSG-TSDVTLPVTLLKPERSTEDIQGIKEVIAEYSTPMAGRNGNQSFNVNKSANTLSGVIVAPDETFSFNGRVGVTDAAHGYKSAAVYSQGKVIQSAGGGVCQVSSTLYSAALRADLGIVSRSNHSMPVNYLPLGQDAAVADYGPDLKFKNNTGNHIYIQAFSNGGSITIRIFGTNTGKNVEQVISRTNDKITAVTYKKVT-QNGEVISNGQISKSVYKSAPK 419
293 0.000e+00UniRef50_A0A1C6DFH0 Uncharacterized vancomycin resistance protein n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C6DFH0_9CLOT  ali  27  126......................................DELLAQTTIYPGIRINGVDVGGLTREEAQAKVDQALADIAIKLNHDGQDIALDFTKAGLTFDTASALDEAVSLGKDGEREARLQKIEELA-KGYDITVPMELDEAQLDAMLDEALNGIGVAAQDAKVTFHPDKFEYQEGTPGKEPNREEIASQLKTMLSQEKEGSIAVTLQDVQPAVTVAQLKEQTQLVSKYQTT-TTSNSNRNTNIRLACDSFQGRVLQPGEEFSFNNSTGERSTAKGYKAAPAIKNGQFVDEPGGGVCQVSSTLYNAVLMADLEVTERYHHSIKSTYVPAGLDATVNYGGADFKFKNNKDTPVYLAYSFANQQLTVYIYGAPTIKTVGEVVSIDPPADKTTVYKVYYDKDGNKVDTVLLHTDRYPAVQ. 543
294 0.000e+00UniRef50_UPI00068B8D48 hypothetical protein n=3 Tax=Firmicutes TaxID=1239 RepID=UPI00068B8D48  ali  28  37...........................................SDKIYPGVRVGKLGLGSMTKAEAKKKLEEGLLDKTLDLTYQDKHYRTSLRDLGYSYQIDAMVDQAYGIGRSGHKGSDFFASFYSLFR-QPLPIQGAFRGDKLDDYLHGLADDLFIMARDAQLSMKDNKVHLVQDRDGRYLDTNLTKEALENW---DGIQAISLPVFNRPADVQAKALEKMDSILGEFTSDYGSSEKNRKFNIALGAEKLDHTILKPGEKISFNDRMDQITKEAGFKVAGVIRNGEFDRGVGGGICQVSTTLYNALIRADVNILERHSHSRPIGYVKNGTDAAVATGHKNLVFQNDFNHPIYIRAQADGSDLTFQVFGSKEDKAKGETEVKESGSSGYS-YRTYKEKDGEVLEKKQISTSNYIGRDR 438
295 0.000e+00UniRef50_A0A1M5AAE8 VanW like protein n=1 Tax=Schwartzia succinivorans DSM 10502 TaxID=1123243 RepID=A0A1M5AAE8_9FIRM  ali  31  35...........................................QDRIAFGLRFDDQPLTGLTKSEAQHMFEKKIPDVPVVLTDGAKLYPIKRAAIALNADTDAALEKAYSAGRIGSRLEQITDALDCAIRGRTITLKGIWDEEKLQHELKKITASIERQPIEGCVWLEPTGIHHRPPAAGLHVDTEALDEELAPKLTELVPHTFQLPIETIPPKVPAEAFASIDAVLSEYSTFYNPS-SNRGENIAIAASKLNQVIIQPGEEFSFNGTVGGRVVSAGYLDAPVIIDGKVEQDIGGGVCQVSSTLYNAVLLAGLTPTMRTSHFYPSDYVPAGLDATVADGQIDFCFRNDLPHSVYLLAGASGGTLTVTVLGSSQDARSYGLTTEITGNPTVDVYR-VTYENGAVIDSEYLHTDTYD.... 410
296 0.000e+00UniRef50_A0A1C6IDN0 Uncharacterized vancomycin resistance protein n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C6IDN0_9CLOT  ali  27  8.STRKKRKYRVRNXXXXXXXXXXXXXXXXXXXXXXXXXXRSYESQVLHRGVVIEGVELGGKTPQEALALVQEQLAEINLTLTFEEESWNFDAESLGVTSDAQALIDQAFSQAKEMSWFDHLKMVLGF-GQGFSSPVTFSYDEEKVDAIITQVAEKVNVPMQNAKMEFDPNKFHVVAEVQGRQIDTEALDTNILSALMSDPQAQLEIPTKTIEPTLLASDLQKTTKLRGRFVTNLGNSSAARTHNVKESLKQFNGMVVNPGQEVSFNDTTGPRTAENGYQDAPLIASDKLQDGPGGGVCQSSTTIYNAILKAGLNSTVRAHHSFPSSYVDKGFDATVNYGYQDYKFINDTDLPFYIKTYVSGKDVVVEIYGEPTPKEEPEIVQDTEGRDGYVVWRIWK-KDGEEIKRELLHTDNYEA... 463
297 0.000e+00UniRef50_A0A1W2BI55 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=2 Tax=Clostridiales bacterium TaxID=1898207  ali  27  156.........................................LYTGRIYPGIYIDDQHVGGMTCEEAAAAIA-RLNGEDITVSVGNESWHVNTERVPVSRNTEEMVQRAWATGRTNTFQERIDQVSNLRSYPVTFVTKQDYDHEALRALTDGIVNYVNREPVNSSFNFETKAFTFTDDRPGAKIDPDDLYRQLTEVLDSGETREVRVVPEKITADITKAELMNSFGLISAYTTQ-TTKDNNRNTNIKLSAEAISGITVQPGETFSFNGATGERTAAKGYKEAPAISGGQSKDEVGGGVCQTSSTLFNAVARADLEIVERHAHAWPSHYIEKGFDATVNWPGLDFKFKNNTNQPIFIVAGYSNRKITVNIYGMSLGPGVGESKKTITGRQGYTTWKVWYQGD-RELRREVLFNTTYKAYQE 579
298 0.000e+00UniRef50_A0A1I2RGH5 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=1 Tax=Lachnospiraceae bacterium C7 TaxID=17  ali  27  5.............KMKKVLLALGICATAAFTVVGASNATKANESDKIEKGVYIGNINVGKMNSKEATKQVKDEFKTTKFTLVGPKGQVEATAEEMGITTDIDATIAEAKAVGKSGSLIKRFKENQDLKKGKVKINLRLEVNKQKTAKFLYSHKDELNIEAKDMTVSRNGNKFQVVDGKKGKEVCYEKSVYKINEFLEEKWNTEIKLVSKVVKPRGSKKELSSIKDLLGSYSTNFSSSSAGRAKNVRNGAAKINGTVLYPGDEFSVYKTVSPFTEENGYELAGSYSNGTVVESFGGGICQVSTTLYNAAIKSELDITMRYNHSMIINYVKPSQDAAIAGTFKDMRFKNNKKTPIYIEGICSGGVITFNIYGKETRPKNREVSSTQSSHTGYVAWKIVK-VDGKQVSKKIFNKSTYKASPK 444
299 0.000e+00UniRef50_UPI00085C8C5E hypothetical protein n=1 Tax=Cellulosilyticum sp. I15G10I2 TaxID=1892843 RepID=UPI00085C8C5E  ali  29  36..........................................FDKVFAERVLINETNISGLTRMEAYQKIQDSLNNKNLVIYKGDISYKIPFSNLGSEYNMEEVLDQAYAVGHQGNLFEKYRYMKNPPQKDTVFDLKHIYDKEKIHQTVEAYSSKFHIAPIDATIERKDRQFIVTPELEGQELDLVATVEKIFTVLDSEADIKIEAEVNKIPAKYTSESFKDIQSIVASFTTSFNNADANRNTNLAVAAHKIN-TMLLPGEVFSLAKQLEPINYNSGYRASKVIVNGRLEDGIGGGICQIASTLYNSLLLTNLDITMRQNHSLPVAYVPLGRDATYATNAIDFKFKNTTDYPLFIESYCENNKVYVNLFAHPSVKSEYEIEVINPPAPKYKLYKLYYKEN-TLVKKELVNNSYYRPR.. 444
300 0.000e+00UniRef50_A0A0E3W2S4 Vancomycin resistance VanW n=2 Tax=Firmicutes TaxID=1239 RepID=A0A0E3W2S4_9FIRM  ali  27  30.......................................KYFHADYFMPGVVIGGIQVEGSTVEEAESLLNKELEKLPVVFYHGEYEEVTTLHKLCQPVNVHGVVTSAWMDEKSRSWHEKITNLDGSR--KIVYPVKLEYRPEQVSSLVEKWNRNWGVPFRDSSLEVDARRLIVVPGSVGLKVNTEKTFKPLPQDLKESGQLRIPVVMTEEHPQVDEETLSNMGE-ISSYTTAFNAGEINRSHNLQMAANGINGSVVAPQEVFSFNQKVGKRTLEKGYRDAMVIVGGKFEPGLGGGVCQVSSTLYNACLLAGLDIVERSNHALAIAYVPLGQDATVVYGLQDFKFRNNTGYPVYLRAVTGGGRLTINVYGKLTARQNIKVKVEHAGSPGYVVFRTYYDVSGNVIKRQQLARDTYRPLNK 438
301 0.000e+00UniRef50_I4ABF1 Putative vancomycin resistance protein n=13 Tax=Desulfitobacterium TaxID=36853 RepID=I4ABF1_DESDJ  ali  23  41...........................................QNQFPPGSRLDDLALGGITPQEAKEKIQSWSKDKNLFLVYNETEIQFTPEELGITLDFERTWENL------------------SENTGKQTHSVLAINDLMANQVLQEKLAEFSRSAVDATFKVENDQFKITPATSGEAVNVDAFLAEVKKASLGDLPRRIPITSVEIPATVTTESLKAFDGVIGEYTTKYNAGDKNRTANLIAAAQKMDKVLLKPGESFSFNGTIGPRTAETGFKDAYIVINNEYVKGIGGGICQVSSTLYNAALLANLSIVERHPHAVVVAYIPLGQDATVNYPTLDLKLRNDSSSYIYFRTKVEAGNLTIKIYGKKTGAKVGAVIQEQSGSKGYKTWKIVTDAQGKETKQ-LLSRDSYAPTNR 428
302 0.000e+00UniRef50_T0MTE4 Uncharacterized protein n=2 Tax=Clostridium TaxID=1485 RepID=T0MTE4_9CLOT  ali  29  44..............................................IYPGVSIENIAMGGKTKEEAKNILVEKLEKGSIDIKVKEQVYSLPYADINIKYNIDEVINSAFEYGKDLNFYSQYKIIK--KPKEMNYNLSLSYDKEVVQGFLENADKTLNKEIVDATIAKVGENFQVASEKVKEEIDITQAFEEITKKIENRETESLETTIKVTNPKIMADDLKKIDTVISSFSTKFNPN--ERSINIQIASKAASGVVVMPGDTYSFNELVGDTTPDKGYREAPVIVNNKLEPGYGGGVCQVSTTLHNAVVRAGIIPTERMHHSMPVSYVPKGMDAMISYNIVDYKFKNTLNFPIYIHSYVLNNELIFSIYSNSTLKKKGQEVVDNIGSNGYKVKVYVTYENGESNKR-LLYNDYYEPVDK 443
303 0.000e+00UniRef50_A0A069RHA4 Putative peptidoglycan binding protein n=2 Tax=Peptoclostridium litorale TaxID=1557 RepID=A0A069RHA4_PEPLI  ali  38  29........................................FSSSDIIAKGIYVRDSYIGELTKEEAKNMLAQKYSVKTIDMAYDGNTFEINPEDIGFESDIENTVEDAFGVGREG--IADFIGTMALGEEKV-LDMEPVYDESKLDSIIEDIAASIDKAPNDARVSMAGGGINIKPDTQGVRVERDVLRESIGDILEKSVEANIEIPVETVNAKIRYEDVKGIRTLLGSYSTKYSASNLSRSENLKVASNSISGKILMPGQVFSMNETTGKRSVQNGYKMAKVIVKGKLEEGLGGGVCQVSSTLYNAVIRSGLEVVARRNHSIPSSYVGLGLDATVSYGSIDFKFKNNFKNPIYLQIKPQGGHISAQIYGYDEDKHNVSIEVEEQGRDGYKVYRVFMDSNGNVVDKQTLSNDYYPPMKK 432
304 0.000e+00UniRef50_D9SNN6 VanW family protein n=1 Tax=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) TaxID=573061 RepID=D9SNN6_CLOC7 :  ali  30  1..........MGKNKNTFIIKLSILSICVISIAGVFFSTVERWNDKIYPSVYVEDINLGGKTKEEAIKVMEEQYSQSVIKIKLGDVIKNTQLSNFEPKYNLEDTVAKAYEYGKSQKMMDKYSKINKPSMNQYDIDYDFD--YDKIDRFISSLASEVNRNPRNATVSSVNERVSVNEEENGYRVDTKKLKEDLLDSLKNIKSEEIEAKVDVIKPTITKENLKIIDTKISSFSSNYSINAEGRATNIEIATESLNGQVVMPGDEFSFNKIIGETTAEKGYKPATVIVENELKEEIGGGICQVSTTLYNSIIQLNIKSTERRNHTLTVAYVPVGTDAAVSYGYMDYRFKNTLKYPLYIEGIANEGILTFNIYSNSKAPKVETVEDEQAGLTGYKVTYLEKVVNGAVVSKEVISKDIYSPT.. 444
305 0.000e+00UniRef50_A0A1J0GL19 Uncharacterized protein n=1 Tax=Clostridium estertheticum subsp. estertheticum TaxID=1552 RepID=A0A1J0GL19_9CLOT  ali  33  25....................................YIRVKYWDSLILPGVKIENEDLTGKTRKEAQTIINDKYASKKITIVTDEKKYIIDYKMLEAKYNVDQTVEQALTYGKDRNMFQKYKAI--THPVSKQIKLTFEYNDKAVDKILKGIAKDIDKKAKNATITKDGEQFVVTNDVIGKQLEVDKLKNDIKSKIDAGVSKDIKAAVKDIKPKISEAALKTVNTRISRYTTNFSSSSEGRATNIALATGSINGKLLMPGDVFSFNDVVGERTALRGYKAAGVIIGDKLEQGLGGGICQVSSTLYNAMLSTSIVSAERIHHTISSGYIPKGQDATVDYGNLDYKFKNTFEYPIYIEGLLSNGNIHFNIYSNPTDPKTETIEIVKTGYAGFKVKVTRKYENGKLVNTEIINQDT...... 434
306 0.000e+00UniRef50_A0A1V4IHH6 Vancomycin B-type resistance protein VanW n=1 Tax=Clostridium oryzae TaxID=1450648 RepID=A0A1V4IHH6_9CLOT  ali  31  35......................................YAKKWNNKIYPGVKIENIDLGGKTLEEAKKAVEEKYLEKKITVNADGKQYTLNYGKLNARYNIDETVNKAYAFGKNYSMMKRYFTIKKSSEKK--YFLKFNYDKEYIDEFIKMVQQNVDKHPTDAKLEVSPGKFKIAADVKGYKLDTVKLKKDIIKSINGGENLTVATKVDKVESEKTRELLESVNSKIASYSTSYYTSTPGRVNNIERATASINGTLLMPGETFSFNDTVGERTAARGYQEAGVIINNKLESGLGGGICQVSTTLYNAMLKT--PIVERMHHSLPSHYVGLGFDATVDWGRLDYKFTNTLEYPIYIQGYNKNRVVYFNIYSNSSIKKKGEKQTVRASSDGHRVYR-ITYENGKQIDKKLLYTDFYRPID. 446
307 0.000e+00UniRef50_A0A1I4GN69 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=4 Tax=unclassified Lachnospiraceae TaxID=18  ali  27  2..............KKLFETALFTALFCIVLSATAFAKEA-----TVHEGVYAGSIDLSGMTESEVSQAISDYVKNAEVTLNYDNNSATVKAGDLGLTWANTEIAGEAVRVAQGGNLIKRFKELTDLKKQNKIFNIEYAVDAAKVKNALSENCAVYDKKAVNATISPNTGSFDIIDGSDGEELDIEASSSAISDFFKNGENASIALAVNTVKPKGDADTLRKMTDVLGTYTTNYKSSSNDRAKNVATGCAHINGTIVYPGEQFSVYETVSPFTEENGYALAGSYLNGLVVESLGGGICQVSTTLYQAVLRAELQVDQRSNHSMVVNYVPHSADAAIAGTSKDFKFTNNLDNPIYIAGKTEGRDITFTIYGIDERPSNRTIEFEQAAHTGYTSWKIIKE-NGVEVSRNRVNKSTYKAVQR 437
308 0.000e+00UniRef50_C0GK11 VanW family protein n=2 Tax=Dethiobacter TaxID=427925 RepID=C0GK11_9FIRM  ali  22  1...........................MFVFVALVAAGDYLYYLNRLYPGIYFKDLHLGGSTFQQAEKLLED----AQITFYGEGKSITFSLSAMGIELDEKEVLETGYWQGRPKSWPWTFKHRLSINKEGLFIPFRYNVNSNLFSHSTDFISSYFSREAENAYFDIDGSQAKLVAEKYGYVYDSREVKQLVLANLARPDPLEIRVPYEIISPEITMAEEKGIEGLMSSYTTKFDPSVVNRVHNLQLASAQLNNYFLAPGEVLSVNRVIGDTVAEKGYKKAPVIVGGKLSEGIGGGICQVSTTLYNTALLANLDIVERHNHHLTVLYIDPGRDATISYPVLDFKFRNNRDHYVLITSQLEKDSLTFRLFGRPPPPVKYQYEEIIEGHPGYDVWKRVYLGD-ELKSEEKISTDRYSPHPR 417
309 0.000e+00UniRef50_A0A174FEM8 Uncharacterized vancomycin resistance protein n=5 Tax=Lachnospiraceae TaxID=186803 RepID=A0A174FEM8_9FIRM  ali  24  1..........MKNSRKMRGLLVMLIAFAFCFL----AEPVKADDRTALDGIYVEDISVGGMTEEQITQAVNDKIEQLKINLSAGEQNAQVTAGDLGLSCANPEVAREAVTIGQEGNVLKRFLTQNRLKNGEVTFSLKYTVDGEAARQAVENNTAVLNREATDATLTRENGEFIVNPGQTGCSVNVDESTAKVVNYLTTSWRGGIELVTEETPAGGNPEQLALVKDLLGEGMTEYGNGTSGRKQNVAVGAEKINGTLVQPGEEFSVEAVVVPFDAENGYALAASYEMGKVVDSYGGGICQVSTTLYVAVLKAELEVTERYSHSMIVHYVDPSMDAAIAEGLKDLKFINNTDAPIYIEASADGSTLHFAIYGHETRDPNGTIEQTSYGYQGSTAWKIVND-NGNETK-EQVNSSTYRMT.. 437
310 0.000e+00UniRef50_A0A1E9AGK9 Uncharacterized protein n=5 Tax=Firmicutes TaxID=1239 RepID=A0A1E9AGK9_9FIRM  ali  30  41............................................DNIYSGITIDGIDVGGLPKEKAKEKIASELEGKNINVTVEDKNYNFELKNLDHKMDVDKAVNEAYDYAREGELEERYNKFEALKENPLNINIDKEIDYSHVDEFVSKIASETNSDAVNAEFSVNNGKITSTESKEGKKLNSEKLKNDIIDAINNSK-ETVTASVETIEPEKKHSELEKINGLIGSFTTDISTSSNERKTNIRVSSDTVSKKLLLPGESFNFNDAIGDVTTAKGYKNAHVLKGGEYEDGLGGGMCQTSTTLYNALIRAGVKIVERHPHSRAASYVPKGQDCAVWRGTKNLRFKNDFDFPIYIDSNVTKNKVTFYVYGDKSKKKSETIEKVDPSFKGYDGYRVVTNKDGKVISNKQFTKNYYPKRD. 444
311 0.000e+00UniRef50_A0A174CCU3 Vancomycin B-type resistance protein VanW n=4 Tax=Clostridium TaxID=1485 RepID=A0A174CCU3_9CLOT  ali  28  46........................................KSWEDKVYPGVHAYGVDLSGKTKDEAVAILNDQLNDKSITVTVGDKSFNIKYADIGSTINADKTAEEALAYGKEEGMFKKNSYIKDGVDTEVNTEL--TYDEAKLKEFEDKINTEVEIPAVDASITISYGEKYITPEVIGKKINAEELHTKLVDCIDPDPNKTVSLELQDYSPRITAEELNKIDGIIGSFSGSYTNDGTGRVTNMQLATGYINGTLLMPGDEFSYNKTILDTTPENGYKEANTYVGSEVVPNYGGGVCQISTFLYRAVITSNIRSTIRYNHSMMVGYSEPSLDATVFEGDIDYRFINTYNSPIYIEGYMGGSTITFNVYGNTSEKEEGKTRTKLNGAPGYKSEYLITYENGVEVNRELISTDVYQPMN. 455
312 0.000e+00UniRef50_V7I3E0 Uncharacterized protein n=1 Tax=Youngiibacter fragilis 232.1 TaxID=994573 RepID=V7I3E0_9CLOT  ali  29  46..........................................WANKVYPGVVIDGIDFSGLTLEEAKTKFEREILDKTVKVDVLGKEYSFTYDKLNIGIDKESIIEEAMDFGKDMEFEEQVAYLK--APSGTEIKVEFTHDAAYVDEFVNQIITENTQEAKDATLSRKDGEFIVTESLNGQALDAEKLKADVVAAIEPGDPAEVAAEVAVMEPAVKAETLRKINGVLASYTTDYSSSIANRKFNVALAAKKISGTLLMPGEVISYNKSIGSISIAAGFKEAGIFVGNKVESGIGGGVCQISSTLYQAGVRAGLGVVERRNHSMKVSYLPVGFDATVYAPYTDLKLQNNYDSPIYISAYGDGKKANVTVYGNDPTLEVGTNVVEQNAVTGYKVKVYLTIIGGKVVSTDMISNDSYKVVNK 454
313 0.000e+00UniRef50_UPI000984AD1A hypothetical protein n=1 Tax=Massilimaliae massiliensis TaxID=1852384 RepID=UPI000984AD1A  ali  30  253.......................................KKLDVDTFYDGIFIEDVDLSGKTMEEAETLMKDELDPIDLTLTYNDKSYHYTEDDFTFVYNTDEILKEAYQIGREGNIWLRYFKVLSLKNNPEKLALNHELDQ--IDNILAQIASELNTEPKDASFDPSAGSFHVEDGVVGIEVDQTQLVEDCRTILESEDTGTISIKVTETPFEVDKEQLMQDITKLASYSTK-STNTANGNHNMANALNRINGTVLQPGDTFSFNGTVGRRTAANGFRAAGVIKNGELVDGLGGGVCQASTTVYGAAIRAGLEVVERGNHRWPSSYVPIGQDAMVSWGSQDMKFKNNTDYPIYIKSYMSGTTLNVIIYGHQPEDPKGTEKVKIEARAGSTASQRTYYKDGKKVKTEALPSSRYNPVNQ 674
314 0.000e+00UniRef50_A0A0M2NJW9 Vancomycin B-type resistance protein VanW n=6 Tax=Clostridiales TaxID=186802 RepID=A0A0M2NJW9_9FIRM  ali  28  156......................................QEILDNGTFYDGVRLAGVDLSGMTLDEARPLVEEKLKGISIDYKVDEDTFSLTADQLGAKADVDQALQKALLYGREGNFAQRMSAINDAKQKGVEIEMPVTYDQSVILESLKANDDKINVPAQDAGVNFENSKITLTDEVVGKEVDDEALAETIFTQLGQNNFETVVAETQVTQPKLTKAQLEDRYTMLGTFKTEYGSSAEGRRYNIWKMADIINGVKIEPGETWSINEEAGPRTYSRGWKGAPGISNGEYQEEAGGGICQVSSTLYGSILRAEVKVVDRTHHSWPLTYVDGGLDATISTGAPDFKIQNNYDIPIYIVATCDGSTIEVSIYGPKGGEKVIQVKQDQHPRRVYEVYKHWYDADGNEVKKEKFSTETYAAFP. 580
315 0.000e+00UniRef50_A0A1G9R455 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=5 Tax=Peptostreptococcaceae TaxID=186804 Re  ali  31  2...............KRLKIITVLIAVGIFFLGSINVAQAKNNEEKICKNIYVENIDVSELTREEAQKKIEKFIKENQIIFINEDSKFVLNINDIGVNYNIRNSVQEAYNIGRDKNIISNIKTKVNLELGEVNIHLNKSYNNEKIQAFIENIEQNISRLPINASISLDGENLAYERETYGIGLDKGKFKRIIITKINEMNYEKEEIPTISVAPKYLYDDICKINSVLGTYETYFNPNIYNRVNNIRVGAKATSNIILNPTEEFSFNSYIQSPDVKCQFKKAPVIINGKLKQGSGGGLCQVSTTLYNAALYAGLEITNVKNHSIPSSYISKGRDATISTGDIDLRFKNNFETPIFITHKVYDNKIVSTIYGNEENKKDIEIITEQKGRKGYTVTFRIYKSNGDVVK-ELIKENYYPPMDK 432
316 0.000e+00UniRef50_R5BGV8 VanW-like protein n=2 Tax=Veillonella TaxID=29465 RepID=R5BGV8_9FIRM  ali  27  1...............MKKKVGIVAGVVLCLISLST--GAFLYPTGNVIQGMYLGERDVSQANKEELADIIEAEAAKGPMKVKWQDKETTVALKDIGVKPNVDKTIESLMTYGYEPSMEEYITNRWHALMAPVSKAIVYDVNVPALEALLQTYSKEIGYTGHDAYLTVENGQVVLHPEVPGKRLDIAKTVASLQEKLAKGEVSGFELVIDNQKPKITAETLKGINTVLGTYSTTFNSGDVSRTHNIQIATDKINNVVIMPHQNFSFNDIVGERTAEAGYDDAPVFMDGKLVPGIGGGICQVSSTLFNSALLAGMDIVERTPHFAPVGYMAAGRDATVAYGYLDFIFKNPYDHPIYVLAHTSGDTLTISILGNKVEDPSVTKETTTEGHAGVDTTVHITYKDGRT--KTDSFNSTYDPV.. 427
317 0.000e+00UniRef50_A0A154BVU1 Uncharacterized protein n=1 Tax=Anaerosporomusa subterranea TaxID=1794912 RepID=A0A154BVU1_9FIRM  ali  26  35...........................................HDQVYAGVMLEDQNVSGKTRTELIEMLNERSREKTVSVYYGDQAYSIQARDVGFSIDVESTAAVIWNYGRVGSWWDRIQSIRTASSRDQNLPVHIVFDQEKLNAIVATWKRQLEKPPQNATLSLTTGGP--IPETKGVRLMEEELKTSLLRSFYRDDIQYIPMPMVAVEPKVTAESLAGIVVMQSIFSTQFNTEDAKRSINVKLAADKINGQILQPGQTFSFNETVGPRDKASGFQEALEFFDGELVPGIGGGVCQVSSTIYNAVLLANLDIKERLNHGKPLSYIGLGRDATVVYGVLDFKFVNSSNSPIMLMCEVKGNTLYAAVFGREKLKEVGETKVENKGAPGYKVYRLVSTE-GKVIKREFLSKDQYMADN. 438
318 0.000e+00UniRef50_D5X827 VanW family protein n=3 Tax=Thermincola TaxID=278993 RepID=D5X827_THEPJ  ali  28  34...........................................EDQIYSGVWVEDISLGMLTXXXXXXXXXXXXXXXXXXVKYPGGEAAFKLAEIDASIDVEGILKKAWEYGRKGSLLDQWQERRRIAREGVIIPLKINYSRTKFEKLAQKLGAGATIEPQDAKLVITQDTIQIIPGKQGKVIDTQNALAQIEDILNEKQEPVLNLVLKTKEPEMTTQEVENVNGIISHFSTFFNVQKTNRVYNIKVAAGALDGTFIKPGETFSFNKVVGPRSKEAGYKLAPTILNNEFIDSLGGGVCQASTTLYNAVLLAGLPIIERANHSLVVSYVPLGQDAAVAYGGKDFKFKNNLSSWVVLKTEVVGNRLTVKIFGDTALKKDVRIVIKQKGVNGYKVQRHIY-VNGKEVRTEKLPSSYYKPLDQ 441
319 0.000e+00UniRef50_A0A151AL18 Vancomycin B-type resistance protein VanW n=3 Tax=Clostridiaceae TaxID=31979 RepID=A0A151AL18_9CLOT  ali  27  1..........MKKRLMLKKGIIFSILLCFIYALPSYAFSEAINKKNKKLPVYFKEVDLSGKTIKDVEEIIDEEIENKKINISYNGQTHNFKLKDLGYYSNKEEVKNKILILYNDLSPIEKLKEYINIKKYGRKYDLNHGIDYEKFCKSISVFDEFKLPKPQNAKYKCEDGKIIIIPEIYGYEFDKEKLYNQVCSNML-GDKREFTLDYKTVKPKITEEVLKGIKEKIASYTTKFNSNNKSRSKNIRLAASIIDGTIVAPGEVFSFNKVVGERTKARGFDEAGVYINGNIESELGGGICQVSSTLYNAVLLSDLEVVQRNNHSLTVNYVPLSRDAAVSWGSKDFKFRNNKDFYIYIHAETGENTITFDLFGTKSNKKVELIEIVKKGRTGYRSKLIKKYENGKLIRREIVSQDKYMSTP. 442
320 0.000e+00UniRef50_A0A084JCB1 Uncharacterized protein n=3 Tax=Clostridium TaxID=1485 RepID=A0A084JCB1_9CLOT  ali  26  2............KKKFMRITFLLLTMLFIVSSFILIKVQTIIHENLIYKGISINKIDVSLLSKEEAIFKVDKDIVNRNVKVQIDEKSYEISFSELGVSDNVKEVVDMALLWGKEGGFIGKYKNIK--KGIDREFYTETSLKADSFNKFLKVIEKEQNKSPVNATVDHDWSGFLITPHEIGRKINGDALNKSIIEAIDNSGDIIVNADFNKVFPKIMEDDLKSINTKIASYTTSFINSSFGRCRNIEMAAKYIDNTIIMPGDEFSFNKVVGATTPGKGFEYAKVIKNGAFIDEIGGGVCQVSSTLYNAVLKSNLYITERKNHSKIISYVPMGQDAMIAYGASDFKFKNNYSYPILLEVIVKNKEITFNIFSNEEEREEGKMVIEKNGVNGYIVTYRIRYENGKIVEKILVGESIYASKN. 441
321 0.000e+00UniRef50_A0A1F8UK11 Uncharacterized protein n=3 Tax=unclassified Clostridiales (miscellaneous) TaxID=39779 RepID=A0A1F8UK11_9FIRM  ali  28  34.........................................VNSDKIYTKITINDVDVSGLSKDEAFKKVLEKVFSVPINIYYKDINKDLYYDDIMASNNVQELIDKAYDIGREGALFDRYAVITKLKKTPQNFQISYLPDKEKIFKTIDSLKEKIETTPINATMKKDKQSFVVTPGKTGTQINKDKTFEAIQNAIKKKESK-VKIIVDSINPQYTKNALAEIQTPLATYTTKFNRYDKSRTNNLQVATSFIDSSLVKPGETFSVNNAIKSRTAANGYQSAHVIVNGQLVDGIGGGICQVATTLYNAVMIADLKVVERHNHSLTSTYVSPGRDATVSGSYLDFKFQNTTNKQLYIQGYLDGGTLTYTIYGDPPEKVTGKRKVTTKAKEGVKLYKLIYDANNVLLKKEYVSQSTYRATQ. 444
322 0.000e+00UniRef50_UPI0006E2229B hypothetical protein n=1 Tax=Desnuesiella massiliensis TaxID=1650662 RepID=UPI0006E2229B  ali  26  2....KNRSYRLTRKLKILITKISICIFGTFCGYALIYNENNKWDNLIYPGAKIAELDVGGKTKEEAIKLIKSHLVNEEIEIKANDNKYTINKGRIIKEYDLNTSVNNAFDYGKDMDFYKKHKLIKQGVSKKYN--VNFILNEEYIKNFLVNLEKEIDKSPVGAAIIKEKGQWKVWKDENGVKLQSEKLEKYIKEAVYNG-NKYIEAPVQEEVSSITLEEINSINTKISSFSTSLVASSIERLKNVEVATSFVNGKLLMPDEVFSFNETVGERTKARGFEEAPIIVGNTVDNGLGGGICQVSSTLYNALLKAGIKPVERVKHSIPVNYVPFGLDATVVWGQIDFKFRNTLQYPMYIEAYIENNELKVNIYSNRSYGINRSLYGSIQGSDGYVVRVTMYYENGNLIGSNLISEDYY..... 438
323 0.000e+00UniRef50_UPI0004E186E1 hypothetical protein n=1 Tax=Desulfotomaculum alkaliphilum TaxID=105483 RepID=UPI0004E186E1  ali  30  33..........................................YKGKILPGTTISGVAVGGLNKNEAMNEIMLRYPQPTILVITDGEEYEITFGEIAFGYKYQEAVDKAFQLGKEISPLWQVKEFYRVVAGKVDIPLGVSFDKEAFSQVLAELNNQYSRQPQNAQIAYAEDQVVLLPETLGREIDVEATVNRLARV--EPGDLKAELVFNSLIPQLTSEDLKDINSRLSIYVTSFDNTNPNRVHNLKLASDKINNTLIKPGDEMSLNKVLGPRTPETGYKKAPVIVGSKLTEAYGGGVCQVVTTLYNAVDLAGLEVLERHTHTIPVNYVPVGRDATIAGDILDFRFKNSGKKPVLISSELEDNKIVVTILGHRDDLKPGEIKVVKPGREGYETTYEVTVINNVVVERKEIS......... 430
324 0.000e+00UniRef50_A0A0C1U135 Putative peptidoglycan binding domain protein n=4 Tax=Clostridium TaxID=1485 RepID=A0A0C1U135_9CLOT  ali  31  56..........................................YESVIYPGMKIQGIDLSGKTKEEALKLIEEKYKQKKLIMTAGDKSYVVNYADMKLSFNLDDTVKSVFEEGKDKGVMEKFKMIKN--PTEKDHQLKFTYDNKVIENKIKTMESELNKNKVNAKIAKAGDGFDITPEQAGMKLDSKSLQEEITKAIASSKETEAEVKVKEDKPTITKAELEKINTKISGFSTSYENSTQARAVNIEISTNTINGTLLMPGDSFSFNTIVGDTTPDKGYLEGVVIVGDKFEKDYGGGVCQVSTTLHNAVLKAGILPDSRLNHNLPVGYVEKGLDAAIAYGWLDYVFTNNTKYPMYIEGYAGNGSVGFNLYSNSSTLEEGTEVIQQYGMEGYKVYRVIY-QNDVEISRELMNNDTYEPTPQ 466
325 0.000e+00UniRef50_A0A2G2MF36 Uncharacterized protein n=1 Tax=Alkaliphilus sp. TaxID=1872455 RepID=A0A2G2MF36_9CLOT  ali  29  37..............................................IYHNVYVEHVNVGSLSREEAMQKIENELKERRIRFFYNKHEWKFTYEKLGYSYLYENAIENAYKIGRQGDLFSRVKKINSLRNKPARIALEGYFNHGSINEIILEIEEAVKSEEVDASIIRENGIFVITNEILGTRLDRNLLRVRVEEAIKNYKLQDIEIPVKYISPRLTREKLLAIQDVIGEYATEFDSSVIGRSKNILLASSSIDGTLLMLGEALSFNKQTGRRTAQAGYQVAPVILNGELVPAIGGGICQVSSTLYAAVLRADLDVIQRQNHSMPVSYMHIGQDATVSYGFIDFEFANSGEYPVFLESYVDGNKLVVRFHGKRDNNIYIKIEIKRKGRTGFRVTYKIYMENDEEIKRKLISKDLYPP... 436
326 0.000e+00UniRef50_A0A1S8LEU8 Vancomycin B-type resistance protein VanW n=3 Tax=Clostridium TaxID=1485 RepID=A0A1S8LEU8_9CLOT  ali  28  30..........................................WEKSIYNGISIENIDVSGKSKKQAENIVKKEFDNKSINLIADEKTMQLKYSDVNVKYDIDKAVDAAFNYGKDLSIYDRYRLIKN--PKKIEVKVEMTCDKKALNEWVKNVSNSLNKEPKNATVIRAGEGFRIIPDEDGKKVNEDKLKKDVEDTIQNNDNNNIKINMDAVKAKTTGDRLKSINTLISSFNTEYASSSEERAHNIFLATKAINGMILMPGDVFSFNGVVGERTAIKGYESAPVLVGNKSDMGLGGGICQVSTTLYNAVLTAGVKATERHHHTLPSHYVSLGYDATVDYGTLDYKFKNTLSFPLYIEGSTDGGCVTFNIYSDASEKYKVTSENYSDSVPKVKVYLEAY-QNGVLKSKDMIANDVYS.... 408
327 0.000e+00UniRef50_A0A2M7KX66 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 TaxID=1973912 RepID=A0A2M7KX66_9BACT  ali  26  43...........................................EGLIQRDVLLEGRPVGGLTREAARLVVEEEALAKEVRLAAHGQEWSFTCRQLGASPQLEEVLGRAYRVGRTGSWFERARMAVAPHPQPRDLRTRYVFDEGALTAILKQLKDQVRTPCQDAYAELRDGVIRVEPGKWGESLDVDNSRQKVMESIANPEAGKVDLVLKSEKPGISYEDLKHLDCVLVEYATTYNSSKVNRTHNLRVAGSFLDKVLLRAGVTFSYNDIVGPRLECKGYRPAAIFANGDVVDDIGGGVCQVASTMYNVALLAGLKIVQRRPHSRPVDYCPPGRDATVYFGQTDLRFRNNTALPLYFRTSVGSGRVRVMALGNRSQRVQVELTPVDREVIPYKVYRRLIKQGGETVVEELISRDYFKPQDR 448
328 0.000e+00UniRef50_A0A2H5X370 Vancomycin B-type resistance protein VanW n=1 Tax=bacterium HR16 TaxID=2035411 RepID=A0A2H5X370_9BACT  ali  25  46...........................................EDHFPPGWRVAGINLSGMSLAAARQQMEQVAQAWNRTLTVEARTPQVTREQLGASLDADATLQRAWQQVKQYPPLARMVLAWVRRQAGKEIAPVVRVDDSQLQAWLRSCRKQVETSPRNARIRISAGRWEVLPEQPGLRLTADA-AQRLMEALQLSET-TCVLPLEETPPRITRQHLQSIDSEWTIVVTHYSERERNRSYNIRKAAESINGTVLLPGDEFSYNRVVGPRTLKEGFRRAPVIIKGELVPGDGGGVCQVSTTVYMAALQAGLRIVQRSHHAFPIHYAPPGMDATVVYGAIDLRFRNDTPSPIALVAEAKRGRMTVRVLGSSVCKREVKIKVVNKGQRGWRVYRVITEP-GKPPVREKVTTDYYRPQAR 455
329 0.000e+00UniRef50_A0A1M5UZT2 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=2 Tax=Butyrivibrio TaxID=830 RepID=A0A1M5UZ  ali  30  29.............................................KIPNGVTIGSVDVSGMTYDEASSAVKSYLSTANITLKGEEDVVTVTAAELGLTWTNPDVVNSALNIGKEGNVVQRYKQLKDIANGGVSLDLEYAFDDTMIMDVFANQCESYNVEEVDYSLKLENGSFTVIDGNTGYELNQTASIDSLQNYIVDSWDGEIALTIDVTEPKGSEEELAKVGDVLGTYSTSYKTSGSSRSGNIANGCKLASGITLYPGEEFSMLDNITPFTEANGYFLAGSYLQGQVVESFGGGICQVSTTLYNAVLKAELEVTERYNHSMIVTYVDPSQDAAIAEGGKNFKFKNNTDYPIYIDGYTTSSKITFTIYGVETRDPVGYVKVTQSAHNGIKAQLIVVTVNGKEESREVVNSSTYSMVPR 441
330 0.000e+00UniRef50_R9J7U0 Uncharacterized protein n=27 Tax=Firmicutes TaxID=1239 RepID=R9J7U0_9FIRM  ali  31  96..........................................NSNTVSEGVYIGSVDVSGKTAEEAKQAVEAYVEEKGLTVVFDGNQIEVAVGDMGLQWTNPDAVQDAVALGKKGNIVQRYKALQDLRHKNKVFDLAYDFDKESIRQILSEQCGEYNTEAKDATLTRVNGVFSVTPGESGRVVDEEASLNQIYDYMMNEWDASVDMVVKVQEPRGSEEELAQVKDVLGTFTTSYSTSGSSRSANVSNGCNLIAGTTLYPGDEFSTYEMVSPFSVDNGYFMAGSYMNGQLVDSLGGGICQVSTTLYNAVLLSELEVTERHNHSMIVTYVDPSADAAIAESGKDFKFVNNTGHPVYIDGYCENKNITFTIYGVETRPANREVVVTQSAHTGYKAWKVVKE-NGAEISREQINSSSYKMTPR 508
331 0.000e+00UniRef50_A0A0F2NJ88 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c4a TaxID=1629716 RepID=A0A0F2NJ88_9FIRM  ali  28  33..........................................YGDRILPGVTSAGFPLGGLTPEQAEKLLRETLTPPEVVLVAEDRQWIMPLKSVGAYYDYPEAVANAYAVGRSGSLMRRVSELLGNKTESTDIKLPLKFHSELLKRELERINGEYSIKPLNARLLLDKNEVNVVPGKEGSEMDLAEITGHIYS-FSAGMELKLAITPKIVAPEIREQDLSGLTDILGECTTLFEAGSVGRVNNIVRASGKLNGKLVKPGEIFSFNDVVGTIDEKNGYLMAKVIADGQLVDDYGGGVCQVSTTLYGAVLLSGFEIIERYPHSMPVKYVPPGFDATVAGDQKDFRFRNNLNRPVYIISSTDQGHVKVVIIGKKQDN............................................ 369
332 0.000e+00UniRef50_A0A255HYY1 Hydrolase n=2 Tax=Peptostreptococcaceae TaxID=186804 RepID=A0A255HYY1_9FIRM  ali  41  33............................................DKISKNTYINEIDVSGMTKIEAIKELEKKYTIGNIKFSYSSDTWDISPKDISLKYNLEDTVEKAYKFNKGKSFGENLINTIKSNFGKVNIEVSTEYNEEKLKDKIENIAKEIDVEVKDASISISGSNINITDDQPGLKVNVGDSVSEFKNKVSKGNLNP-EIIVTKVEAKIKKEELESIDTVLGSHSTKFDGGTTGRNTNIRLAAERTSNVLLMPGESFSYNDHTGLRTIANGYKNAPVIVQGVVQEGVGGGVCQVSTTLYNATLYAGLEYVNLRNHSIPSSYAEKGRDATVADGSIDFVFKNNLSYPIYVNNYVSGNTVTCQIYGSYKDKQKIEIKVLEKGRDGYTVYRVYKDGNGDVLKKEKVSTSYYPKKQ. 433
333 0.000e+00UniRef50_UPI00082D2F9C hypothetical protein n=1 Tax=Clostridium mediterraneense TaxID=1805472 RepID=UPI00082D2F9C  ali  26  40..........................................WKDRIYPKISINGVEVGGKTKEEARKLINDKVKDKKLTLESEGEEVVIEYSKIKPEYKVEEALDKALAYGKDEGVFTQSGYIKKGLDS--DIEVLFGYDEKVVENSKKELERRVNKPAKDATLDLSGNDIKVVEGTDGEKINKKKMDEIVAKSISGDIDKKVNIPIEKATPAITGKMLSKIDYKIGSSTTNFNAGDTQRVTNLRLATDFINGTIVMPGETFSYNEVVGERTTERGFREGAAFVGNQVVPSIGGGVCQISTTLYQAVTRSGIPPTERHNHSMPVSYASPGQDATVAWDYLDYKFKNIYNVPVYIQGYLNGGSVTFNVYGNKPSMPKGTQKIEKRACAGSRVNYLVAYKDGKEVDRALLSKDVY..... 444
334 0.000e+00UniRef50_UPI00067F58D9 hypothetical protein n=2 Tax=Bacillus TaxID=55087 RepID=UPI00067F58D9  ali  31  32.........................................LYNDTFYPHVTVEGQDLTNKTKEEATKLLAAKHDLIKVNVKVGNQTFTTSLKNIGVQYDTKQKMDQAYSFGKNEGLLARYKLAK--EKKGKEYHLTYTINENLLNKWVGNIEQKMKKAPQNASISIRNGFVSIKDDTKGYQINQDQLRQDLSAALNNKEDITVAAQLQQVPAKITKETLTTVHNVIGSFTTNYTTGAKNRNTNIKIAAETIDSYLLMPGESFSFNDFVGDTTADKGYKAAGTYEGGKVVESYGGGVCQVSTTLYNAIIKAGIIPNKRYNHSMTVGYVPVGQDAAIAFPYKDLEFSNPYPFPVYIEGVVGPGTLTFKVYSNVDYRLDSSIVSKTPDHTQSVTYLE-TLKNGKMIERKVINRDHY..... 415
335 0.000e+00UniRef50_A0A1C0AJT4 Uncharacterized protein n=1 Tax=Criibacterium bergeronii TaxID=1871336 RepID=A0A1C0AJT4_9FIRM  ali  35  39............................................DKILNNVSIGKMNVSNLTKEEAKQALGQKFSFGNVTLNDAGVTYDYNLSENGFNYDIDKSVEDAFNVGRDGNVIQNALVAFGHSTGKKDIPLDYNDDYAGLENWFNEIAQKANIDPVNPTISVSGAGIVVVPGVKGKIVDVEALKANVKQEIEKNSDGQLDLPVKTVEPYIKEEQLSKINGIIGKYSTKYPTTDVARSMNVAVTAKKMNGILLMPGDQGSFMSHLGPVNEKAGFKAAKIIINNEYVDGIGGGVCQVSSTMYNALLRSGLDITARSNHTFPIGYVPLGLDATVADPAPDMKYKNNYPFPIYITNSAGGGYMTTTIYGNKDDPPEGKEVVDDNGHIGYKVV-SYKTIDGK---KTVIARSNYKMTPK 438
336 0.000e+00UniRef50_A0A1M5XYD9 Vancomycin resistance protein YoaR, contains peptidoglycan-binding and VanW domains n=2 Tax=Clostridium TaxID=1485 RepID=A0A1M5XY  ali  27  1................MRKKVAIIGALVFCAALIEFSCSFWNVSDKIYPGVFVENIDLSYLTKEEAKQKIEETYKNRSITTEINDNEFEISFSDLGVQYNTDEIIAKSFAEGRDKNIFKSYIRLK--KKSIDEFKLSFNLDEEAFKQYIDNIKCKACRCSEDAKIEINNGDIKVYSEVIGLELEEDKLREDIINKLMEDHGKDNILVVKEIIPRILEKDLKSIDSVISSYETSLYNSGESRNKNIEISTKAVNGTLVMPGDEFSFNKIVGARTSNKGYENAKVIVNDKYQDDVGGGVCQVSSTLHNAIIRTDINPTERHGHSKLVSYVDKGYDATVSYGYLDYKFINTLPYPIYIEGNVKSNLVYFKIYSAKSTKGIGYTEIKQQGEAGWSAYRYIYEE-GELVDKKLIYNVNIKPKDE 435
337 0.000e+00UniRef50_W8T347 Putative exported protein n=1 Tax=Peptoclostridium acidaminophilum DSM 3953 TaxID=1286171 RepID=W8T347_PEPAC  ali  34  30..........................................NSGLIAKGVYIDKVYVGEMDKIAAAKAVEGKYSIDKLELTHGEKTYEITPQELGFKIDTEKAVGKAYIYGRE----SVMEYIGSLTGKSLHIKLNSEYSPELVASVVGNISKDIDYSPKDATIRISGGKASFTREADGLEVEKEKLTGMIESVLRESAEKSMQIPTNVLSAAIKYDQIKGISTVLAAHSTKYNASNAERSENLRVASSSVSGHVVMPGDVFSLNAVTGKRSIQNGYKMAPIIVKGKIEDGLGGGVCQVSTTLYNAVIRTGLDIVERRNHSIPSSYADMGLDATVSYGSIDFKFKNTLKNPVYINIAPYGGTITAQIYGYPEDRRIVKIETEDSGRDGFKVYRTFIDGSGK---KQQLSSDYYPPAKK 427
338 0.000e+00UniRef50_A0A0V8QBT6 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A0V8QBT6_9FIRM  ali  26  30........................................KKNDNTICEGIYINSVDVGGMTKEQAEEAVLEELESRTLTVAIDKHTVKITLRELGLVAEENEVVEEAANIGKTGNFIKRYKEIKNLENQRLDLSIPIHLDKTLVENFVTEKCSAFDIPAENASLKRENGVFVVGEDKTGRKVVADETVGKIVARVEKDWDYQMEAVVMDEEPEFPKEVVELCKDKLGSFSTTYATSSASRANNLANGARLINGSIIWPGETFSTGGTLSPITAENGYSMAGAYQNGQVVDSIGGGVCQVATTLYNAALLAEIEIAERSNHSMIVGYVEPSMDAAIAGTYKDLKLKNNTDVPLYIEAATVGRTITFTIYGHETRDVNRKIEVTQSAHKGYQAWKVVYE-NGVEVSREKVNSSSYAAEP. 443
339 0.000e+00UniRef50_B1KTI3 VanW-like family protein n=43 Tax=Clostridium TaxID=1485 RepID=B1KTI3_CLOBM  ali  33  34..........................................FDSVIYPGVFIEGIDLTAKTKNEAKNIIESKYSKKNITISWNDKKYNLSYAKLNPGYNIQETIDNAYSYGKNLSIFSKYKIIKSKSIQ--NYLLKFSYDKKAMDGFIDSIEKDINKEAENAKINVNKGSISIVQDKKGFKLEKDKLKKILYSKMDGKNLKDINAPVKTQEAKIKKKQLETVNSNISSYTTNYGSSSPQRANNIVISTKAINGTLLMPGESFSFNNTVGPRTEKRGYQGAPVIIGNKIESGLGGGICQVSGTLYNAMLKANINATERVRHTFPSTYVPIGMDATIDYGNIDYKFKNILTYPIYIEGITNGANVTFNIYSNSSLKPLGKTEIVQEAHTGYKVYKSTVEND-SVVKKELLYTDFYKPVDK 442
340 0.000e+00UniRef50_UPI0009DDCA61 hypothetical protein n=1 Tax=Clostridium sp. Ade.TY TaxID=1391647 RepID=UPI0009DDCA61  ali  28  55..........................................WSNKIYPNVFIKEINVGGMTKEEAKNALNNNYKEIIVNIKGKDKEFEANYSEISPKYDVDKAIDEAFNYGKDSNFFKKNSLIKNKKNYKQEIQLNFTYNNKKLTSLEDKIVKKFTILPKDATISI-NGKILITPEKVGYGVDKKELDNKFKEELNGDIGNETKIVVEEKEPKVTKKELSKIDGVMGEFTTSYQSSDSNRATNIQVVTNFVDGTVLMPGEEFSYSETSQK--DKSLYKEGNAYINNQVVKDIGGGICQVSTTLYRAVMKANIRSTERYNHSLTVGYSKPGLDATVAWGYLDYKFKNPYDFPIYIKGITHNKMVTFKIYGDVDGLKGRTYDVESNGQTGYVAYQLTYE-NGQLIKKELVSTDNYAMVPR 464
341 0.000e+00UniRef50_A0A2M8KSC7 Uncharacterized protein n=1 Tax=Candidatus Roizmanbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_39_6 TaxID=1974853 RepID=A0A2M  ali  23  29..............KYIIRIAVYSCLCIALSILGVFSVQASYYNNKIYPNISIGNIPVGSLTKEQALAKINKIYTKGNLKFVLNEQVASISQKELGYSLPFTQAVEKAYAIARDENPILKYKTILLLLASQEQYRIVPQYNTRVITVNLQKIDDSFRTDPVNARFEFKDNKVTFRKEEEGFSINKNSALATIEDLLTSKKTLAIQLKTRTIMPDITLSDINGISELISEGKSQFHGSSAERIYNITLGSQRLNGIIIKPGETFSFINALGEISGATGFKASYVIK