current user: public

If you have questions about the server, please let us know.

Query: IDP06124 hypothetical protein jhp0592 [Helicobacter pylori J99] NP_223310 [Helicobacter pylori J99], from CSGID

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# E-value Template Links and tools%idFirst MGNLTYYAYMYLILFVCLLPVLLVGLAWRLTRPPLKQNIPNKSLSLENLNEQIKNLQSVPALEKLKNRFNERFKICPKDKETLWLETIQNLVASEFFELEDAINFGQELENANPNYRQKIANATGLALKNKKEKGLast
1 1.000e-32UniRef50_I9ZLN2 UDP-N-acetylglucosamine 1-carboxyvinyltransferase domain protein n=3 Tax=Helicobacter pylori TaxID=210 RepID=I9ZLN2_HELPX  ali  92  1MGNLTYXXXXXXXXXXXXXXXXXXXXXXRLTRPPLKQEIPNKSLSLENLNEQIKNIKSAPALEKLKNDFNERFKICPKDKETLWLETIQKLVASEFFELEDAINFGQELENANPNYQQKIANATGLALKNKKKK. 134
2 1.000e-22UniRef50_E7AAB3 Putative periplasmic protein n=17 Tax=Helicobacter TaxID=209 RepID=E7AAB3_HELFC  ali  38  34................................PAPRAQIP----SIRELSDRVKNLQTQEDFDTLFQTFTQHYSILPKNKEGDWLSLIEEIAESEYIDIDSTIKFGHDLEGDNPKLQKNIANTVGLALKHKKK.. 131
3 1.000e-21UniRef50_Q17WZ5 Uncharacterized protein n=565 Tax=Helicobacter TaxID=209 RepID=Q17WZ5_HELAH  ali  87  32...............................RTPLKQEIPNISVSXXXXXXXXXXXXXXXXXXXXXNSFNERFKICPKDKETLWLETIQNLVSSEFFELESAINFGQDLENANPNYAQKIANTTGLALKNKKEKG 135
4 2.000e-21UniRef50_A0A268U3W6 Uncharacterized protein n=2 Tax=Helicobacter TaxID=209 RepID=A0A268U3W6_9HELI  ali  29  39.........................................KEQTIKDFCLLTASIHSKEDLESLLSEFRKKYTRYDEHHIDVWLESVTNLAKSHYWDTDAVALFGQELENKNLSHKKVIANTISAALKMKE... 129
5 9.000e-21UniRef50_M7RU69 UDP-N-acetylglucosamine 1-carboxyvinyltransferase domain protein n=1 Tax=Helicobacter pylori CCHI 33 TaxID=1200325 RepID=M7RU69_HELPX  ali  85  11......................................................PLKGGVEISGAKNSFNERFKICPKDKETLWLETIQKLVASEFFELEDAINFGQELENANPNYRQKIANATGLALKNKKEKG 91
6 3.000e-20UniRef50_UPI000CF0847D hypothetical protein n=7 Tax=Helicobacter TaxID=209 RepID=UPI000CF0847D  ali  39  9.............................................LKDLVFQLDKAKDQEEYNALLQDFNTHYASLPKHKEGDWLNAIKNFAQSEFLDIDSTVNFGQHLEDINPKLSKAIANTVGLALKHKKK.. 97
7 6.000e-19UniRef50_V8CHU4 Uncharacterized protein n=4 Tax=Helicobacter TaxID=209 RepID=V8CHU4_9HELI  ali  24  29...............................RSLFDKKPKPKSFTLKDFRKLISKAKTQAQAHELIEQFVKKFGLFAPSSNDEWLDVVKELTSLESIDTDKAAEIREHLSAKNPAIKKEISDAIGLALKTKKD.. 132
8 3.000e-18UniRef50_A0A268UBN9 Uncharacterized protein n=1 Tax=Helicobacter sp. 13S00482-2 TaxID=1476200 RepID=A0A268UBN9_9HELI  ali  21  33....................................KPISIQEPTLQTIQILLSTIKTKQGFDAFLRKFLKNFAVIPTDEKDFWFALVEKIAHSKFLDIDEVSELRQELENANSGNEKQIADMISGVLKTRKK.. 131
9 3.000e-18UniRef50_UPI0004AD66D4 hypothetical protein n=1 Tax=Helicobacter pametensis TaxID=95149 RepID=UPI0004AD66D4  ali  29  28...............................KPKIQAKPTHSPPTPAKLSKQIK--KGGKHTQKALQTFRQFFLDATSCEQTQWLELIKELSLSPSLEIKTITEFQEELKQANPSLFNEIALTISVALKNRK... 126
10 5.000e-18UniRef50_A0A2A2GTC6 Uncharacterized protein n=4 Tax=Helicobacter TaxID=209 RepID=A0A2A2GTC6_9HELI  ali  25  21...................................DDKPIVKNPLMELYKEILAHKDDKEKIQENYQTFTKNFNTCPPNSFDTWLNIIYNLINSVLMEADEVAKFRDMLEDANPSIAKAIQNKIGSALQHREK.. 121
11 6.000e-18UniRef50_C3XEV7 Uncharacterized protein n=7 Tax=Helicobacter TaxID=209 RepID=C3XEV7_9HELI  ali  26  33...................................NKPPKKVENTMQIMFNIIKGAQTKAAFTASLEQFKGKYGVLADEKFDLWIQCIKELANSTHWDTDAIAKFGQELEDKNAAHAKKIAVAIATVLKTKDQK. 132
12 4.000e-17UniRef50_UPI000CF1417D hypothetical protein n=1 Tax=Helicobacter TaxID=209 RepID=UPI000CF1417D  ali  34  39..........................................QITLALIHNKVKLARNSKELEIVYNKFLEHFKKIPENSFQEWIQCVNDLIATDLASLDMIIQLKEELENENPTKRKEIANTVALILKNKKN.. 129
13 2.000e-15UniRef50_C5EYY0 Uncharacterized protein n=19 Tax=Helicobacter TaxID=209 RepID=C5EYY0_9HELI  ali  19  42...................................QKSREKMLKNIRYLISLLQNNPDKETLDEALDSFKKNFLIFGNLKKDDRMDFISALAWCPLIDIDSVARYREEFIKANPNFKKEIETIISSALKNREK.. 144
14 2.000e-15UniRef50_A0A2X4PIH6 Periplasmic protein n=2 Tax=Helicobacter mustelae TaxID=217 RepID=A0A2X4PIH6_HELMU  ali  22  35.......................................PSKRPTPAQIIESVENTQSVEEISKAYAMFYDYYGRIPVDQEEEWFEYFTKLISLSVASVEMVLDLSDRIQKINQERQREVVDLTANILRTKKR.. 130
15 6.000e-15UniRef50_UPI000CF10FF3 hypothetical protein n=1 Tax=Helicobacter cholecystus TaxID=45498 RepID=UPI000CF10FF3  ali  19  39..........................................PPKPKDILALLQNNEKSAQKGSLL--FEQYFLDAQSCDEQTWFNLLDQIALCKWLETTQIVEIQQRVIKANPTLEKKIETQISNALRNRK... 126
16 2.000e-14UniRef50_UPI000DCAFFAA hypothetical protein n=1 Tax=Helicobacter sp. 15-1451 TaxID=2004995 RepID=UPI000DCAFFAA  ali  22  43.....................................KIERKLQNIDFLFTLINPDNTQEEKQMALDAFNKNFAKFPKGEDQKRLRFITSFALLDFYEIDKVAKFSEALVVQNRNFKKEIEHAIGGAIKSREK.. 143
17 5.000e-14UniRef50_Q7MSL2 Uncharacterized protein n=2 Tax=Wolinella succinogenes TaxID=844 RepID=Q7MSL2_WOLSU  ali  27  52...........................................QKIDFLLSILDNPKSVKDYEAALEAFKKHHASLPKEKEFLRLDFIGKISLMDFWDIDSVAKFRDELVGRNKSLKKEIEQAIGKSLKNRESK. 148
18 5.000e-14UniRef50_UPI000DCE7E87 hypothetical protein n=1 Tax=Helicobacter sp. 16-1353 TaxID=2004996 RepID=UPI000DCE7E87  ali  24  43............................................TLDFLLEQVNNSHNDKEIDSVMREFYANFYNITNKNFDKWLNLIQAITLLDYMSVEQAARFRDDLVKKNPKIKSDIEHSIGVSLKYRENK. 135
19 1.000e-13UniRef50_I2DG21 Uncharacterized protein n=1 Tax=Helicobacter pylori XZ274 TaxID=1127122 RepID=I2DG21_HELPX  ali  88  29............................RLSRPPLKQNIPNKSLSLEDLSEQVKNLKSAQALEKLKNSFNERFKICPKDKETLWLETIQNLVASEFF...................................... 97
20 1.000e-12UniRef50_A0A1B1U6Q3 Uncharacterized protein n=1 Tax=Helicobacter sp. MIT 01-6242 TaxID=222136 RepID=A0A1B1U6Q3_9HELI  ali  21  32....................................KKRPPKIKTPKRLLKDIR--KSQKTFASALKTFQTHYISSSSCDEDLWLKMIEDIFASKWLQEEESNALKEKLISQNPEKDRQIEQLINSERRNK.... 124
21 2.000e-11UniRef50_A0A268TTV4 Uncharacterized protein n=4 Tax=Helicobacter TaxID=209 RepID=A0A268TTV4_9HELI  ali  31  37......................................PRPVSVTLENIQSLLSTLKKDQEFEGLLKVFLQHFKKLPSDTDKYWLEIIGKIASLEYFDTDRXXXXXXXXXXXXXXXXXXXXXTIGLALKNRRKR. 133
22 1.000e-08UniRef50_A0A099DPW3 Uncharacterized protein n=12 Tax=Helicobacter TaxID=209 RepID=A0A099DPW3_9HELI  ali  37  71........................................................................YKTYPKDGEELWLDIISRFANMNLMEVDEVVNFQDTLESANPESKPSIKEAIGKALQKRENK. 135
23 6.000e-06UniRef50_H5VD49 Uncharacterized protein n=1 Tax=Helicobacter bizzozeronii CCUG 35545 TaxID=1002805 RepID=H5VD49_HELBI  ali  32  42............................................TLKELDQAFRNIQDKESYDAIFQDFIRYYQVLPKGKEGDWLEFVGKLAESEFF...................................... 95
24 3.000e-05UniRef50_T2SPB6 Uncharacterized protein (Fragment) n=2 Tax=Helicobacter pylori TaxID=210 RepID=T2SPB6_HELPX  ali  100  29............................RLTRPPLKQNIPNKSLSLENLNE.................................................................................... 51

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.