current user: public

If you have questions about the server, please let us know.

Query: IDP91676 DNJA3_HUMAN [Homo sapiens], from CSGID

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480
# E-value Template Links and tools%idFirst MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRALLTLRPGVSLTGTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDLFISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTSLast
1 0.000e+00UniRef50_A0A2M7RME9 Chaperone protein DnaJ n=35 Tax=root TaxID=1 RepID=A0A2M7RME9_9BACT  ali  32  1........................................................................................MMTKDYYQILGVERSASQDDIKKAYRRLAHKYHPDKKGGD---EKKFKEISEAYQILNDKRKKEQYDKFGNVFEGQEAQGAQGFGNFDFSSLGMEDLFEQFFN--SGRARGKKNINRGSDIEVEIKMELKETLQSFEKRINLVKKIVCTRCAGLGSEQGTKIKECFSCRGVGQVRTFLGTIARYVVCPECKGEGRIPENVCNVCKGEGRINGEEQITIPIPAGVDTGQVLKFGGKKGDLYIRIFIAPHSIFQRKGDDVYMSFPISFSMAVLGGEIEIPSLQGKILLKVPSGIESGKVFRISDKGIPHFSAWGKGSMFVELVVQTPKKLTKKQKELLEKLGEE.................................................. 360
2 0.000e+00UniRef50_A0A1D2VHF1 DnaJ-domain-containing protein n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A1D2VHF1_9ASCO  ali  30  13...............................................SKSSLPIYNSSAIILKKVPITSSSFLHSFSYGRTSFHTSSNLAQASPYKTLGVNKEASNSEIKKAYYKLAKKFHPDVNK-EPEAEKKFHDIQDAYEILSDPNKRAAFDQYGTTDFEGAGSPFGFSGSNGFGNINFEDIFSQAFGGSTRSGRGNSSEYVGENIEIVQTLTLKEAIFGKKLNLDYSVNDSCHSCDGSGLKPGKGKSTCGTCNGSGQVNFMNSGYQVAYTCPKCNGLGKIISNACGSCNGHGTEQIRKKIEVDLPPGMMDGSRVKMSGEGGDLIIRVRVKPDPKFQVEGKNLVHTVSIPMTTAALGGTITVPTIDGPVRIKIPSGASYNQVFTVSGKGLPRSNNRYRGDLNIKLDIKTLKPLDDAQTALLEALADSFNDKTAKINPLWKTDKPIKDNLDSSNENHPSETEHESTSKLKKVENFLAS 486
3 0.000e+00UniRef50_A5CD86 Chaperone protein DnaJ n=22 Tax=Rickettsieae TaxID=33988 RepID=DNAJ_ORITB  ali  32  1........................................................................................MSDLDYYQVLGVSRTASQEEIKRAYRKLVLKYHPDHNPGXXXXXXK---------------KRSAYDQLGHQAFKNSGGGNYQQHHGFTGGIDPNDIFENIFGDFMGARRSSKSKKAGANLKYDISLTLEEAFYGVTKIISFKTALTCDACAGKGSLDNNSTSSCPTCRGSGVTRSQQGFFFFENTCQTCRGAGHVIKNPCTKCYGEGRYINTRNLEVKIPAGVKEGSRIKLTGEGGDLYVCITLIPHNTFSVDGNDLHCQLDINCTTAALGGEVEVADITGKLKLKIPAGTQNNHKLKLSGKGMQILHSDRCGNMIVHVNIKVPKSLTKSQRELMIKLDKELNEA-------------------------------SEEGFLSKVRNFWAS 374
4 0.000e+00UniRef50_A0A1Z8XPE8 Chaperone protein DnaJ n=22 Tax=root TaxID=1 RepID=A0A1Z8XPE8_9BACT  ali  35  1.........................................................................................MKEDXYELLGVSRQATQDELKKAYRKMAVKFHPDKNPGXXXXXX--------------XQKRAAYDRYGHAAFXXXXX---XXXXXXXPFHDPFDIFSEVFGGGGGRSSGXSGAQRGSDLRYDLEXQLEDAAKGTEKEISFRKPVXCTRCKGNGAEPGTGVVXCPTCAGHGQVTVSKGFFSVRQTCSTCHGSGKKVEKACSTCGGEGRVNETTKIKVKVPAGVDTGSKLRGGGPSGDLYIVIHVAEHEIFERQEENLFCQIPIKFTLASLGGTIEVPTLTGKASLKIPAGTQSGTTFRLKGKGIPSLRGGYFGDQMIRVEIEVPTSLSSDQRQKLEEFALACGDADEPV----------------------------GKTFFDKAKKFF.. 383
5 0.000e+00UniRef50_A0A2E0JQY1 Chaperone protein DnaJ n=188 Tax=cellular organisms TaxID=131567 RepID=A0A2E0JQY1_9EURY  ali  31  4..........................................................................................KRDYYEVLDIKRDASQSEIKKSFRSLARKFHPDKNPNDPESELKFKEVQEAYAILSNPEKRK-YDTYGHNGPGGSPFGAGGXQGEDLFGGGFESVFSSIFG---SSSPRRNKRQRGSDLLVSHSIPFEALMNGCEESLEFEVLKTCNDCNGLGSKNMDDVRECPACDGRGRIQRRLGPFTQQVVCPSCKGEGRIIQNPCSNCRGQGRANQTKKVQFTVPPGIENGQRLRMSGDPGHLYIEIDVQEHEWFERDGADLLMALPLTFTDLVLGTTVEIPHLDGEIKIKIPPGSKPSQTISVKGRGLPSNRRNGRGSIMVLLKLDMPEKITRTFKKKLIDIRDEMNYSNEELEEKIRKEARSRRN............................. 382
6 0.000e+00UniRef50_A0A2E3XLC3 Chaperone protein DnaJ n=18 Tax=Bacteria TaxID=2 RepID=A0A2E3XLC3_9BACT  ali  32  4............................................................................................DLYDLLGVSRTASLTEIKKAYRELARKFHPDANPDDAEAEQKFKDIAMAYEILSDHEKRSQYDQFGAVG---------SAGSPFQGAGGISDIFEAFFGGFGSSGFQAQQRNSGEDVEIGLNITLEEVVNGGEAEFTLNLALECETCTGSGSQNGES-ESCGRCDGHGQLQQVRGQIMSTAVCPSCQGFGTLITDPCSSCGGVGIKKSEKSFSIEVPKGVDTGITQRLGGERGDIHVRYVVERHSRFSRNGENLLEQLWIPVTFAALGAEIEYETFDGMQKLKIPAGSRTGDKFRYSGLGVPRLQRRGRGDLIVEIVVDTPQNLSEVSKRLMIELAEEFGETLKEKPKRSRKSKRNE............................... 366
7 0.000e+00UniRef50_A0A1L6MYQ1 Chaperone protein DnaJ n=1 Tax=Pajaroellobacter abortibovis TaxID=1882918 RepID=A0A1L6MYQ1_9DELT  ali  29  7............................................................................................NYYETLEVDRSANAEEIKTAFRKLAVKYHPDRNQDDPEAGNKFKAINEAYQVLSDPKQRARYDQMGSTWDRSPFEEQNPFSD--FTSVSPEGIFDELFNFFGGHSRPSG------NLQTQIEISLEEAAFGCEKKVSYERRVICPACRENRQHTRGRTAVCPTCQGNGQLLSSSFFVFTGRICPSCQGSGRVIPAVCNQCNSTGLITITNTLTVTLPPGIEDGTTVTRAGPPGNLELRIAIRPHPIFQRMGHDIECKATIGFPQAALGTEIEVPTLEGARKLRIPAGTQPNTVLRIKGKGLPHHNQSQRGDQLVTIHIQVPISLTSYQQELLEKLALSLDGKEAIGHL----------------------------SLFQRVRRFFSN 368
8 0.000e+00UniRef50_A0A1E3Q0A9 Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3Q0A9_LIPST  ali  29  26....................................PYSVCASSRFSSTSKTRANPARPTVSPKPHSERKRSNSLPFQSRRSFHSSSLNGRSDPYGTLGISKNASDKEIKKAYYALAKKYHPDVNTED-GAEKKFHDIQDAYEILSNAEKKSQFDSFGPGAFGGADAPGDAGGGPFNPFSDMEDLFSAFTGGSARGRGRRSQEFKGDDIEVLVSVSFMDAAKGISKDVSYNPLVACHTCSGTGLKTGHKRATCPKCRGTGQVHMTDGGFAIGTTCNTCGGTGVFVKSACSTCHGEGILKTRRTTTVDIPPGIEDGMRLRVSGEGGDLYVRVKVEPHAEFTRKGPHVFYTAEVPMTTAALGGKVRIPTLSGEADLTVPPATQSGMTVTMTGRGMPMLQRNQNGDMKVTFKVNTLRPTNAEQTRLLEMLADAFNDRSARRTQTNRDK................................... 477
9 0.000e+00UniRef50_A0A076NQ18 Chaperone protein DnaJ n=14 Tax=Corynebacteriales TaxID=85007 RepID=A0A076NQ18_9CORY  ali  33  8.........................................................................................ANKDYYGDLGVSSSASAADIKKAYRKLARENHPDSNPGNKAAEEKFKRVAEAYDVLGNEQERKEYDQFKSGFGRFGGGGSGFPGGFRTTQTDFSDVFGHPGAGRGGAAGRNARPSRGADVETEITLDFREAAKGTTFPVELTGEAPCTTCHGSGSKDG-KTHRCGTCSGSGYVRENSGAFGMARPCAECQGTGEIIEDPCTTCHGTGTVRRTRSITVRIPAGVIDGQKVRLAGQGGDLFVHVHVREDAVFTRSGDDLEVTVPVSFGELALGGTVTVPTLEKRVRVKIPAGTPNGRTLRVKGRGVPR-KSGKAGDLLVTVEVAVPKDLDAAATSALRAYHQAERDS.............................................. 380
10 0.000e+00UniRef50_A0A1F5AZN4 Chaperone protein DnaJ n=2 Tax=Candidatus Azambacteria TaxID=1752741 RepID=A0A1F5AZN4_9BACT  ali  31  1........................................................................................MAKKDYYHVLGVQKGSSEDEIKKAYRKLAHQHHPDKTGGN---EAKFKEINEAYQVLSNKEKRAQYDTHGRTFPGDFGGGGFQWDFGGAGAEGFSDIFGDMFGFGGGARGGRSRASRGEDVQVALVIDLEDAAFGKEKEIQIKRQVECTHCGGTGAEPKTDIATCDTCKGSGEVRKQFGVMAQAAVCSACHGRGKIPKHRCSSCGGDGILKETDTFRVKIPQGIDSGEAFGVPGKGGNLYVVVTIVKHPKFTREGDDLHVKFPVTFSQAVFGDKVDLETLHGPIRLKIPAGIQSGTVIRVGGKGMPRKGGYGKGDLLVMVQVRTPEKLSKRQ............................................................ 348
11 0.000e+00UniRef50_A0A1Q2CH15 Chaperone protein DnaJ n=2 Tax=Propionibacteriaceae TaxID=31957 RepID=A0A1Q2CH15_9ACTN  ali  30  2....................................................................................STKDWLEKDYYKILGVSKTATSDEIKKAFRKIARDNHPDQNPGNKAAETRFKEASEANSVLSDADKRKEYDEGGFRFNKPGQPGAAGFEDGGATNPGFGDLFGGLFGAHDGPTRRQRGPRRGADIEGDVTISFEQAVEGATVTMRTVSDRPCPGCRGTGAKAGTLPRVCPTCEGSGMQSRSGGVFQMSEPCVDCLGRGLIVDEPCPDCDGSGRGRSTKTMQVRIPAGVSDGQRIRIKGKPGDLYVGVKVTPHKLFGRSGSNLTLEVPVTFTEASLGAEIQVPTLSGKIRLRIPPSTPNGRTMRVRGKGARKPDGTM-GDLLVTIDVQVPDDLSEEAKAALQEYAEKAHETNPR........................................... 377
12 0.000e+00UniRef50_P25491 Mitochondrial protein import protein MAS5 n=233 Tax=Eukaryota TaxID=2759 RepID=MAS5_YEAST  ali  26  1.......................................................................................MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSE-EAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFG---DDIFSQFFG--AGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA-VKKCTSCNGQGIVTRQMGPMIQQTECDVCHGTGDIIKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDLKVGIVPGIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKFPENHSEENLKKLEEILPPRIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEE............ 397
13 0.000e+00UniRef50_A0A0N1I257 Putative chaperone protein DNAj n=32 Tax=Kinetoplastida TaxID=5653 RepID=A0A0N1I257_LEPSE  ali  32  11......................................LRRVVSATALRTPLLVANTAAPPTVANSPSSTLSGAAAGALHSHRRWQSGSAKKDLYSVLGVPRNATAEQIKSAYKKRAKALHPDVNPS-PTAAEDFAEAKQAYETLSDPQKRSMYDMTGAAGGNPFANMGGNPFANGFSFNDFEEIFQKMSGSGKDKTRKPQGPEPGADIHYKLTLAFLEAVNGCQKEISYNTMRRCGACTGSGFQDTGSRAKCPHCGGRGKKVMSTGFFHMQQDCTHCGGTGELGRTTCTQCSGKGIVKDRSVQTLPVPKGVDNKERLKVTGPPGNLYIEISVEEHPVFHREGSDIHVITPITLSTAVLGGTVRVPTLTGEVETRVPVGTQQGDKLVLRGRGVHRPNQNKTGDFFIHFAVMLPKSLTEAQKKAIADFAKDEKPLNLSDTELQELKGRYRS.............................. 459
14 0.000e+00UniRef50_A0A023X0D9 Chaperone protein DnaJ n=1 Tax=Rubrobacter radiotolerans TaxID=42256 RepID=A0A023X0D9_9ACTN  ali  32  1........................................................................................METKDLYKTLGVGKDASREEIRGAYRRLARKYHPDANPDDPAAEERFKEIQNAYEVLSNPERRREYDRGPETFF---GQGGFRDGGRPDDLSDFADLFGNFFGDIFGRSTSARTKQRGDDVTVSVNLKFNESLNGVTTRVRVVAEEVCGDCGGSGASPGTAIRTCPDCGGRGTRSRDQGFFALSETCPRCRGEGVYVEKPCSSCAGTGRVERPRQVTVRIPAGAKDGTKVRVPGPPGDLYVVTRVEEHPVFKRRGDDFVVEVPVSFVEAALGAEVPVPRPGGRVRLKLPAGTQHGRQLKVRGAGAPNVKKKGQGDLIVKVSVVVPKKLTRREREILEAFAEERDEDVRE........................................... 361
15 0.000e+00UniRef50_Q6FNQ1 Uncharacterized protein n=37 Tax=Dikarya TaxID=451864 RepID=Q6FNQ1_CANGA  ali  26  1.......................................................................................MVKDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSE-EAAEKFKEVSSAYEILSDSQKREVYDQFGEEGLSGNGGAGFPGGFGFG-----EDIFSQFFGGATGG--RPRGPQRGRDIKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGA-VKKCSSCNGQGIVTRQMGPMIQQTECDVCHGTGDIIKDRCKSCNGKKVDNERKILEVRIEPGMKDGQKIVFKGEPGDVVFVISEKPHKHFQRAGDDLIYEAEIDLLTALAGGQFALEHVSGDLKVDIVPGIAPGARKIVEGKGMPIQKYGGYGNLLIKFNIKFPENHSEENLKKLEEILPPRRPAKAQVDDCVLSEFDPSKFGQSNGRSGANYDSDDED............ 395
16 0.000e+00UniRef50_J9JBH0 Chaperone protein DnaJ n=3 Tax=Oxytrichidae TaxID=57506 RepID=J9JBH0_9SPIT  ali  35  52...............................................................................CRTFKSSNILNKKDFYASLNVARGASQDEIKKAYFKLAKQYHPDVNKA-PEAKEKFAIINEAYETLGDDSKRKVYDQTGMNADEQQQAGAGGPFDGGFGFGDVFEEFEKFFTGGGGPRGSKRAAQKGKDIVMALEIDFMDAVNGSNKTINFSRVDVCGTCKGSKSKPGTSPSTCGGCGGTGYQTMRQGPFTIQQQCGNCDGQGTVIRNPCMTCRGRGSVSNTVKEQVNIPKGVDSGVNLRISGPPGDLMIQIKVKPHPYFKRDGSDINTDLFVTVSQAILGTEATVKTLYGDIKLKVDPGTQNEERKKISNYGVQKLNQHQKGNHFVTMKVVIPKVLNDEQKRALEAYAKVEEKIPNT........................................... 444
17 0.000e+00UniRef50_A0A0F7S786 Related to MDJ1-heat shock protein n=26 Tax=Basidiomycota TaxID=5204 RepID=A0A0F7S786_9BASI  ali  29  30................PRRSFVSRTSTSLPRAEASAATSSSQ--LPASSWTLVSWSRASTARPRSCSSCGHQISTSSQRSFSSSSIRSASAKDPYSVLGVKKDANTKDIKRAYYDLAKKYHPDTNK-EKNSKERFVEIQNAYDLLSDEKKRAAYDQYGSTDGQPGFDPFGGAGSSPSNASNAGSIFESLFGAFGGGGRPGQRGPGFEDLETTINLTFEEACKGTKRKVVINPIERCGTCTGSGLKPGAKKSTCATCNGTGTRTFVQSGFQMATTCPSCGGVGSTVADNCNTCDGIGRVRGRKEVEIDLPAGVDDGFRIRFGGTPGSLYVRINVAPSRIWRRQGSTLFYPATIPFHTAILGGKVRVPTLDGPVEVRVPAGTQVGEEMILPGRGVPSPRRGQKGDLMVQFEVSMPRSLTKRQREILQQYADEVEGRSSSAPASSDSNSASFSSSSKPSKAAGASTASSPRD........... 519
18 0.000e+00UniRef50_A0A2E2VWZ7 Chaperone protein DnaJ n=3 Tax=root TaxID=1 RepID=A0A2E2VWZ7_9BACT  ali  29  1..........................................................................................MRDYYEILGVPKTSSKDEIKKAYRKVAMKFHPDRNPDNKEAEDKFKEAAEAYSVLSDDNKRSQYDQFGHAGVNNSRGGG------FSGGMNVEDIFNDIFGGFGSQRSSGNRRRKAENLKISIPLTYEEIFEGTSKKIKIKRWE----------KSSSDAQKCPTCNGTGEIRNVQGQIVNVQVCPNCKGMGYI----------GGRDKKTATIKVKIPAGVSDGNYMTLEGEGGDLIIYFEEKPHSLFVRSDSDLYLECVINYSDAVLGTEVKVPTLNGKVKFKIPAGIKNGQILRLKNKGFKEVNGYGRGDQYIKVNIDIPLNISKDLKKIILDLKNNLDDEIKFKK......................................... 352
19 0.000e+00UniRef50_P63967 Chaperone protein DnaJ 2 n=584 Tax=Terrabacteria group TaxID=1783272 RepID=DNAJ2_MYCBO  ali  31  1.........................................................................................MARDYYGLLGVSKNASDADIKRAYRKLARELHPDVNP-DEAAQAKFKEISVAYEVLSDPDKRRIVD-LGGDPLESAAAGGNGFGGFGGLGDVFEXXXXXXXXXXXXSRGPIGRVRPGSDSLLRMRLDLEECATGVTKQVTVDTAVLCDRCQGKGTNGDSVPIPCDTCGGRGEVQTVQGQMLTSRPCPTCRGVGVVIPDPCQQCMGDGRIRARREISVKIPAGVGDGMRVRLGGPAGDLYVEVHEQAHDVFVREGDHLHCTVSVPMVDAALGVTVTVDALDGLSEITIPPGTQPGSVITLRGRGMPHLRSNTRGDLHVHVEVVVPTRLDHQDIELLRELKGRRDREVAEVRSTHAAAG----------------------GLFSRLRETFT. 380
20 0.000e+00UniRef50_A0A0G0IY44 Chaperone protein DnaJ n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A0G0IY44_9BACT  ali  31  2..................................................................................FHVARVMA-KNYYDILGVPKGASKDEIKKAYRKMAHQYHPDKKHGN---EAKFKEANEAYQILGDDQKRAQYDRFGTGFNDNSGGSSSRGGSWGGDGGFNEDIFGEMFGGG-----KRSRSRRGQDIKMDFDIDLEDSVSGKDVEVNFKKVSLCDECKGQG---GFDPENCARCGGSGQVNQVFGTMSQIVSCQKCHGQGKFFKKVCGECHGQGRAKKTTLFKMRIPKGILDGEMIKFSGEGGDLFVQAHFKPHKHFKYEGVNIYYDLTIGLTQAALGDKMEIPTLYGSVKLKIDPGTQPQDIIKISGKGLPKRGSGGHGDMFVKIKVLVPKHLSHKQRELLEELKKE.................................................. 363
21 0.000e+00UniRef50_A0A1H3P6Q3 Chaperone protein DnaJ n=20 Tax=root TaxID=1 RepID=A0A1H3P6Q3_9PROT  ali  32  2.................................................................................................LGIARDVDQKAIKDAFRTLALKYHPDRNK-EPGAEERFKEIAEAYAILSDPAKRAEYDARGFAGV------AGTSREDLFSGINFEDIFGNLFDGFFRRHKKQAESIRGANIEMDLYVTLERVAAGGEEVVHLTRPVACSACHGTGGEGGIAPRKCKTCGGTGRMTYSHRLIQQIVPCSACHGRGSINDHPCPQCHGSGEVEQEETLTVKIPAGIEEGMALRIAGKGGDLFVVVRTREDARFERAGADLWHTVTLPLSDAVLGATLKVHTLDGAIEVTVPAGTQSDAILRLKGKGLPVFKSDRLGDLYLRIRLKVPEHLSHEERELYEQLRAISHKP.............................................. 356
22 0.000e+00UniRef50_A0A0G1JQ86 Chaperone protein DnaJ n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1JQ86_9BACT  ali  34  1.........................................................................................MAKDYYNLLGVSKNSSEEEIKKAFRALAHQYHPDKKSGN---EAKFKELNEAYQVLSDPEKRKKYDQFGASFEQMGGGGNFGGNEFAGFSFDIGDIFSEFFGGRASSSSMSGASRSRSDIEIAIEIEFLEAVTGAERTLELKKFDKCSRCKGNRAEPGTPLITCKECGGRGEVQTILGVMRTSGQCGKCGGEGVFPKLNCKHCNGDGMERVAKKIKVRIPAGIQNGEAIRISGEGGDLYVGVRIRSHHKFKRDGDDIHSSELISFTQAALGDKIRADTAHGKVELKIPAGTESGTAFKLKHKGVPSLRGGGEGDHYVTVKIVVPERVSAKAKKLLNELKEE.................................................. 379
23 0.000e+00UniRef50_A0A2D6P316 Molecular chaperone DnaJ n=2 Tax=archaeon TaxID=1906665 RepID=A0A2D6P316_9ARCH  ali  34  1........................................................................................MTKNDYYEILGVNKDSSKEEIKKAYKKLAKKYHPDLNK-EEEASEKFKEISEAYAVLSDDDKKQTYDNYGHDGFDQRY-----SQEDIFRGADFDSIFQDIFRGQGGFGGGGRQRTKGNDLSFNLEISFKEAALGVKKKIKLPKKVKCEDCEGTGAKNG-KLTTCNVCKGNGQVRRVFGAFTQVSTCYNCKGYGKMAKEKCGSCK-DGLIEKVKEITINIPEGVDDGNTLRVENEGGDLYVVINVDEDDVFERKGSDLFLDYYISFPQAVFGTTLSVPTLKDKIKVKVPSGTQSGTVFRVKDSGVKNLNGYGSGDLYVKTNVKTPTKLSSKQSKLLKDFSTDRKEKV--------------------------EFGKKDVGLFDKIKDIF.. 375
24 0.000e+00UniRef50_A0A078KH62 Chaperone protein DnaJ n=3 Tax=Zymobacter group TaxID=114403 RepID=A0A078KH62_9GAMM  ali  28  21........................................................................................MVKRDYYEILGISKHADLTDIKKAYRKLAQKYHPDRNPS-KEAEIKFREISEAYDTLSVVKKRANYDKFGH-----------SNNDSNSNSTGFGDIFNDVFSDIFSNRNKNTQSKTGSDLHYEIEITLEEAVYGTNLDISIPRLIKCKICKGEGSEPGTRKRTCNTCNGIGQIRIQQGFIIIQQTCHKCNGQGYKIDMPCYKCHGHGLLREKCLLLINIPEGIDNGDKLRIHGKPGDLYIKIKIKNHLIFERKFFDLYCDIHVNFIDATLGGDLIVPTLKGRVKLKIPPETQTGKVFRLRRKGVKSLTNNSIGYLFCKIILETPMNLNKTQKKLLKDLKNNINGKIPETTPLPNR-------------------------WFNEVKKFFEN 384
25 0.000e+00UniRef50_A0A1W9LN00 Chaperone protein DnaJ n=8 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1W9LN00_9BACT  ali  33  1.........................................................................................MTKDYYQILGIKKDASKEDIKKAYRKLAHEYHPDKKGGN---EAKFKEINEAYQILSDEQKKQQYDRFGRAWGKPGGGRERDFDFDFGGMNDLSSIMEEMFGFGGQRGGERGKKKNGKDIRIDIEIPLKEVMQEQKKNIILEKMSSCSRCQGKGAEPGTPIKECFSCRGVGYVQQIRGSFTQRVVCPECKGEGNRPEKSCNVCMGEGRIKGNETITFSIPAGVDANQVIKMEGKPGNLYIRISVGSHPVFQRKADDLISGFPISFSQAVLGGEIKITTIDEKISIKIPSGTQSGKILRVSGEGIPHFSGRGRGDLYIQLTINTPQKITKAQKDLLEKLKEE.................................................. 381
26 0.000e+00UniRef50_A0A1Y4DG98 Chaperone protein DnaJ n=11 Tax=Bacteria TaxID=2 RepID=A0A1Y4DG98_9DELT  ali  32  3.........................................................................................SKRDYYEVLGVPRNATQEELKKAYRKLTFQYHPDRNPGN---------------------KRARYDQFGFDGVDQGQG-----------FASTSDIFSQFGDLFGDFFGSGTAAMQGADLRYELTITFEQAARGDEAKLVLPRHETCGTCHGSGAAPGTKVETCPRCKGTGHIHRSQGFFSLATPCPYCHGTGQHIPRPCPTCHGEGLVKKTKELYVRVPAGVDSGTRLRVHGEPGDLYVIVRVEPSKVYERQGQDLIYTTEISFTQAALGCRIEVPGLNGELPLEIPKGIQSGTILRIANEGLPYIGRSQKGSLLVDVKVITPTKLTERQIELLREFEELSQKPDS............................................ 350
27 0.000e+00UniRef50_A0A1Y2FID3 Uncharacterized protein (Fragment) n=1 Tax=Protomyces lactucaedebilis TaxID=56484 RepID=A0A1Y2FID3_9ASCO  ali  36  1................................................................................RAFSTARRLQAQDPYKTLGVDKSADKAKIKKAYFNLAKKYHPDSNK-DPKAKDKYVEVQEAYEILKDPSKKEQFDTYGANGFDANGNPQNNPYGGFGGFGNFEDLFSAFGGGARGGTSGRSQILVGDAVEVAATISFMEAAKGTGKQITIEPLVKCRPCTGSGLKPGEKKSACLACGGAGRVHIMQGGFQMQMTCEVCQGAGIVIPKACGTCHGEGVVRERKTVKVDIPAGIEDGMRLRVAGEGGDLYVHVRIQPSKGFAREGPNLRYKATVPMTTAALGGHCKIPTLEGDVNIKVTPGTSTGDAITMTGKGMPRIRSRGPGDLTVEFKVQMPKQLDPKQRSLLEQLAQSLGDATARRDD........................................ 401
28 0.000e+00UniRef50_A0A2E8T9W3 Chaperone protein DnaJ n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2E8T9W3_9CHLR  ali  26  1........................................................................................MTNKELYSILELTREASTEDIKKSFRRLAMQYHPDKNKDD-DAEEKFKEVTFAYNILSDPEKKARYDSFGMEGVVNE----GANFSDFSNFGGLGDIFDAFFQGTAS--TQKQTNLRGTDIAIELQVSLEEVHKGAKKTIHFEHNTACSKCKNTGQKNGAQLGECKECNGTGEIRRVFGQFVNVMSCNMCTGQGKIVTDPCEDCSGFGIKLEESTKDIDIPKGIRSGQKIRIGGVPGDLYLHINVNEHKVFKRIEDNLIYEMAISVPDALIGFEKNIPLINEEKKMKFKPGVQHGQLFRIKKKGMPGLNSNAHGELIVVANIIIPKKITNTQKKLIQELGNTLTLDSEQIPEE....................................... 361
29 0.000e+00UniRef50_A0A0D8FWD3 Chaperone protein DnaJ n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A0D8FWD3_9ACTN  ali  32  9..........................................................................................EKDYYKVLGVSPTATDKEITKAYRALARKYHPDSNAGH---EEQFKEVSAAYDVLGDATKRKEYDRMGASGMGGMGHNPGANGNFNVHSEDLGDLIGNLFN----RGKRSSGPKRGEDQGAEVRLSFADAASGATASVVVIGETSCSVCNGTGAAPGTVPKVCARCNGSGSVSDNQGFFSFSQPCPACHGRGLLIEQACSSCKGTGTEHRARTVKVRIPAGVEPEQTIRVRGKGGDLLVKVHVEPDPRFGRKGADLTTKVAISFADAALGGTVTAPSLSGPVTLKIPAGTHSGQTFRVRGRGLPNPRKNTVGDLLVTAEIVVPETLDARQKKYLQDYRKVFGEKVQENSGQEK..................................... 369
30 0.000e+00UniRef50_B5Y7H3 Chaperone protein DnaJ n=4 Tax=Coprothermobacter TaxID=68335 RepID=B5Y7H3_COPPD  ali  29  1..........................................................................................MKDYYEILGVPEDASVDEIKKKYRELVKQYHPDLNKGDEEAAKRMAEINEAYQVLTDPKKRAEYD-----AMRKGGVGFSSEYYRPGQGFDFFDIFRDFFTDFPFGSSFFNRKPRGTDINLEVTLSLKDVVTGCTKSLRFFRDELCEECHGTGAKDG-KTKTCERCHGTGVVSTPFGVFITQTTCPTCHGAGSVPEQVCPVCHGTGVVKRQRTLDLQIPPGIENNDVITLKGQGGDINVTVKIIIPPPWRRKGKDLYTEVHVPYYHAILGGKIKVTTATGEEKLLLEPGTQPDQEYILANEGVPDKSGRYRGDLHVTIKVDLPSKLSPQERKFLEEIRKLHEGDNKKRFGL....................................... 364
31 0.000e+00UniRef50_A0A2G6JMM7 Chaperone protein DnaJ n=17 Tax=Bacteria TaxID=2 RepID=A0A2G6JMM7_9BACT  ali  30  4..........................................................................................KRDYYEVLGVQKGASADEIKSAFRKIAMKNHPDRNPDDKGAEARFKEAAEAYSVLSDEEKRAQYDRF---GHAGLSGGAAGGGFGGQGGFSVDDIFEAFGDIFGGGGGGVFEGLFGGGLRVDLQVTLEEIATGVERSIEIARNVTCDSCSGSGAKAGSAPVICNTCAGHGEVIQSQGFFQVRRPCPQCRGTGKTIKDPCSSCHGSGRVRRREPKKIYIQPGAEEGHVERLGGPPGDLVVVVHVQEHEFFQRHGADLLCEIPIRFGQAALGGSTQVPTLSRPVEMKIPKGSQPGQLLRLRNQGLPMGGGRSRGNLLVRLTIDVPKKLSSRQEELLQEFDELDSKNPRSKTSDGSSDSSGHSGKSGD-----------ERGFFDRIKDIF.. 398
32 0.000e+00UniRef50_A0A2H6AL26 Chaperone protein DnaJ n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2H6AL26_9BACT  ali  33  4..........................................................................................KRDYYEILGVPRNASKEEIKRAYRRLARQYHPDLNPGXXXXE-----------------KRKMYDMYGTAEFQPGAAPGGGFEFTFGDFSGFEDIFNEVFGE----REPTRVRRRGRDLEYQLEIDFDTAIKGGVKDITITRETICPGCGGSGVRIGAGARVCPKCRGSGRSLFTS-FLNISRACDMCGGSGKISTEPCNTCNGSGKRITTETISVKIPAGVDTGSRIRVPGKGGDLYLVIKVRPHPLFRREQDDLYIEVPITVYEAALGAQISVPTVDGTAVVTIPPGTQSGTKLRLRGKGVPHLRDGGRGDLYVITKIVLPEKINESARKKFEELAKTSPYNPR............................................ 360
33 0.000e+00UniRef50_A0A124G0E7 Chaperone protein DnaJ n=1 Tax=candidate division TA06 bacterium 34_109 TaxID=1635277 RepID=A0A124G0E7_9BACT  ali  31  1.........................................................................................MEKDYYKILNVDRNATPDEIKKAYRALAKKYHPDLNKDNKEEAEKKFKISEAYEVLIDPEKRKIYDAYGYEGVSGQFSQGGFSWQDFSHAEDISDIFKEFFGGRFGGSFSHRGERKGKDIKINLRLTLEEIFSGTTKTLKYSRYEKCKKCDGKG---GTDIKVCPDCKGTGQRQTVFGTVVQVATCPTCSGEGKVVGNKCKDCFGEGIVKVEHSVKVDIPAGVYDNSYMRLQGEGGDLIIVFQEVPHKKFIREEGNLKTEVYIKYPTAVLGGEVTIEIIDNKLKLKIPSGTESGKVFIVKGKGLPDPNNPRKGNLLVKVNIEIPKNIDVKAKNLLKELERI.................................................. 372
34 0.000e+00UniRef50_Q7V3Q3 Chaperone protein DnaJ n=53 Tax=cellular organisms TaxID=131567 RepID=DNAJ_PROMP  ali  31  3............................................................................................DFYQILGVSRDADANTLKSAYRKLARQYHPDVNK-DPGAEDKFKEIGKAYEALADPETRARYDQF-----GEAGIGGAAGMPDMGDMGGFGDLFETFFNGFGGQRSQRRGPQQGDDLRYDLNIDFKDAIFGQQREINIPHLETCEVCRGTGAKKGTGPTTCTTCGGSGQVRRPFGNFTQVAECPTCNGVGQIISDPCTSCGGNGVKQVRKKLRINIPAGVDSGTKLRVSGEPGDLYVFIKVKNDSNLKREGINIYSEISVSYLQAILGDTVDIITVDGKVNLKIPSGTQPNSTLSLENKGVPRLNPVARGNHQVLVKVKLPTRITEDERNLLEDLASKYTEQNSSSNS........................................ 363
35 0.000e+00UniRef50_A0A1S3AZY1 chaperone protein DnaJ isoform X1 n=26 Tax=eudicotyledons TaxID=71240 RepID=A0A1S3AZY1_CUCME  ali  25  59......................................FPNQPNLYFGSSSNYSGFSRLFGPLRRRDFQTRSR---LTFVNCGAGATRAAATDHYSTLNVSRNATLQDIKNSYKKLARKYHPDVNK-EPGSEDRFKEISAAYEVLSDDEKRYLYDQLSEAGVQGDYG----VMSRDSQGVDPFEIFDAFFGGSDGLFRQRSEKIQSLDIHYALHLSFEESVFGGEQAIQFSFFETCGKCDGTGAKSNSCIKLCANCHGRGGVVTPFGMMSQVSICSECGGDGKKITELCRSCGGSGQLQSIKKMNLVIPPGVSDGATMKIQREGGDLYIMLHIGEKHGIWRDGIHLYSNISIDYTEAILGTVVKVETVEGLKDLQIPAGVQPGDRVRLPFMGIPDINPSVRGDHLFIVNVQIPKRISDSERTKIKELAKASTKNDEVYTHGLPLGIFDKYADKNQGNLVSSQEIKRHTSLWSSIKYFI.. 517
36 0.000e+00UniRef50_A0A2I0A3C9 Chaperone protein dnaJ 1, mitochondrial n=164 Tax=Magnoliophyta TaxID=3398 RepID=A0A2I0A3C9_9ASPA  ali  34  21.............VYERVAPLLSGLPEGLARDGSDGILPFRAMSYFSSSSNGCSTGIQSLDTFFKTSS--------SFSNRSFHATGSTVERDYYEILGISKNATQEDIKKAFRNLAKKYHPDANRSSPAAKRKFQEIREAYETLRDPDKRTHYDM----GFSRGAESVSYDAYAAEFQNSSHDPFSSTFYKVFSEVFENDREVYAADIQVELNLSFDEAARGCIKQVSFMAQVPCDSCSGKGHPNNSGLSICPTCRGSGKVTI----FPFTSTCGSCKGFGRLIKDPCLVCEGSGVVDGIKSVNVSIPAGVDSDDTIRVPGGPGGLHIRLQVSKDPIYHRDGADIYVEANISFTQAILGGMIEVPTLSGKAPVKIPKGVQPGQLLALRGRGLPHIGSASYGDQFVKFRVCFPLSVNDRQRELLEEFAKEE................................................. 436
37 0.000e+00UniRef50_A0A2H5ZZT2 Chaperone protein DnaJ n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5ZZT2_9BACT  ali  39  3.........................................................................................AVKDYYEVLGVSPEASAEEIKKAYRKLAKRYHPDANPNDPSAAEKFKEVSEAYSVLSDAEKRKQYDRYGAFAGTGAGSGDLGFGGFGGLGDLFSSIF------------GRSRRAAVEPIEVTVPVSFATAARGGKVTVEIPVNETCPACGGSGAAPGTRVAACAECGGRGTVTFGHGGFSVSRPCPACRGRGRHVAQPCARCMGQGEVRIGKRVVVTVPPGTEDGQTVRLRGPPGDVLITFRVEPDRFFRRDGLDVYCTVPLNLAQALLGTKVRVRTLDGKVVLKIPPGTSPGKKFRIPGQGIEK--NGRRGDQYVEIAVNLPERLTPEQERLFRQFADSLG................................................ 352
38 0.000e+00UniRef50_A0A0D2WHE3 DnaJ protein n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2WHE3_CAPO3  ali  33  101...........................................HSTRAARGADTTSGRAAVSVLERAGSTAKTCSPFASSRGFHTSAAAASKDLYATLGVSKTATVSEIKKAYYQLAKKYHPDTNKTDKDAAKKFSEISEAYETLSDETKRQRYDTYGTTGDNQFGGGGSGGFDPNSDFHHFQDIFRQFGGGGAFGAGTRGGKRRGSDVRIGLEVSFMDAIDGTTKTIDFPTVTACTPCNGTGSSTG-KTTRCPSCRGTGMETVSTGMFAMQTTCRKCSGAGQVVQDPCKSCHGQGSVESHRKLDIKIPPGSDHNQSIRVPGAGGDLWVVLQVGSHPSLERQGPHIISQVEIGLSQALLGGTVPIQGLRSKFTLTIPPKIADGTMLRMRRLGVKTED--GQGDHLVSVRLKLPRNLTELQKAALIQFAKDEK-YTGTVNGVEDASASSTSSSNASSASDNS-----GKTILDKFKETF.. 543
39 0.000e+00UniRef50_I4YID6 Uncharacterized protein n=2 Tax=Wallemia TaxID=148959 RepID=I4YID6_WALMC  ali  29  11..................................................SLQFSLQSKHTSKFLSSRTLSKRAFSTTAKSSFKATLPTSQKDPYQVLGVSKDAPTSEIKKAFYQLARKYHPDTNK-EANAKEKFVEIQSAWETLSDETKRKNYDQFGPASQQQGFDPNMYGSSPFGGGGNASDLFEQLFGSGAGRGTRGGFGSRGDDIESTVSIPFLDAAKGKTVHLDTRPLKNCNSCKGNGLKRGKSRSTCKACNGVGSRTFVQGGFQVASTCQVCQGSGSSINDECDSCDGVGKVRGKGTVEVKIPAGVEDGMKVRVDGPPGDLYVRISVKPSKDFKRQGMHLFHSAKVPLHVALLGGRHRIPTLDGEVDIRVPAGTQPGEEMVLRGKGVPRIRGMDKGDLMVGFQVQMPRHLSPLQREILEEFKEEVKEDVKEDAKEVKKEDXXXXXXXXXXXXDTKSKEKKEPGIWNKIKDNF.. 508
40 0.000e+00UniRef50_A0A1V5H8G0 Chaperone protein DnaJ n=8 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5H8G0_9DELT  ali  31  1.........................................................................................MARDYYEILGVPKDASANQIKEAYRKLSRKWHPDINPGNREAEEKFKEISAAYDVLGSEDKRRLYDEFGEAGLHPGFDEQQAAAEDFGRFRSYEDIFGNLF-DFEQEGPAFHERARGRDLEYTMSIDFVSALKGVQTEIAMDKTKVCPTCRGNGIDPGAGAATCTVCGGTGRLDVARGPIQFTKPCPRCRGTGR-IGKPCPTCAGQGMVSGVERIKVSIPPGVMEGSRVRIAGKPGDLYLVIHVPEHPFLKREGDDLTMEVPVTVREAMAGGTITVPTVDGRIRVKVPPGSQSGQTLKVRGKGALNPKTKQKGDLLIRLVVKVPRTEDKEALDAAEKIERLYQGDVR............................................ 378
41 0.000e+00UniRef50_Q8TA83 DnaJ homolog dnj-10 n=24 Tax=Chromadorea TaxID=119089 RepID=DNJ10_CAEEL  ali  39  6......................................................RSSGLIHRSVPLLAQVSTPTTSTTKLAQLHTTHALSKEDYYKTLGVDKKSDAKAIKKAYFQLAKKYHPDVNK-TKEAQTKFQEISEAYEVLSDDTKRQEYDAY-GSGGGPAGGRGGAGGFHHHGNVDVNEIFRRAFGGFNFDNFAQSAFGHSAAQEMVMDISFEEAVRGATKNVSVNVVEDCLKCHGTQVEPGHKKTSCPYCNGTGAVQRLQGGFFYQTTCNRCRGSGHYNKNPCQECEGEGQTVQRRQVSFNVPAGTNNGDSLKFQVGKNQLFVRFNVAPSLKFRREKDDIHCDVDISLAQAVLGGTVKVPGINGDTYVHIPAGTGSHTKMRLTGKGVKRLHSYGNGDQYMHIKVTVPKYLTAEQKQIMLAWAATEQLKDGTIKGLEKSESQKRRSEPVAENAETIDENQENEGFFEKIKKIFG. 456
42 0.000e+00UniRef50_A0A0D8HJ58 Chaperone protein DnaJ n=1 Tax=Acidithrix ferrooxidans TaxID=1280514 RepID=A0A0D8HJ58_9ACTN  ali  31  9..........................................................................................EKDYYSILGVDKSASEKDIRNAYRKLAKAYHPDAHPG---SEEKFKELSSAYEVLGDAKRRSEYDSFKDQSPFMPRTGGGGGGSEPGFNFKVEDL-GDVFGGLFNKGRRNPGPQRGSDVDTSLSITFIESIEGLTTSVNVIGEAQCRTCHGTGAAPGSSPVVCARCQGSGSVNENQGFFSFSQPCPACGGRGLRVDLPCNSCQGTGTVPSNRKLNVRIPAGVEDGQRIRLGGPSGDLYITIKVGADPRFSRRGNDLVTTSKISFPQATLGTDIVVPTLRSSVKLRVPAGTKSGQVLRAKGYGVPSGRRITPGDLLVTIEIVIPKNLSDEQRKLVEELARILPKEV............................................. 361
43 0.000e+00UniRef50_L0DDD5 Chaperone protein DnaJ n=3 Tax=Bacteria TaxID=2 RepID=L0DDD5_SINAD  ali  32  6.........................................................................................TKRDYYVVLEIKREASQDEIKKAYRQLALKNHPDKNPGXXXA------------------KRQRYDRYGHAGLEGAG---------VHDFRNAEDIMSAFGDFGDLFGQRRRGPRAGQDLLFKLEIDLVEAARGTTKPIDVNRQEYCGDCKGSGAKKGTVAVSCNYCAGQGQVVQSRGFFQVATTCPACGGEGMRITDPCPNCRGAGRVNAVAHLKVDVPPGVESGMQLRGQGEPGDLRIQILVRKHPFFERNRNDLVCQVPINFPQAALGADIEVPTLDGPDRLHVPKGTQSGDVLRLKGRGMPDISGRGRGDELVEVVVETPRHLTPRQEELLRELAEIE----------------------------HLDVSPKRKSFFEKLRDYFT. 373
44 0.000e+00UniRef50_K7L6V7 Uncharacterized protein n=3 Tax=Pentapetalae TaxID=1437201 RepID=K7L6V7_SOYBN  ali  39  2..................................................................................................................QLAKKLHPDTNKDDPKAEKKFQEVSMAYEVLKDEEKRQQYDQVGHDVYVNQESTSGFGGNSGFNP------FEQMFRDHDFVKNFFHQNIGGEDVKTFIELSFMEAVRGCNKTITFETEVLCNTCGGSGVPPGTRPETCRRCKGSGVTFVQTGIFRMESTCGTCKGTGKIVSNFCKSCKGTKVIKGTKSVKLDIMAGIDNNETIKVSGGPGDLYVTIKVREDPVFRREGSNIHVDAVLSITQAILGGTIQVPTLTGDVVLKIRPGTQPGQKVVLKKKGIKTKNSYTFGDQYVHFNVSIPNNLTERQRELIEEFAKEEQGD.............................................. 324
45 0.000e+00UniRef50_A0A0E0PT21 Uncharacterized protein n=6 Tax=Viridiplantae TaxID=33090 RepID=A0A0E0PT21_ORYRU  ali  32  18...............................................................................................................................DPGAEQKFKDISNAYEVLSDDEKRSIYDKYGEAGLKGAGMGTG-------DYSNPFDLFESLFEGFGGMRAARNRPMQGDDEAYNLVLNFKEAVFGVEKEIEITRLEGCNTCDGTGAKPGTKPTTCKTCGGQGQVRTPLGIFQQVSTCNTCGGTGE-FSTPCNTCGGDGRVRKTKRISLKVPAGVDSGSRLRVRGPPGDLYVFIDVLSDPVLKRDGTNILYTCKVSYIDAILGTTVKVPTVDGMVDLKIPSGTQPGTTLVMSKKGVPLLGSNARGDQLVRVQVEIPKRLSSDERKLIEELANLNKAQTANSR......................................... 340
46 0.000e+00UniRef50_A0A2K5Z649 DnaJ heat shock protein family (Hsp40) member A3 n=17 Tax=Bilateria TaxID=33213 RepID=A0A2K5Z649_MANLE  ali  96  63......................................................................GTKHYPFICTASFHTNAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNQDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDSGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQEYIMELTFNQAAKGVNKEFTVNIMDTCERCDGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIITPCVVCRGVGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRV-----------DIHSDLFISIAQALLGGTARAQGLYETINVTV------------------------RG------------RLTSRQQNLILSYAEDETDVEGTVNGVTLTSSGGSSMDSSAGSKARREAGEDEEGFLSKLKKMFTS 425
47 0.000e+00UniRef50_A9VAT3 Predicted protein n=1 Tax=Monosiga brevicollis TaxID=81824 RepID=A9VAT3_MONBE  ali  36  11...........................................................................................EDFYKLLGVDRGASKADIKKAYFKLAKKYHPDANPGDDAAAKRFAEISNAYEVLSDEEKRMRYDQMGHDSFSSGYXXXXXXXXXXXXXRDAHDVFDELFRSFGGMNQQRRRQAEREPMIMGVRLDFLDSVRGHTVQVPITTETRCNGCNGTGAENG-EMQTCSRCHGSGTIDASLGFMQVRTACDKCGGTGTTARHQCGTCNGLGASKTQSNVEVEIPAGVEDGTVVWIDDFHG---LRVRVQPSRVFERHGLDVTSRATISLAQAVLGGSLRVQGLDGSVTLDIRPGQQPQDRLRLHGKGMPSVNPRRRGDHYVIVDIEVPRNLSTRQRQLMEEFAIHERDRQGEVNSPPPSATEAEPSEDEPAHGEPGKDDEKEGGFFSKLKKTF.. 407
48 0.000e+00UniRef50_D5U3V3 Chaperone protein DnaJ n=12 Tax=Brachyspira TaxID=29521 RepID=D5U3V3_BRAM5  ali  31  1.......................................................................................MAEKRDYYEVLGVAKTATNDEIKKAYRKLAMQYHPDRNPGXXXXXXK---------------KRAQYDQFGFQGVHSDFADAYGRGGFD---------FSQMFGGSGGFGRSSRSQRRGNDLRHDITLSLEDAVFGKKMEIKLDKNDICDVCHGTGAEPGTKTQTCPTCGGSGEVRMAQGFFSVRRTCSKCNGSGSIVTTPCKKCRGTGTVKKNKTISVNIPKGIEDNTQLRVSGEGGDLYLYIHVAPHQYFVRDGIDLITEVGINIVQAALGADIYIQTLDKKVKIKIPAGTNSGQVFKLKGSGAAHINRSGRGDLFVIVNIDVSSKLSSEEKRLFNELKKVMPNNDEPV.......................................... 367
49 0.000e+00UniRef50_A0A2G9Y4K0 Chaperone protein DnaJ n=1 Tax=bacterium (Candidatus Stahlbacteria) CG23_combo_of_CG06-09_8_20_14_all_34_7 TaxID=2014295 RepID=A0  ali  30  1........................................................................................MSSKDYYKVLEIEKNASPDEIKKAYRVLAKKYHPDLNRDNKKESEKKFKISEAYEVLIDPKKKSIYDQYGYEGISQQFGQDGFRWENFSHFEDISDIFESFFGGRKSSERNRQKNNRGSDIKIVMKLTLEEMYSGTEKTIKYHRFEKCYSCNGLGGAKN-DLKRCPDCNGTGQRQSMFGTMIQVAVCPTCQGEGTIIEKKCKDCYGEGRIKKEHTLKVSVPAGVFDNAYMRMGGESGDIIIVFQQIPNQKFIRENDNLSTEIRISYPEAVLGSEHEITSIDGKIKLRIPEGTQSGKIFVLKGKGMAELHSSRHGDLFVRVVVDIPKRVDHKIRAILKELDK................................................... 372
50 0.000e+00UniRef50_K8Z206 Chaperone protein n=2 Tax=Nannochloropsis gaditana TaxID=72520 RepID=K8Z206_NANGC  ali  27  21.........IVALLFVSGISADSHRRRKSTAHGGCASASFPMAHGANYGRGRSVPSSPSAFTQAPRVDLGGLRQAKGRTGRG--GSLFMQSKDYYDILGVSRSATKQEIKKAYRKLALRWHPDVCK-EEGAADKFKEVNKAYEALSDEEKRARYDRFGEAGVEGRGFGGGAQFVDDFDIGDIF---DSFFXXXXXXXXXXPQVVPGDDLRLDLTVPFSTSIFGAEEKVRINHLETCKTCNGSGAKKGSPSRVCGKCQGNGVVVQVQGIMQTQVVCDQCDGTGEVVAEKCGDCKGAGALQTNKQIKIDIPAGVQDGTKLRIKGEGGDLYVFLSVEVDKRFRREGIDLYTDLSIDYLDAILGSEKPVPTADGKEEVQIPSGTQPTTRITLKGKGVPRLGPNLRGDQIVNVVVNFPTKLSSKEKELLQKLRTVQGGAT............................................. 468
51 0.000e+00UniRef50_A0A2T9YTG8 Uncharacterized protein n=1 Tax=Smittium simulii TaxID=133385 RepID=A0A2T9YTG8_9FUNG  ali  32  13..................................CSSLSKAFQPRFSYNPSILSLSSKPLLGFSNKVYSNPSTQPSFINKREFHSTNFVKADDLYKILGVSKDATTSEIKKKYYQLAKKLHPDVNKS-PNSKEEFFKIQEAYDV---------------SGFPGGGYGFSDAYGSGRTAPSMEDIFSQIFGSGFGSFNRGNFSSQGDDINTTINITFAEAISGVEKKIRINPIVECSTCDGNGHKKGAKPKKCASCKGTGRQTFSMGGFMVQQTCSSCGGSGSSIQDSCNSCSGRGVVQTSETVTVAIPAGVDNGMTVEMRGPRGSLYVHVKVAESDVYIRQGADIYYDETISLSQALLGGEVTIPTVQGKVDVTIKPGTQPFDELRLRGKGMKKVQSFGHGDFYITVNIAIPKNLSDIQKDLAQKFLDSLDDN--------------QKQDPNNKSSSEKNSAKSKKGLFAKLKDQFS. 450
52 0.000e+00UniRef50_A0A1G2FG66 Chaperone protein DnaJ n=5 Tax=Bacteria TaxID=2 RepID=A0A1G2FG66_9BACT  ali  32  1........................................................................................MPTKNYYEILGVPKNASEIEIKKAYRQLALKYHPDKAPESKEYEEKFKEISQVYRVLSDKEKRAQYDRFGEEAPFGRGFSEQDFRSFYDVFGGFEDLFSHIFEEIFGFGPTRKVQEYGDDIHLDLEINLEDAFYGIQKEIELKKMIACDKCRGQG---GESFKKCPACQGAGQVRTQLGILLRQKVCSKCRGRGEWPEKICPACRGEGRTREIKTIKITAPAGIDNEQTLKLGGEAGDLFITIHIKPHKYFKRQEDDLYYNLSINFTQAALGDKIEIPAIDDPLKLKIPAGLQPGETIRLKGKGIPRLYGRDRGDMLVRVQVAVPKKLSREQRKLIEELAKEEK................................................ 366
53 0.000e+00UniRef50_E4XEZ7 Uncharacterized protein n=1 Tax=Oikopleura dioica TaxID=34765 RepID=E4XEZ7_OIKDI  ali  39  6...............................................................RKVLNRTLPQVNRCSCRNLSRTSALL--DDFYKTLGVSKSATAKEIKKAYYQQAKKHHPDANKDDVDAEKKFQKVSEAYECLSDPTKKQQYDQLGAAGYQNAQNHGGMXXXXXXXXXDPFDLFNSIFKEFGGQGNFSSEQIKNQPQQYDLNISLKEACLGVEKRVRMNLETDCHSCGGSGAKPGSKPIICPACNGSGTQTQMQGPFMMRTTCSLCLGSGKYIKDKCETCEGSGKVEQPKEVKIDVPAGISERERVRIGAHGHEIYVNFQIDQNSKFRRHGEHIHSTVDISISQAILGGSKIVDTIDGVEQIVIKPGTESDTQIRLSRKGSCKLGNKSRGDHICHLQIKPPKSLTENQRKAILEFAKDED------------------------FSGSVNEEPGDESLLAKAKNKFNS 408
54 0.000e+00UniRef50_A0A0S7XGJ3 Chaperone protein DnaJ n=3 Tax=FCB group TaxID=1783270 RepID=A0A0S7XGJ3_9BACT  ali  31  2.......................................................................................PQAQQDFYETLGVGENASTEDIKKAYRKLAKKYHPDANPGNTTAEAKFKEVSEAYNVLSDSKKRAQYDQMRK-------LGAGAYAGGGFQGFDLGDLFEDLFG--SRVRPQSHGPRKGNDILVELEVPFDLTVRGGKTTVVISKEDHCKECGGSGARPGSKTVTCPECKGQGSVSFVQGGFAVSRPCPKCLGWGVLTEDPCRACGGRGTVRGAKKYVIKIPAGISTGEKIRLRGPPGDVIAQVRVGSHPFFTKKGANIYCTVPINIAQAVLGAKVKVKTVDGRVELKVPAGVQNGATFRLKGMGLK--RNGLKGDQFVKIDVVTPKKVTEKQKKLIEEFAKEGG................................................ 371
55 0.000e+00UniRef50_UPI0004DD928B molecular chaperone DnaJ n=1 Tax=Plasmodium vinckei vinckei TaxID=54757 RepID=UPI0004DD928B  ali  29  55............................................................................FRGRRNIHLSRRASNQDPYTVLGLSRNATTNEIKKQFRLLAKKYHPDINPS-PDAKQKMADITAAYELLSDPKKKEFYDKTGMADDSNSNHASSNFEGAFSGFGDASFMFTDFAEMFTNMAGNKNSSTRGEDIQTEITLKFMEAIKGCEKNIRLNVKVSCNNCNGSGKKPGTNLTICKVCNGSGVQRMERGPIIIGVPCRTCSGNGQIINNPCKHCSGSGVKFQTKNITLDIPPGIKKGMQMRIPGKNGHLFVTINIEPHKVFKWIDDNIYVDVPLTIKQCLLGGIVNIPTLNGNMDLLIRPKTYPNSEKVLKGKGPSKVDSHTNGDLIVKFSLSIPEKLTQRQIELIEEFNRIELNLPNPQAANNSNNNDQKININNYNKNDNTNTTRNGSG........... 456
56 0.000e+00UniRef50_A0A2N3G7B6 Chaperone protein DnaJ n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G7B6_9ACTN  ali  30  6..........................................................................................DRDLYEILGVAQGVSSDEIKSAYRGKARECHPDVAQHDLESEEKFKELTFAYEVLSDPEKRRTYDAFGLDGLRRGAG------IDASGFGSISDLFDMFFGGFSRQRPARGGKERGRDMEMLMTVSLDDVLSGLEKDIEHTRMATCSLCDGSGMKPGARMNRCAVCQGTGTQRNVFGTFIRSQPCPTCAGQGEVVTDPCQNCEGAGRERITEKLRVSMPPGVERQDRIRIGGPSGDLYVVIDVASDDRFERNGKHLYTCVEVGMIDAALGAEIDMKVLDGTHKLKVPAGVQPDDVLKIKGKGLPPRYGGRRGDIFVRVRISVPKQLTGKQRNLLESYRESEKAKASK........................................... 362
57 0.000e+00UniRef50_A0A2N2EV26 Chaperone protein DnaJ n=4 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2N2EV26_9BACT  ali  34  4..........................................................................................KRDYYDILGVARDAATADIKLAYRKLALKHHPDRVGESKSAEEKFKKISEAYAVLSDPQKRQQYDRFGHEGIDSRYSTEDIFR--GADFGDFADILRSAFGSGAAGFGSFGGGRGRGDIETRMVITLEEAFTGTEKEITYSRAKKCDACGGSGAKPGTKASTCPLCRGRGVVTEGSFIFSMQRPCPECGGRGQIIKQKCPSCAGHGLVKKKENLKVKVPKGVLSGTSLRVQGIAGNLYVLIEVLPHKDFERREGELYTKIEIPFPVAVLGGTIKAQAINKTVQMKIPPHCPDGQVFRLRGYGMPRLNAAYSGDLFVTVVIHVPKKVPSKAKKLLEDYMTIMEEEQKP........................................... 364
58 0.000e+00UniRef50_A0A1A9VK13 Uncharacterized protein n=1 Tax=Glossina austeni TaxID=7395 RepID=A0A1A9VK13_GLOAU  ali  35  71........................................................................................MSKKDYYDLLEVGRNASIDEIKKAYKKLALKYHPDRNPGNQEAEEKFKEVTAAYEVLSDSEKRASYDRYGHEGASGGFQGFSSSA------GDFSDIFNDFFGGGFGGGASRSRAKRGADLRYDLEITLEDAFKGIQAPIHYVTNIKCDTCQGTGSEGAIKPVQCPTCQGSGRIRTQQGFFTIERTCTTCYGEGEIIQNKCKKCGGSGRRRDEVNISVSIPKGIEEGAKVRISGKGGDLYVYVKIISHKIFARNKADLHCKVPIRMTLAVLGGEIDVQSIDGKIKVKVPENTQTGTKLRCREKGMPYMNSHVRGDLYVEVIVETPKNLTKKQ............................................................ 414
59 0.000e+00UniRef50_A0A0L0SIT6 Chaperone DnaJ n=1 Tax=Allomyces macrogynus ATCC 38327 TaxID=578462 RepID=A0A0L0SIT6_ALLMA  ali  34  40..........................................................................................KRDLYEVLGVKQGASEKEIKRAYYQLAKKYHPDTS-SDPSAKDKFVEIQNAYDVLSDSTKRQQYDTMGHGAFEQGGPGGPXXXXXXXXXXDPASMFASMFGMGGRGGRPGQAQRWSPDLETQLAISFEEAVKGTSKTINLATHVRCDPCKGSGLKEGTKLSRCRMCNGSGQQIFSQAGMQIAATCMACGGAGQSVPSNCKSCNGEGRVQETKTVRVDIPAGVESGMRVRVAGKGGDLFVRILVRPSPIFQRMNNDIIYTAKVPLSTALLGGTLRVPTIDGDVDLKVPEGTQPGERKVLRSRGVTHVNPSRRGDQYVDVKVELPRNLSSEQKDKLKALLSEIEESGSK........................................... 414
60 0.000e+00UniRef50_A0A168Q5A7 Uncharacterized protein n=1 Tax=Absidia glauca TaxID=4829 RepID=A0A168Q5A7_ABSGL  ali  30  132LNRHCIHYAMHRHLFLNVLMHHSQRSFKRPPNLHSKSWEQKESWRPCNMNSLVSSTEWALKTTLRTTPCLPREEEKLTCITPAIQFAGAKKEDPYKVLGVSKKASQGDIKKAYY--AAK---------KDAREKFSQVQEAYELLSDEQKRAQYDQFGH-GFEXXXXXXSSGDAGFTGGFDPNDIFSQFFGGGGRHSTXXFRSMTGDDLQAPLTISFMEAAKGTKKTISIHQVTNCATCKGSGLKPGAKMDTCKTCHGSGLQTVQMGGLNMQTTCSTCGGVGQSIPGECGTCQGLGKVRERKSIQVDIPPGVDNKARIRVAGQGGDLFVSINIQASNVFTRQDKDVFLNTKIPFYKAILGGKVRIPTIDGDVELKIPKGSQADDKIALRGRGIKQLRGTTRGDQIVTLKVELPRSLRSEQQTIIEKYAQLVDPEYRK........................................... 625
61 0.000e+00UniRef50_A0A2D5C614 Chaperone protein DnaJ n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D5C614_9FLAO  ali  29  3...........................................................................................KDYYNILEVDRSASERDIKKSYRNLSKKYHPDKNPDNKESEDKFKEVAEAYSILSDKEKRGNYDTFG--------DPNGQPQNPFGDMGDMNDIFSQFFGGGRNFGGRGSRRKKGGDIRINVHMTLEDMYNGEHKTIKYRRNKKCGTCDGTGGES----TTCGNCKGHGVVNQIQGRVQSTVTCPSCGGTGKIITNPCGDCSSNGVISSEERLSFDIPKGIMDGESLRVTGKGGDLFINIIEKPHPTFRRSGLDIHQRVNLSYKDLVLGSPIEVDTIDGKIRMTVKSGTQVGSMLRVPQKGF--IRDNQRGDMIVEVWLDIPKEVTEEEKKIIETL..................................................... 337
62 0.000e+00UniRef50_L0PG51 Uncharacterized protein (Fragment) n=1 Tax=Pneumocystis jirovecii (strain SE8) TaxID=1209962 RepID=L0PG51_PNEJ8  ali  37  5.................................................................................FFHTSKILAMKDPYATLNLTKDATTADIKKAYFKLAKQYHPDTNK-DKGAQEKFLEIQQAYEILSDPKKRSKYDQYGTSAFEGESTSGSSDFEDFGGFSNMGFPFDDLFGAFGFGGKSSTRSNVGDDVEVQTSISFMEAAKGGTKSIYINLMATCKTCSGTGLKSGQKRSACQRCGGTGRVHIMHGGFQVASTCEYCKGAGITIGSECWSCSGNGIIREKKAIKLDIPAGIEDGMRIRLAGEGGDLYVRIRVMPHAIFRRKGSDIFHTVTIPMTTAALGGTIKVPTLDNDVELKVPSGTATGDVIVMNGKGIERLHSNGKGDIKYDFKVTIP................................................................... 363
63 0.000e+00UniRef50_A0A0L0G6M4 Uncharacterized protein n=1 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0G6M4_9EUKA  ali  35  46.....................................................AGHPLAGLSSAERYGQHISSVHTQQQKRKY---ASQKKRDYYEVLGVSKNSDQKEIKKAYYQAAKKFHPDRAKGAEEKKEKFQEISEAYEVLGDENQKSVYDQYGHAGLDGQNGMGGGGFGGHPG-HDPFEMFRDFESMFGGRGGRPNRPQRGMDIEAQVNIPFTDIIKETKHTVEYRADCTCTTCSGTGAKPGTTRTTCSRCGGSGHTVQQSGFFHMQSACTACGGVGSTVSSPCSSCFGAGQKSEKKTVEITIPAGVEDGMQMQVKGPAGNLVLLIRVARSPVFQREGADVLSRVNIDMVKAALGGTVRTQSLTGEIELNVPAGTQPGDKLRLRGRGIPQLHRSSKGDHFIEFKVSIPKRLTAAQREALRQAQSMAADKTSAASAEETTTKSKKHVDKGLEK-------EEKASFFGRLKK.... 491
64 0.000e+00UniRef50_A0A2E4WY14 Chaperone protein DnaJ n=3 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E4WY14_9DELT  ali  32  16........................................................................................AMKRDYYEVLGVERNSDAGHIKKAFRRIALAHHPDQNPDDPEAAKIFREASEAYEVLGDAEKRDLYDRYGHEGVEGRVQTAGA------DVHDIFSHFGDFFGDLFGGRPF-QQARKGRDLRVRLEVPFSEVLSGAERSIQLRRNRPCTTCNGTGSESEQGPETCGMCSGTGQVVQRQGLFVMSTTCPRCEGSGGVIKDPCASCDGRGVHVDTSPLVIHVPAGVSSGMQIRMRGEPGDLLVVFRVEDAPAWVRDGADLHQPLALDLPTAVLGGQVQVEGLDGLMALTIPAGTGEGAVLPLHGAGLPNPAGHQ-GDLLVHVQLQVPRQLNPETRALWQSLKDRQDET.............................................. 363
65 0.000e+00UniRef50_A0A1F4YC81 Chaperone protein DnaJ n=3 Tax=FCB group TaxID=1783270 RepID=A0A1F4YC81_9BACT  ali  30  1..........................................................................................MKDFYQILGVPETANDDEIKKAYRKLAKRYHPDTNPGNKQAENKFKEISGAYDVLSDRQKRSQYDQMRKGGFGRGGARPRAGTEGGVDFEDLSDIFSSLFGGAGMPGARGRRAAQGEDLYSEVDVPFKTAATGGRMTVRVNVSEQCSVCRGTGAKSGSAPKTCPECQGRGTISFVQGNFAVSRPCPKCLGRGQIVTEVCPTCAGRGTVRRPREIAVTIPAGIENGKNIRLGGPPGDLYLQVNITQHQFFWREGLDIYCRVPINIAQAVHGTKIRVRTIDKKVELKVPPGTRTGARFRMRGFGL--TQNGRKGDQIVEIEIKIPQKMTDEEKKMLEEMGDKIG................................................ 375
66 0.000e+00UniRef50_A0A257X3P9 Chaperone protein DnaJ n=1 Tax=Caulobacter sp. 12-67-6 TaxID=1970329 RepID=A0A257X3P9_9CAUL  ali  31  1..........................................................................................MRDYYEILGVTRTADDAGLKAAFRKLAMEHHPDRNGGCEDASGRFKEINEAYSVLSDPQKRAAYDRFGHAGVNGGQGGGGFSGDPSDIFSDFGDVFGEMFG---GGRRPSNGPQRGQDLRYDLEISLEQAYAGAEVEIKVPAAITCEVCDGSGAKVGTSPTVCGTCGGHGRVRATQGFFAVERGCPRCGGSGRLVLDPCQSCNGHGQVRRERVLSV---------------------------IPHELFERDGLDLLCTVPVPMTVAALGGEIDAPCLMGKIPVKVPEGAQTGKTVRLKGKGMPSLRSRQRGDLVVELFVETPTHLSARQKELLKELAGLCGEKQNPKSANFVGKAKRFWDE............................ 341
67 0.000e+00UniRef50_A0A1Y3NLN3 Uncharacterized protein (Fragment) n=1 Tax=Piromyces sp. (strain E2) TaxID=73868 RepID=A0A1Y3NLN3_PIRSE  ali  32  3.........................................................................................SKKDLYEVLGVKKGASAKEIKAAYYKLAKTYHPDTNKS-KEANDKFIEIQNAYEILSDDNKRAQYDQYGHAAFDPNARAQGFQGRGGFGGFSGFDIFEQMFRGFGRAGGMGGFGNMGRDIKTTMTIDFMDVVRGTKKELKYHHMVFCHDCDGMGTTNKSTPGKCPKCNGTGQEFIQHGGFGMARPCSQCHGEGFYIPKRCKKCHGKRLIRQLDTVEVPIPKGVDSMVQLRLAGKGGDLYISVNILPHPVFKREKNDVHVNVTLPLTTAILGGKVTIPTVDGDFEMDLPAGIQPEEKKILRARGLYIMDTNVRGDEWIHFKVEIPRHLTKKQKELLKSFQEEEDKK.............................................. 376
68 0.000e+00UniRef50_Q9RUG2 Chaperone protein DnaJ n=42 Tax=Deinococci TaxID=188787 RepID=DNAJ_DEIRA  ali  33  2............................................................................................DYYELLGVSRTASADEIKSAYRKLALKLHPDRNK-EEGAAEKFAQVSEAYSVLSDTEKRAHYDRFGSAAGMPGGDXFGGMGGMGGVGFDPMDIFEQLFGGAAGMGGRGRRGPARDDLETEVRITLEQARAGEEVEVTVDRLTECEHCHGTRTEPGGKPVTCSTCNGSGAVRTIFGVVETQQVCPTCKGDGKMVVDPCTVCHGRGRTLKSEPVKVKLPKGIDEGYRIRVAGQGGDLYVHIEMEPHPELHRQDENLIFPARIGFATAALGGRIQVPTLDGPQEVEVKPGTQHGELHRLRGQGMPRLQGAGTGDLIVDYEIVVPKHLNAEAKDALQAYARAVGDEVP----------------------------EEHEGLFGKIGKLFG. 374
69 0.000e+00UniRef50_A0A1F5NX54 Chaperone protein DnaJ n=1 Tax=Candidatus Delongbacteria bacterium GWF2_40_14 TaxID=1817817 RepID=A0A1F5NX54_9BACT  ali  28  1........................................................................................MSKRDYYEILGVGKNATKDDIKKAYKKLALQFHPDRNQGNKESEEKFKEVGEAYSVLSDDNKRAKYDRFGHEGLRGQGGGGFDFGGGSFDFGDAESIFEQGGSSRGRRSGAGNAHRRGNDLQISIKLTLEEISKETTKKIKINKFIKCTSCSGSGAKSISSVSKCSSCGGTGEIRTVQGQFVNVSPCHACDGMGEVILEKCPLCGGDGRIRDEKTVNVTIPPGVSEGQYLTLSGEPGDLIVIIQEKEHKYFNRDRENLYYDLQLSVSEAALGTEIEVPIIEGKVKLKVPSGTQPGKKLMLKDKGLPVLNGYGKGDLIIRISIWIPTKLSKKAKELFEQLESLDDTKPKS----------------------------SEKGFFEKIKDRL.. 383
70 0.000e+00UniRef50_UPI000C9D2E72 uncharacterized protein LOC111784933 n=1 Tax=Cucurbita pepo subsp. pepo TaxID=3664 RepID=UPI000C9D2E72  ali  30  1..........MALICSPCNAKLNPKPRILSLSAIPNVLNFRSPPSISFCSSLNYSFSRVVRPLRGTDFQTRRRLKSVYCG---AAATGAAATDHYSTLNVSRNATLQEIKVSYKKLARKYHPDVNK-NPGSEEKFKEISAAYEVLSDDEKRSLYDQFGEAGLQGEYD----VRSSGSPGVDPFEIFDAFFGGSDGLYGKRSGRNQNLDIHYDLHLSFEESVFGGEKEIQLFCFEACENCDGTGAKTSNCIKVCASCHGKGTQRTPFGMMSQVSTCSECGGDGKVITELCQSCGGSGQMKSFRKMDIVIPPGVSDGATMRIQREGGNLYVTLRVDEKHGIRRDGIHLYSNISIDYTEAILGTIVKVETVEGLKDLRIPAGVQPGDKVSLSRMGVPNINPSVRGDHLFIVNVQIPTSI................................................................ 426
71 0.000e+00UniRef50_A0A218Z5T7 Uncharacterized protein n=9 Tax=leotiomyceta TaxID=716546 RepID=A0A218Z5T7_9HELO  ali  30  78...........MTFDASVLHAYRH-GYHLNTPAAFSKPYNELVLNRSPIGRMSPTMARNKERRRQSKEQLANAVRKHFNSKAFHPSSRLATKNPYTVLGVDKNASAGEIKKAYYRLAKKFHPDTNK-DPKAKDKFAEAQSSYELLCDPQKKAAWDQYGAAAFDQGGNPAGFGGAGDAFFGAADFSFEDLFKGFTGGRRTRSGQNPGETIEVQTQISFAEAARGTSKTISIQPLTTCKACSGSGMKAGTNRTECKSCGGTGRVHFMSGGFQMASTCGVCGGQGVSIPKECRSCSGNGVVRERKTITVDIPGGIDDGMRLRLDREGGDLYVLVRVATDPKYRRSGADILYTATIPLTTGLLGGEVTIPTLDGDVKVKVATGTGTGDKITLGGKGMKRIDGRGQGDLKVEFKISMPKYLSANQRTIVEMLADELGDKTAKRFM-------------NLGRASYPEDSSKNEGFLKSVWNKFT. 592
72 0.000e+00UniRef50_A0A2V6PKN9 Molecular chaperone DnaJ n=2 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6PKN9_9BACT  ali  33  1........................................................................................MAGADYYEVLGVARSASDAEIKKAYRQLAMQYHPDRNPGDKNAEDRFKQASEAYAVLSDPDKRAQYDRFGTVA-------GGVGFDPGGFGSLFEDIFDNFFGGGARGGRRSRAARG-EDLQYELKLTLEDAASGIETKIRIPRLEPCEICGGSGNEAGTRAKTCETCQGRGEVGMRHGFLTVARPCPKCHGEG-VLRTLCRECRGEGRRRAEHVLQVKIPAGIDDGMQLRL-------------AEHEAFGRKDDDLYCDLPVTFPQLALGAELEVPVLNGTATLSIPAGTQPHQILRLAGQGMPRLRNRGRGDACYRVILEVPQKLTAKQREALEAFDAALKGQRGPLASAFLDRMRK................................ 338
73 0.000e+00UniRef50_W4ZBU9 Uncharacterized protein n=5 Tax=Bilateria TaxID=33213 RepID=W4ZBU9_STRPU  ali  50  11...............RACHKSSSNYLLKGEITRSYRCKTCRSVPASNIASFSVFSQPKSCTSQDKIGGGLQQHQFVHGFSRNIHTSALAGKRDFYQVLGVPKTATQKDIKKAYYEMAKKYHPDRNKESPDASKKFAEVAEAYEVLGDEGRRKEYDTLGQAGFXXXXXXXXFQGQWQQSSMDPEELFRKIFGDRGGMFDESMFGGFNTAHEVAMDLTFSEAARGVNKEINVKMEDTCERCKGSRSEPGTKTSKCHQCNGTGQETVNTGPFVMRTTCRRCRGTRVIISVPCIVCRGAGQTMQRKKVVVPVPAGVEDGQTVRMPVGSQELFITFRVARSNQFRRDKADIHSDATISFTQATLGGTCKIKGIYDTITLNIPAGTQSHARIRLPGKGISRVNGYGFGDHHIHIKIKVPT.................................................................. 419
74 0.000e+00UniRef50_UPI0007112FCF molecular chaperone n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI0007112FCF  ali  33  7................................................................................................VLGVPRDASKAEIKKHYFELAKKYHPDQNKGDENAKQKFIEVSEAYEVLKDDEKRARYDQFGEMGVNDNGAGYGQAN------VDMDELFADIFGGEARSXYSGEMNNSGSDIAVSISIPFLDGINGCQRDLRVSKEVECSMCHGSGTGPNNQKQQCPQCKGKGMIYSNRGIMMSMSPCPRCNGSGSINTDVCTKCHGSGTQHSVSTISVKIPAGIDNGDTIRLVGQGGNLY--INVEPDSFFSRRGADIYCNVPISVTTAILGGTITVPTLSGAVDVHVPAGTQCNTKMRLRSKGIRPMRSTFVGDQIITFDVHIPKNITEEQRRLITEFGKDEKGVQHPKAPAMQSVVTRIKSFLDSHRK...................... 386
75 0.000e+00UniRef50_A0A0B3B2S8 Molecular chaperone DnaJ n=1 Tax=Archaeon GW2011_AR21 TaxID=1579379 RepID=A0A0B3B2S8_ARCG8  ali  31  4..........................................................................................KRDYYETLGLGRNATPEQVKQAYKELAKKYHPDINK-EPGAEEKFKEVLEAYTILSDSQKRSAYDNYGFESPEFAGFDINDFIRRGGAHFDFSDLFGDLGFDPFEQSFRKQASQRGADLKTELEIELEEAATGTEKTIEIAKTEKCSECEGTGSRDK-ELSKCSACNGRGMVRTVFGIFSTRTTCPKCQGSGIAIKNPCRKCNGSGQMRVKKRISVKIPAGIDSGNHLRLKGEGGDLYVVVLVKPHKIFKRGASDLFLEMPISFTEAALGSELEVPTISGKKMLKVPAGTQTDTIFKLKGLGVKEINSSRIGDLYVKAIVKTPASLSKKQKELFEELSRLDG-------------------------------FKEREGFFSGFKRKFS. 376
76 0.000e+00UniRef50_A0A0K3C5W8 BY PROTMAP:  ali  30  14...........................HRPASPAPFAPLCRHPSPPAYSRPAAAASTRQRHGKTWLGSWITAGQAQAKGQRSFHASSRQLAKNPYSVLGVGKDASTSEIKKAYYQLAKKYHPDSSK-EPGAKEKFVEIQEAYDTLSDDKKRADFDRFGSASQQPGFDSDAFARGGGAGGASGADIFESLFGAFGRGGAAGPRQTQGDDIDVSISVPFIQAAKGTSKTIQISPVVDCHTCHGSGLKEGMKKTTCGSCGGTGTRTTIQSGFQMASTCAACGGSGSVPGSNCGTCAGVGKVRERRSVEVKIPPGVDDGMRIRLDGKGGDLFVRINVQPSKVFTRQGSNLYETVSVPFYTAILGGRAPVKTLERDVEVKVPQGTQPGEEMVLRGRGVKKLYKEEYGDLIVRFNVSMPRSLTPIQRMILEQYVRETEEPGSSSTSPFTXXXXXXXXXXXXXXXAPTPQKPR.............. 483
77 0.000e+00UniRef50_A0A0G1IBX6 Chaperone protein DnaJ n=18 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1IBX6_9BACT  ali  31  1..........................................................................................MNDYYEILGVARNATKDEIKKAYRKLAHKHHPDKTKGD---DKKFKELNEAYEILYDDKKRAEYDTYGKTFAGGAGFGDFASRGGQGFEFDFGDIFENFF--TGGQGGRRAKAKRGADIAVDLSISFEDSIFGTERKILLSKISYCSVCKGSGAEPNSEMEKCPACQGAGRVRSIFGAVSSFRECAKCSGKGTIPVKKCSACSGHGVSKKSEEITVKVPPGIRDGEAISLPGMGGDLYVKFTVGKHPVFRRDGLNLIMDLDVKMSEALLGVEKDIATLDGLIKLKVPAGISSGEILAVRGKGVPQGHGRGRGDLLIKTMIRTPRKISKKAKELIDELKKE.................................................. 361
78 0.000e+00UniRef50_A0A2C9T0S3 Chaperone protein DnaJ n=43 Tax=Actinobacteria TaxID=201174 RepID=A0A2C9T0S3_9MYCO  ali  28  1.........................................................................................MARDYYGLLGVSKGASDQEIKRAYRKLARELHPDVNP-DEEAQHRFKEISAAYEVLSDPEKRRIVD-LGGDPLEGAGGAANGFGGFGGLG----DVFEAFF-GGGGSRGPIGRVRPGSDSLLRMRLDLAECATGVTKQVTVDTAVLCDVCQGKGTHGNSAPVACDTCGGRGEVQTVQGQVMTSRPCPTCRGVGEVIPDPCHRCAGDGRVRARREISVKIPAGVGDGMRVRLGGPAGDLYVEVHEQQHDIFVRDGDDLHCTVSVPMVDAALGTTVTVDALDGLTEITVAPGTQPGSVVTLRGHGMPHLRSGVRGNLHAHIEVTVPGKLDARAKELLAEFK--------------------TRSHAEPEVKSTHAATAGSGGLFNRLRETFS. 377
79 0.000e+00UniRef50_C9RP33 Chaperone protein DnaJ n=33 Tax=FCB group TaxID=1783270 RepID=C9RP33_FIBSS  ali  32  1.......................................................................................MAEKRDYYEVLGVGKDASADEIKHAYKKLAIKYHPDKNPGDKEAEEKFKEAAEAYDVLSNPEKRKNYDQFGFNAXXX----XXXXXXXXXXXXDINDIFSQFGDXXXXXSSRKAGPPRGNDLQIKVALSYKEIFEGCTKKVRLKRYTPCTECNGKG---GTNVKTCDTCHGTGRVRRVSGFFQMVSVCPTCSGMGEVIANPCSHCHGEGRVQETEEISIKIPAGVSEGQYLNLRGEGGDLLVVIAEKPDDFFSREGDDLHCEVKVPVHKLVLGGTQRIPTISGDIQIKIAAGTQAGSVLRLRDQGLPLKKQGDRGSLYVQIGVDIPKDISRE............................................................. 348
80 0.000e+00UniRef50_A0A2I0B4I6 Chaperone protein dnaJ 1, mitochondrial n=5 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2I0B4I6_9ASPA  ali  27  13..................................CGSSLRRPFCVLPLLKPGRKLSPESGTFFFGDLNLHWNPCSPAPHRRGSCRHGNMAKRDFYEVLNLTRNASIQEIKSSYRNLARKYHPDMNKGS-GGEEKFKEISAAYEVLSDEEKRSLYDRYGEAGLQGEYAEANA----GPLGVDPFEVFNAFFGQSNGLFGFSPQMRQGHDIRYDLFLSLEESIFGVLRKMDITCKEICNSCNGTGAKSSKSIKSCSECGGRGTERTAFGEVSQISTCFKCGGSGRSITDRCRICNGKGNVEVTRSVNINIPPGVSDGSTIQIPGEGGDLYLVIHINEKRGIRREGLNLYTDISIDYTEAILGTTVKVETVQGCQDLCVPSGTQPGAVLNLANMGVPNINPSVKGDHHFIVRVQIPKDISDEERSLVEKLASIRKTFQGHSSPQSGKKKSYKNLNQQKMKKQRSYTSQSNRSLWDSFKNLFG. 504
81 0.000e+00UniRef50_A0A222MW01 Chaperone protein DnaJ n=5 Tax=Campylobacteraceae TaxID=72294 RepID=A0A222MW01_9PROT  ali  28  4............................................................................................DYYELLEITRTADKDSIKKAYRKLALKYHPDRNQGDKEAEARFKLINEAYEILSDDEKRSIYDRYGRDGLKSSMQGSGFNFAD----IDIEGIFSDFFGFSGSRKRRQSSEKYSENLSIPLVISFKEAVFGTKKNVEFMYKSFCKDCKGTGSKDG-EVKICPKCEGRGQVGLSRGFMTFVQTCDECRGEGSIVKDKCKTCSGLGYENKRDSIELDIPEGIDDAMSLRVSGSRGALLVKISVQDDETFIRDGSDIYLKFPVFFTQAALGAKVKIPTIRGHAFLELPVGAKDGDHFVLEKEGVKDIHSEEIGRQIVQISISFPKHINDEQKELLAKLNESFGVNEEGI-------------------------HQEQQGFFDKIASWF.. 369
82 0.000e+00UniRef50_A0A2W4IBU0 Molecular chaperone DnaJ n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A2W4IBU0_9BACT  ali  28  3.........................................................................................SKKDYYETLGVPKTASAEEIKKSFRNKARHLHPD-NK-DSGDEQAFKELAEAYEVLSDQQKRATYDRYGHEGVKGAGQGFDNFDFSNFSGFGMDDILDSFFXXXXXXXXXXXXPEQGAHLKFDMEIEFLDAVFGTEKTINVRRLEDCESCSGSGAAPGSNPVPCVTCAGVGQVQQVFGQALRVIACPACQGSGSKIDKPCKDCKGEALVRKQKEFQIKIPAGIDSGTRLRVGGPFGDLFVVLHIKEHETFVRDGETIHIRQPISYSLAALGGEILVPTVEGAKPLKINAGTQTGTTVQMKNLGVPRFRDNRRGDQIVHLLVETPTKLSGEEKKLLEKLAELRGERLTLSKADIAKAEEANKENHKENSDKNDSGKNQEKN........... 402
83 0.000e+00UniRef50_A0A0Q9ZBX3 Chaperone protein DnaJ n=18 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0Q9ZBX3_9FLAO  ali  32  1.........................................................................................MKEDYYDILGISKGASTAEIKKAYRKMAIKYHPDKNPGDSEAEEKFKKSAEAYEVLSNEDKRARYDRFGHQAFEG-----GAGGGGGFGGMDMDDIFSQFGDXXXXXXXXXQRRAKGSNLRIRVSLTLEEIANGAEKKIKVKRKVQ---------APGTTYKTCTTCKGTGQVTRVLGRMQTASPCTACSGSGQIIDKRPPEADAHGLVQKEETVSIKIPSGVEDGMQLKVSGKPGDLLVAIEEKEHPSLQREGDNLHYDLYISLSEAVLGSSREIDTVTGKVRIKVEEGVQSGKILRLRGKGIGNLNGYGKGDLLVHVNVWTPKNLNKEQRDFFEKMAEDENFQPNP--------------------------EKSDKSFFEKVKDMFS. 376
84 0.000e+00UniRef50_A0A2P1P7D5 Chaperone protein DnaJ n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2P1P7D5_9RICK  ali  31  1........................................................................................MSQQDYYKILGVSQGASEDEIKKAYRKLAMQYHPDRNKGNLEAEKKFKEINQAYDILKDPQKKATYDRFGHESFNSGGGGFGRAGGFDFGDIDVENIFDMGFGGGGRSKSRGPQKERGADLQYHMTITLEEAFHGTQKTISFACDTKCGQCNGLGSKTGA-ISTCTTCGGRGAIYMKQGFFSIERPCGTCGGAGHIVKDPCSSCGGRGAYQKTKNVEINIPCGVTDGMRLRFRGGAGDLYILISIKPHSIFRVDEANMHCRLPVSFITLILGGKVEVEDINGKISVTIPQGTEHGHQITIKNKGMSITGSKSRGSLIVHVVSTVPKNLTAKQRQMLEELEKDLAQNKAS------------------------------ESIFDKMKNLWS. 375
85 0.000e+00UniRef50_F9VKP5 Chaperone protein DnaJ n=5 Tax=Candidatus Arthromitus TaxID=49082 RepID=F9VKP5_ARTSS  ali  32  1........................................................................................MSNKNYYEVLGVSSNASESEIKSAFKKQAIKYHPDRNKGNAEAEKKFKEINEAYQVLSDSSKRASYDRVGHDAYTKGASYGSSSAGGGFEGFDMDFDLGDITGGGFGGGRSKRGPKPGEDLEYRLTLTFDEAVFGCTKDIFIRRKDRCGTCSGTGSKTGTDRTTCDKCHGSGQIKVQFGSMVSMTTCSKCSGVGKINLNPCATCRGSGKVNTEKKITIDIPRGIDTGQVISMRGEGGDLYIAINVMSSNKFKRKDNDIFTDHHIPIWIAILGGDSVIETLDGEHKINIKEGTQSGTVHVLKGKGVYKVNSNFRGEHHVRIVVDVPSVHNDSQRQAVELMREAYEGSQEHYTERKQDS................................... 375
86 0.000e+00UniRef50_P87239 DnaJ homolog 1, mitochondrial n=4 Tax=Schizosaccharomyces TaxID=4895 RepID=MDJ1_SCHPO  ali  28  7....................QSRVCGLHSFTNSSAQQLFSKSIAHSSRRNFVISSSCTKFRNAKREFSRCAALKNFSYHARCFHATRAVEMTDPYKTLGVSKSASASEIKSAYYKLAKQYHPDANP-DKAAQDKFVEIKQAYEVLQDPKKKKAFDTYGAGAFKNGEFTGGDFEGFQNGFAGPGFNFEDLFGFSSRGPQARRNTSFGEDIEASITIDFMEAVRGAKKDLSYSVSSTCSSCHGSGLQPGSHKSTCFACKGTGQRLHFIPPFHMQTTCDSCGGTGTTIPSACRSCMGSGTVRERKTVSIDIPPGIDDNTVLRVMGRPGDLFATIHVRKHPFFVREGTNVTYNAKIPMTTAALGGTLRVPTLTGNVDLRVSPGTSTGDRITMAGKGIRKVNTSRYGNFYVNFEVTIPKILSPHERSLLEQLADALNDSTARRTQSSPSXKHSTGISTEPTTGEENKQDGSVGGFFKR....... 508
87 0.000e+00UniRef50_A0A2L2Y0R9 Putative chaperone protein (Fragment) n=3 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=A0A2L2Y0R9_PARTP  ali  45  2.................................................................................NFHVSHNAARADLYKVLGVSRNASQNDIKKSYYQLAKKYHPDTNKDDPEAAKKFQEVSSAYEILGDETKRKEYDQWGTQS-EFGQRSNTSSEFHYHSNIDPEELFRRIFGDLNFKPRTDSYFGYGASEHVHLHLDFFEATRGAQKIVKVNVIDTCPTCRGSCCVPGTKMVRCDHCNATGMETVSTGPFIMKTTCRKCNGSGMFNRFPCTECFGKGACVQQKGLTVNVPPGVEDGQTVRVKSGLQEILVTFRVQESKYFRRDGSDIHTEATISVSQAFFGGETKIQGLYEDIVLKIPPGTPSHKVFRFPNKGIKNTTGYGNGDHYVHIKINVPGKLDGVQYHLIKSYAELEKDTPGTISGISSSKK--------KEQKYAGHAEPEKKGLLEKIKTAI.. 397
88 0.000e+00UniRef50_A0A1V5XDW1 Chaperone protein DnaJ n=16 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5XDW1_9DELT  ali  30  1..........................................................................................MQDPYEVLGVPRDATADEIKAAFRKLAAKHHPDRNAGDVSANERFKEINAAYQLLSDPKKRMMFDRFGAAGANASGANPFAGGMPFDFGVSLDGIFGDLLGAFGFGGKGDRG-----DVKKEVTIDFAEAAFGCEKEVTYERAELCERCHGSGAASGADTRTCSACNGRGRIRFQQPFLPMARVCSRCHGTGREVLVPCVECRGEGMVRKKKTMLVQISPGIEHNASQVVARGPGDLELTIKVRPHELFRREGDDVVCSVPISFPQATLGAEIEIPTLAGKGKLRVPSGTQSGTVLRLRGMGIPRRVIGGRGDQLVEVSVEVPVNLSDRAKTLIQELGDEIGAEVQPQRRTFMEKLRD................................ 367
89 0.000e+00UniRef50_A0A2A4STH1 Chaperone protein DnaJ n=2 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A2A4STH1_9BACT  ali  31  3............................................................................................DYYGDLGISKGATEAEIXKAYRKMAQKHHPDVNAGNKTSEEKFKKASEAYEVLSDTTKKSRYDQFGQTANGQXXXXXXXXXNDFGGSDFMEDFMSSFFGGGGRSRASRQRNTRGNDLETHIQITFEQSIHGVNKEIQVTKAEACDPCSGQG---GSGKTTCNTCHGSGQVRTPLGVIQMRQECPDCHGAGKRFANICSICHGEGRTRKNSKIKVKIPAGVYDGANIRLSGQPGDLYILISVSPSKDFIRKNNDIYSDQHIHILQAIFGDEIEIKTAHNPVKLKIPSGTQSEQVFRIKDHGAPVLQGHGKGMHYVKIIVDTPKKLSNKEGELYKQLADESGLNIKA----------------------------EKKGFFDSLWK.... 377
90 0.000e+00UniRef50_A0A0F8VHI1 Chaperone protein DnaJ n=5 Tax=root TaxID=1 RepID=A0A0F8VHI1_9ARCH  ali  33  2.......................................................................................SSKKRDYYEVLGVSKDASLKEIKVAYRRLARKHHPDLNKTNPKAKEMFIELQEAYEVLSDEGKRRNYDRYGHGGVQVDMS-DFFSGGIPGIDELFKGIFGDFFGGLNGFGSRSRRRSAGQDIEDLIEITFEEAMFGVKKDLVIERYTPCDMCEGTGAEDPSSIKSCPECEGSGRVRKMFGMIIRESSCYTCNGTGQVIAKKCTVCNGKKVIPEEKTIHVPIPPGIEDSVHLKIQGAPGDLYLGVRIIDNEKFLRRGNDLYTPTNVDIVTAIIGGKITVPTLDTEKELSLPPGTQPGTEFRIKNRGVSYMRRKGKGDQYIIVNIEIPKKISDKQKDLLLKFREMNK................................................ 371
91 0.000e+00UniRef50_F6S871 Uncharacterized protein n=7 Tax=Bilateria TaxID=33213 RepID=F6S871_ORNAN  ali  81  1...................................................................................................................LAKKYHPDTNKDDPQAKEKFSHLAEAYEVLSDEVKRKQYDTYGSAGFDPGTGSSGQNYWRGGPTVDPEELFRKIFGEFSGSSFGDFQSVFDQPQEYIMELTFIQAAKGINKEFTVSMNDTCQRCDGKGNEPGTKVQQCHYCSGTGMETINTGPFVMRSTCRRCGGRGAIITTPCVMCRGTGQTKQKKKVVIPVPAGVEDGQTVRMPIGKKEVFITFRVQKSPVFRRDGADIHSDLYISVAQAILGGTARAQGLYETINIMIPPGIQADEKIRMGGKGIPRVNSYGYGDHYIHIKIRVPKRLTSRQQSLMLSYAEDEAEVEGTVNGVTNTATGKEFTGNAPTADMPKRD................. 348
92 0.000e+00UniRef50_A0A1G2FXY1 Chaperone protein DnaJ n=1 Tax=Candidatus Ryanbacteria bacterium RIFCSPHIGHO2_01_45_13 TaxID=1802112 RepID=A0A1G2FXY1_9BACT  ali  31  1..........................................................................................MKDYYKILGVDHNASKEDIKKAYRRLAHQYHPDKHTDEKEAETRFKEITEAYHILSNDQRRSQYDTFSTSGFHGSDAGWDFSGFGQSGFSDFSNIIGEIFGDFFGFGRAKHAPRRGRDISIDIEITFDESVFGTERRMLIRKMALCSGCGGSGAEEGFGEKTCSRCHGSGTIRTTFASFSQLVECDLCGGIGKLPEKACKKCSGSAVIPQSEEVRIVVPPSVRSGEMIRLSGKGGDLYVKVHVLPHKVFRRENDDIHMQLIVPLSQAMIGGEQEIETLDGKIKIKIPHGTQTGDMLRVRGKGF-VREGDDRGDLIINVIVRMPKRVSKKLRAIAEEIHRE.................................................. 355
93 0.000e+00UniRef50_A0A1R2CSF3 Uncharacterized protein n=3 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2CSF3_9CILI  ali  35  7................................................................................RSFRSSRRLYKKDYYSILGISRSASEAEIKKAYFSLAKKYHPDVNKSS-DAKEKFAEINLAYETLGEAEKRKTYDSTGMTGDEQGSSNFNPFTNFTGSGFNFKDAFNEFDSFFTGHEDQEKMNYKGEDISIVLEISFIDAVKGIQKKIQFERKSLCSTCNGTKIKPGTSPIKCSSCGGKGNIEIQMGSILMQSICNKCKGKGSILKTPCTSCRGVGMGNKECEEVVNIPPGVSNGQSLRMANKGGDLLVKIVIAQHPIFRREGQDIHSDVFISIPQAALGTSLDVETIHGKTKINVEPGINPGDQKRISGSGIQHLNQSRRGDHVITFKLKVPKKLTDEQRKLYEQLAREEGSNTADQTPNKFKT................................... 393
94 0.000e+00UniRef50_R1ENT0 Putative DNAJ n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1ENT0_EMIHU  ali  33  1........................................................................................MQETDLYQALGVARNANDGDIKRAYRSAARKYHPDVNPSD-DAKEKFQTINEAYQVLSNPEMRQRYDQFGMAGIKGAAGAPNMQDF------DLGDIFESFFGGSPGGRARQNRPTQGDDLRFDLELDFKTALFGGEKKIRITQLEACATCAGSGVAPGASVTTCTTCGGRGVVMQTLGRMQQQSRCPTCGGSGSVVEKYCGSCDGRGTNKRSKQLTVTIPPGVENGNRLRVRGEGGDLYVFLSVSPSNGFRREGMDIFSEVSVSYLDAILGSTLKIDTVDGPVDVALPAGTQPGATLRLEGKGAPKLNNNVRGSHFIKVNVQIPKSLSTKEKELVTKLRAE.................................................. 375
95 0.000e+00UniRef50_A0A0E9NBY5 Uncharacterized protein n=2 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9NBY5_9ASCO  ali  30  6.......APVLNGVARRRVATPGSVPVRPTVTGVVGGDAPRAAAFYSTSSNKARPRSHNLECLSK-------------QRRSFHATAPAAMKDPYKVLGVDKAAKSGDIKKAYYAAAKKYHPDTSK-EPDAAAKFQEIQSSYEILSDAKKREQYDQFGAAAFEQGGGMGGQGGFGGAGGFNFEDLFGAFANGGMGGSRRNPGPIVGANIETEASISFLDSAKGTTVPLTVSTHDPCNTCSGSGLKSGAKRSTCGRCGGSGQIMHVQGGFHMQTTCTSCGGAGVHVPSECKPCRGDGAIRARKTIKVDIPAGIEDGMTIKLAGEGGDMYVHVRVAPHPTFRRQGRNILYSATVPLTTAVLGGKIRIPTIEGEVDLKIPAGVSTGEGVVIGGRGMPDVNGGRKGDFRVEFSVKTPKSLSPHQRQLFEQLAVAFGDKNAKVTTDFSSSTSSNSSGAAGQANETATTEKDSGGFFKKAFSKFT. 499
96 0.000e+00UniRef50_U9UT08 Uncharacterized protein n=7 Tax=Rhizophagus irregularis TaxID=588596 RepID=U9UT08_RHIID  ali  33  3......................................YCRICSNDRISFSIEPKAIFSYNRHVFNSNFKISKFLKFLINRYDPEPSRQRKKDYYELLGVDKKASQAEIKKAYYSLAKKYHPDTNK-DPTSKEKFVQIQEAYDMLSDEEKRAQYDQFGASFAEGGPTGAXXXXXXXSGSTDFFDLFE-----GFNRRSRGTGFSTGSDIEVGLNISFMDAIKGTTKTITVESVATCKPCK-GTGSKGGKKDTCKTCNGTGVQFIQISGFHMQTACPECNGKGTKIPNQCPTCGGHGQIKERRPVSIPIPSGVEDGIALRMPGVPGDLYVRLHVAPHEIFKRQGLNIHVDTMIPFYTAILGGYIRVPTIDGNVELKVPPGAQPEQQALMKKRGIQQANSNYRGDQIVTFKVTIPKTLTTKQRELIDQFVSISEGTKSK........................................... 415
97 0.000e+00UniRef50_A0A1F3AMG6 Molecular chaperone DnaJ (Fragment) n=9 Tax=Bacteria TaxID=2 RepID=A0A1F3AMG6_9PROT  ali  34  1........................................................................................MSKRDYYEVLEVGKTASADELKKAYRKLAMQYHPDRNPGDQDAERKFKELNEAYEVLKDDQKRAAYDRFGHTAFQGGGGGGPXXXXXXXXXXXXXDIFEEMFGEFMSGGRRGEANQRGADLRYNMEISLEDCHTGKDTEIKVPTSVPCDTCKGSGSEGGAAPVTCPTCDGRGNIRAQQGFFTIQRTCPTCNGAGRVIKSPCKKCGGSGRTRHEKTLSVSIPPGVEDGTRIRLSGEPGDLYIFLTIKPHRLFQREGANIYCRVPIPMTTAALGGTVEVPSID............................................................................................................... 292
98 0.000e+00UniRef50_A0A0D8FSR9 Chaperone protein DnaJ n=4 Tax=Acidimicrobiaceae TaxID=84994 RepID=A0A0D8FSR9_9ACTN  ali  31  3............................................................................................DYYEVLGVARSASADDIKRSYRKLARQLHPDVNGGDKEAENRFKLVTEAYDTLSDPDKRRQYDLYGSSSGAGGDPFGGAGGPFQP---NFSDIFQTVFGQGFG-TQETAGPRRGEDMETAVNLTFEEAVFGCQKEISLKMPTTCPTCSGSGARPGTSATVCAQCQGSGSVKRVLGRMVTTMTCDVCHGEGKVVRDLCSDCRGEGRKTLERHFTIEVPPGADNGLVLRLGGQPGSLYVHVNAASSDRFERQGNDLWMRLPISYVQASLGARINFESLDGTETIEIAPGTQPGSTLHIKGKGVPVLRGRGRGDLIVAMDVKMPDELSEEEEGLLRQLAELRGEQV---------------------------LEHHEHSIFSKLKSAF.. 372
99 0.000e+00UniRef50_A0A2G4H681 Chaperone protein DnaJ n=2 Tax=Thermoleophilia bacterium TaxID=2026888 RepID=A0A2G4H681_9ACTN  ali  31  6............................................................................................DYYETLGVPRDASDDEIKKAFRNLARQHHPDVNPDNPEAAETFRVVAEAYEVLSVTETRAQYDRF------GHAGISGAGAGGGAGFGNLDDILGMFFGGMFGGRGARRGPQAGPDAATAISLTLREAAVGVQRDLEVEIVAPCDRCSGSGAEPPTRPIPCPTCGGLGQVRQPLGQIVREMPCPACRGRGATVETPCSDCRGQGKQPERRTVSVGIPAGVDTGQRVRVVGQGGDLYVAIQIEDDPAIVREGLDLHVLVDLTVTQAMLGATVHVPTLEGMETIVLQSGTQPGDRRTLRGKGMPQINENRRGDLHVLFAVHIPKKLEPTVRLLVEELDKSIPE----------------------------DAYKTESGFFNRVRRGFS. 373
100 0.000e+00UniRef50_I7KDU6 Chaperone protein DnaJ n=26 Tax=Euryarchaeota TaxID=28890 RepID=I7KDU6_METBM  ali  31  1........................................................................................MGPDSYYDTLGVSRDANDAEIKKAYRNLARKYHPDVCK-EPEAEERFKNINEAYSVLSDPQKRAQYDQMGHTAYSNAAGGGGFSGGFSADFSGFGDIFDTFFG---GGGRQRSGPRPGADLLMKMRVTLEEAAFGTEKEVSLDHVEPCPACDGSGSETK-KFTTCPTCGGSGQMRQMFGNFVRMSTCTTCGGRGKMPESRCKACGGSGHRRARQTVKVRIPPGVDTGMRLRMEGPSGDLYIEISVAPHKTFTRRGDDLEMTVDITPAQATLGSEVEVQTIDGRVVLDIPPGVQYNTGLKIPGEGVRWQ--TKPGDMLVRVRIVVP------------------------ERLTEEERELYERLLEIEGSKPSAKGAKKGKGFFDKVKE.... 380
101 0.000e+00UniRef50_A7I2G3 Chaperone protein DnaJ n=12 Tax=Epsilonproteobacteria TaxID=29547 RepID=DNAJ_CAMHC  ali  29  3............................................................................................DYYEILGVPKDADSDEIKKAFRKLALKYHPDRNAGDKEAEEKFKEINEAYQVLGNDERRQTYDRYGKEGLNGAFG-------NDFGGFDFGDIFDTFFGGGGFNKSRSQRYDDAYDLEILVSISFKDAFFGVSKDIKYKIKKPCKTCDGTGSKDK-KLNTCPYCGGSGKIVKRSGFLSFAQTCPFCKGSGQIVKEKCHDCAGKGFIEEQVNVKFDIPKGVNTGIRIRISGEIGDLYVAVQVKDDKFFVRSADDIYIEVPVFFTQAILGKTIKVPTMHGEKELQLKVGSKDKDQFVIEKEGFENIRTKIAGNLIVQINVQTPKKLTDEQIELLEKLHESFDKTA--------------------------------DGIFDKIKNWF.. 358
102 0.000e+00UniRef50_A0A1F7SN61 Chaperone protein DnaJ n=3 Tax=Candidatus Schekmanbacteria TaxID=1817811 RepID=A0A1F7SN61_9BACT  ali  31  1........................................................................................MKKQDYYRILGLNSDATAEEIKKAYRKLALRFHPDKNPGNHFAENKFKEVSVAYQTLINHQKKRIYDS--TSNSETFSDFRGNFSSGYRSYGGFTNIFEEIFHDFFGYSGDRTRIKKGSDIKTELKISLADAAFGKETEVTIERLEKCNTCNGNGSEAGIGESICPSCNGTGEKRYSYGFFIVKRICTQCKGNGFIIVHPCLKCDGDGRQKKKNTITVKIPPGVDTGSKLRLGGPSGDLFVIIRVEKHNIFERENFDISCEIPITFTQAALGSEIEIPTLEGTANLKIPEGTQSSSVFTLEGKGIINPASYIRGNQYVKILVETPVNLSSFQR........................................................... 342
103 0.000e+00UniRef50_A0A257RYU8 Chaperone protein DnaJ n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A257RYU8_9ACTN  ali  31  2......................................................................................ANVASANLYEVLEVDASASQEELKKAYRRLARQLHPDANPGDPSAEARFKEVSQAYEILSDPDRRANYDRFGQD-------VGAGAQGNPFGAGSVQDIFDMFFGGMGGHGGGRRGPQPGPDAEVSLEITLEEAAFGATREMTITLPLRCETCEGSGAAPGTAPVNCLECAGTGEVRRVRGQMVTSSVCTRCNGLGTRVESPCADCRGEGRRNQSTTLSIHVPAGVEDGSTMRLGGANGRLFVHLSVIADERFERHGDDLHHQAHVTFTQAALGTTINVPTLQGSYELEIDAGSQNGTVHRVRHEGVEHLHGRGRGDLYVHLVVDVPSELDEASEALLRQLAALRGEHVHEA.......................................... 359
104 0.000e+00UniRef50_A0A2N3EQL8 Chaperone protein DnaJ n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-9 TaxID=2013654 RepID=A0A2N3EQL8_9ACTN  ali  34  1.......................................................................................MAAGKDYYDILGVKRDASADEIKKAFRRLARKHHPDTG----GSEEKFKELNEAYEILSDAEKRKQYDQYGQYFGGNVPPGAGGAGAGGWDMGDLGDIFGSVFGGGGFXXXXXXXXXXXXDLTYDLTISFDDALNGSSARVEVQRAETCAVCKGSGAKEGTGRTTCPTCKGSGHINQGGGMFAFSRPCPRCQGAGTVIENPCPACKGAGRVVRAKPITVNIPPGASDGGKLRFKGPPGDLYVITRVRKHPYFTRDGADVLLDLPVTIAEAALGTTVTIPTPDGKKKLKIAPGTQDGKVHRLAGKGAPKLSGKGHGDLKVRMRVVVPEKLNGKQKDLLQEFASAYDEDVR............................................ 373
105 0.000e+00UniRef50_A0A1W9PIT5 Chaperone protein DnaJ n=1 Tax=Thermotoga sp. 4484_232 TaxID=1968524 RepID=A0A1W9PIT5_9THEM  ali  33  4..........................................................................................RKDYYEILGVPRNASQEEIKKAYRKLVKQWHPDLHPENKEAERRFKEIQEAYEVLSDPEKRAMYDRFGYVGPSHQYTPHETKSIFEDIFRDFEEFFDDIFDIFFGERTRERTRRARRDVEIHVNVDFRTVVSGGEVIVEYERYERCDHCGGSGVEPGSGYMNCPRCHGTGVRRTVFGFFVSERPCDYCGGTGKVPKERCKVCKGSGRVLRRVRRAVKIPPGVEEGSRIRIPGGGGDLYVIVHTKMDSRFKRSGNDLYYTVTIDYVQAILGTMVEIPLPEGSTMLKIPPGTQPDTIFRLKGKGISDPSRGKKGDLYVTIKVELPKSISREEKRLLEEIARIKN................................................ 366
106 0.000e+00UniRef50_A0A0G1X7I7 Chaperone protein DnaJ n=4 Tax=Bacteria TaxID=2 RepID=A0A0G1X7I7_9BACT  ali  33  3...........................................................................................KDYYQILGVAKGATPDEIKRAYRKLALKYHPDK--GENGNADKFKEVNEAYQVLGNADKRQQYDQFGHSFEGAGPGFGGFDFSNTSDFGGFEDVFSTFFGGRTSTPRRSREDKRGEDLEIAIEISFETAVFGGTQTIHLAKDTLCESCGGTGSINK-QMKRCAKCNGSGHVQTMLGAIRQSKTCSECKGLGEMPEQTCRHCTGTGRTKQPVAVKVEIPDGIDDGQTVRVPGKPGDLYVTVRVIPSREYRRDEFNLYKVVTVPFTVAALGGEVKTQTLDGTINLKIPPASQPGDVLRVKGHGVPKISATGRGDLYLTIEIQVPKRLTLKQRKLLQELNKEWGKE.............................................. 358
107 0.000e+00UniRef50_F2U883 DnaJ protein n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2U883_SALR5  ali  34  2.....................LQRQALRAASSGAASLRAVPVRHTHVHAQAITGLGXXXXXXXXXXXXXXXPPTSP-GKRHDALCNAGLAKQDFYELLGVSRDASERDIKKAYFQLAKKYHPDTNPGDEAAAQKFAEISEAYEVLSDSQKRQQYDQFGSTG--PSXXXXXXXXXXXXXSSNPEDIFREFMRNMGMGGAGEYGDPFGQTFVTTVRLSFMESVKGASRTLTFPSVEACSSCKGSGSATG-KTITCPVCNGSGVEHMSMGFLNMQSACRKCAGTGQVPEKSCKDCKGSGSVKTEETVSVNIPAGVEDGMQLQVGNHR---VISIEVEPSRQFRRKGTNVFSTARISLPQAVLGGRVHVPGLYGDMAVKVPAGTNSGQRLKLRDRGFQSVHDYTKGAHILELVVDVPVRLSDEERELYEQLALREANRNGEVTGIE...................................... 422
108 0.000e+00UniRef50_W6TV90 Chaperone protein DnaJ n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=W6TV90_HOLOB  ali  35  3............................................................................................DYYKVLGVPSNASIQDIKKAYRKLALKYHPDQHQNSSSAEEKFKEVTEAYEVLGDEKKRRMYDQMGPDAFRQSSSGGGGFEGFSEAGFDFSSIFEDFFSNFGS--SSQPTVSKGRDVLIKISITLEDAFKGVNQSVEFSTIVRCDSCSGTGGEKGSKVVQCTTCHGKGEVGISQGFFMVRQTCKRCQGTGTYIAVLCKKCRGSGCMRDRRVLDFRVPPGIEHESQLRLHGPCGDAIIQVNVQSHSLFRRKGANLFMNYPLSISQAALGCVVQIPTIEGEVSVTFREGTQFKEKTVVHNKGMPY--SSGRGDLIIEADVYVPLKLTQRQKELLQDFLEEEENKP-----------------------------PETTGFFAKLKNFF.. 370
109 0.000e+00UniRef50_A0A2P6FAR0 Chaperone protein DnaJ n=13 Tax=cellular organisms TaxID=131567 RepID=A0A2P6FAR0_9MOLU  ali  28  1........................................................................................MGKRDYYDVLGVERNATDEKIKRAFRQLAKKYHPDVSK-EKDAEAKFKEVNQAYEVLSDPNKRRNYDQFGHAGNDPNAFGGFGGDFEDIFSGGFGDIFENFFGGGAKRRGFSNQPIKGENVAARVTVTLKEQMFGKTIKLDLNVDKTCEACDGTGAKDKKDIHTCTTCDGYGYVRSLFGVIQSQQPCPDCKGRGKVVASKCPKCKGQGHYRGKEVVEIELPKSIYENQQLRIRGPRGDIYLEITVKPNKYFKRINDNLHLDLPVSYLDALLGAEIKVPTFDGDVHLKLPANTKTNSVFSIPNHGFKGPASTKRGDLIVNVLVAIPTKLSVEEKTKLQELKDI.................................................. 366
110 0.000e+00UniRef50_A0A1G2MAD9 Chaperone protein DnaJ n=9 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1G2MAD9_9BACT  ali  31  3...........................................................................................KNYYELLGIQKTASKDDIKKAFRTMAHKYHPDKKGGD---EAKFKEVNEAYSVLSDDKKRAEYDAYGFEGFDFSDFASGKGFGQGGVEFDLGDIFSDFFGG----RSPGGRQARGRDISIDVELSFAESVFGTDRRILLSKTSLCEVCKGSGAKAGTAMETCKTCNGKGKIRSIFGSVQTTRVCPECQGQGKVPKEKCPHCHGAGVTKRQEEIAVRIPAGIEDGEVIRLGGAPGDLYVKVHAARHPHFRKEGNNLLMDFSIKLSSALLGDEYKIETLDGPITVKIPEGIHHGEILRVKGKGVPIERGR-RGDLMIKIAIDLPSKLSREAKKLVEEMKK................................................... 363
111 0.000e+00UniRef50_E0NIU0 Chaperone protein DnaJ n=25 Tax=Firmicutes TaxID=1239 RepID=E0NIU0_9FIRM  ali  32  8...........................................................................................RDFYEILEVKRESTQTEIKSQYRKLAKKYHPDLNPGDEEAAEHFKEVNIAYEVLSDEKKRQMYDAYGEDGINGNAGSYGGGFGDIFGDIFDMFGQGFGGFGGYSEAEYRNRPIKGDDVRVDIIIDFKESIFGAKKDINVKRTETCKTCNGEGTAPGTHKHTCDKCNGTGKIRTPFGRFTQVSACDKCKGTGEIIDTPCPDCKGHGTRVVNKKITIDIPKGIDDKMILTLRGPAGDLYVYVRVKEDQIFKRMGNDLYMELPITYTDAVLGGSIKVPTLTKLVDYDIPAGTKSGATFRIRGEGVPYLRKDGKGDLVFKVDIHVPKKISD.............................................................. 347
112 0.000e+00UniRef50_A0A136L1L9 Chaperone protein DnaJ n=3 Tax=Armatimonadetes TaxID=67819 RepID=A0A136L1L9_9BACT  ali  31  1..........................................................................................MRDPYEVLGVARDAGADEIKSAYRRLARRYHPDVNPGDEEAEDKFKEVGQAYSVLSDPERKARYDTFGSVDEAPS---------TGFVDTRFSDLFDMFFSGFDASQSRRRIGRDGDDIRVDLQLTLDEVVTGVEKTVEYARSAKCAGCGGTGSEKGQAPEQCAKCGGQGVVTQMRGTVRTSATCSACGGAGAIIRNPCGECKGLGLKQEMAKASVKVPPGVESGLTVHLSGQNGDLFVVLRIQNDPRFARQGNDLSTGVTLTLAQAVLGDVVEVEGLDSDFEVEVPPGTQPGAVFRIDEAGLPPLYGGKRGNLVLHMRVEIPEKLSEAEADLIRQFAELRGEKPPRGKPE....................................... 355
113 0.000e+00UniRef50_A0A0E9ME69 Chaperone protein DnaJ n=7 Tax=Bacteria TaxID=2 RepID=A0A0E9ME69_9PROT  ali  33  2.................................................................................................LGVPKNADGKAIKDAFRKLALQYHPDRNK-EPGAEERFKEIAEAYAVLSDPKKRSEYDARGFEGV------AGFSREDLFGGIDFEDLFGGLFDFGPGGGRRQAGPVHGSNIEVELTIPLERVVSGGEEKVRLPYQTACSACHGSGAAAGTQPRVCSACNGTGQQTTRRRLIQQISVCPACLGRGSVIDKPCPSCGGTGKTTHEEVLSVTIPVGVEEGMALRIPGRGGDLFVVVRSAPDPRFERDGADLWRSETITVADAVLGTKLKVPTLDRSAEVTIPPGTQHDTVLRVRGKGLPEFGGRKHGDLFLRIRVHIPEHLSAEERELYQKLRDLAGEPHR............................................ 359
114 0.000e+00UniRef50_A0A256A7J8 Chaperone protein DnaJ n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A256A7J8_9FLAO  ali  31  1.........................................................................................MKKDFYEILGVPRNADEATIKKAYRKKAIEFHPDKNPGNKEAEEQFKLAAEAYEVLSDPQKRAKYDQYGHQAFEG--------GGFGGGNMNMDDIFSQFGDIFGSXXXXXXRRVKGSNLRIKVRLTLEEIANGVEKKIKVKRKVQ---------APGVRYKTCGTCNGQGQVMRVLGRMQSASTCPTCGGAGQILENRPANADAQGMIVNDETVSIKIPAGVVDGMQLKVSNKPGDLLVAIEEVEHETLKREGENLHLDLYISFAEAALGVSKDIEAVNGKVRIKLEEGIQSGKILRLKGKGVPNINGYGNGDLLVHVNVWTPKTLTKEQRIFFEK--------------------------ALTDENFIPHPEKSEKSFFEKVKDMFS. 370
115 0.000e+00UniRef50_UPI000830BE2C molecular chaperone DnaJ n=1 Tax=Methanofollis ethanolicus TaxID=488124 RepID=UPI000830BE2C  ali  30  1........................................................................................MSAGSYYDVLGVARDAGEQEIKKAYRNLARKYHPDVCK-EPDAEEKFKDINEAYSVLSDPEKRAQYDNIGHEAFKNASGGGGYGGGFQADFSGFGDIFDTFF----XXXXXXXXXXXXADLLYRLSISLKDAVFGTDREIEVMHTESCPECDGSGSKNK-KFRVCPKCGGSGQIRQVFGQFVRMSACPDCGGRGKIPEEPCKRCKGSGHARVKRKVSVRIPPGAYSGLRLRMEGYGGDLYVEIIVEESQDFVRNGENLETTVKVTPAMAAVGSKVEVKTIDGRVELKIPAGIQHGTALRIPGEGVRHRGRP--GDLLVRVKIVVPKSLSDEEKELYQKLLEIENKKGPEKKGFFKDFVDKMRGEPEK......................... 378
116 0.000e+00UniRef50_A0A2E3WIY4 Chaperone protein DnaJ n=8 Tax=Bacteria TaxID=2 RepID=A0A2E3WIY4_9BACT  ali  31  19.......................................................................................NMASKDFYSTLGVQRGSSDDEIKKSYKKLAFKYHPDRNKGDKXSEEKFKEINEAYQVLGDPEKRSQYDTYGSSAFEGGGAXXXXXXXXXGGGIDIEDLMNDFLGGGRGRRSSRDRSPKGRDLRYELVLDFEQAVKGTKMNVQVRR--------------AKSYKTCKACGGTGQVNYSQGFFSVSRGCDSCGGVGAFPED-----------TEHKTVEVKIPPGVDNGTQLRIRNEGGDLYIDISVKDHPLFERENENLICEVPISIPNAVVGGSVDIPTLEGKSELKIPAGVQPGQVMRLRGKGIKDLRSTRIGDLYVKLNIVIPKNISSKQKKLMQDFQKEIDKEATNPFSEYINKVKDF............................... 370
117 0.000e+00UniRef50_A0A2G4H448 Chaperone protein DnaJ n=1 Tax=Thermoleophilia bacterium TaxID=2026888 RepID=A0A2G4H448_9ACTN  ali  31  1..........................................................................................MRDLYEVLEVPRAATADEIKKAYRKLARKHHPDANPEDPKAEERFKEISAAHDTLSDVEKRKAYDQFGASGGTGAQGFDPNDFRDFDRGFDISDLFGDLFGRRRGGGPNAGRGRRPADLETRVTLSFDDALRGARVTVPVDKDLNCADCSGTGAAAGTSRTTCPDCGGSGERQVNQGFFAIAEACMRCGGQGSIVERPCTTCKGSGRQRRTKRYTVKIPAGIADASRIRVRGKPGDLWVVVQVLPSERFTRRGKDIIVEVPVTFPEAALGAEIDVPTLGEKVRVKVPAGSVDGKMLRVRGLGAPSTSGDD-GSLLVRLKLIVPSGLSTQQTEALEKFAALDGGTDPRAE......................................... 364
118 0.000e+00UniRef50_A0A1V5ULT8 Chaperone protein DnaJ n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V5ULT8_9BACT  ali  34  1........................................................................................MKMKDFYSILGVSQDASKEDIKKAYKNLAKKYHPDANSGNKSAEDKFKEVTEAYEVLSDDEKRSKYDRIKAGGFSGFGDGNFDFSGAGGAGGDFGDIFGSFFGGASGFRADSDRPSRGEDIEVKLELTLKQAVGGGNLKLKVNRRDICGYCSGEG---GSGNAACQSCRGTGSISRSQGGYAISQPCPRCSGRGKIKTNTCANCSGHGFVSDIKQIKVNIPEGVADGQLIRIPGEGGNILITVSIKPDDQFSRSGDDLYYELVLKFTEAALGAVKMVPTIRGSAKVNIPAGTKSGSKLKLKGQGVKNHKTGATGDQIITVKIDVPSVLSEEAKKLLKELEK................................................... 371
119 0.000e+00UniRef50_A0A2G4I6L1 Chaperone protein DnaJ n=35 Tax=Actinobacteria TaxID=201174 RepID=A0A2G4I6L1_9ACTN  ali  32  1.........................................................................................MAQDFYQLLGVSRGVSQEELKRAYRKLARELHPDANPNNAEAEEKFKLVSRAYEVLSDEETRARYDQFGEAGISGGGRGGGGGDPFGGAGGFGS-IFDAFFGGFGGSTRQQSGQQRGPDLETQIKIDFVDAIFGCHTSVSIRSAVSCEDCGGSGATAGTKATTCADCGGSGQVRRMRGQMVTTTPCGRCRGMGEVIASPCNKCRGEGRVTKDQTHEIEIPAGIAAGQTMRVGGAAGDLYVHIDVAPHAMYQREENDLVTNVQVSIAQAALGVDLVLATLDGDETLTVTPGVQHGHEYVLKGRGVPFLNGRTRGDLRARIEVVVPKKLSSKERDLLQQLAKERGEAVATSDSSLKSK................................... 377
120 0.000e+00UniRef50_A0A1U7LSJ4 DnaJ 1, mitochondrial n=1 Tax=Neolecta irregularis DAH-3 TaxID=1198029 RepID=A0A1U7LSJ4_9ASCO  ali  33  11.................................................................................GYHIIQNERAKNPYTVLGVSKDADAKDIKIAYYSLAKKYHPDSNK-ESNAREKFQEVQHAYEILSDPQKRTQYDQLGSVAFDQGFGSGSFTGFPGFTNIDLGDLFGNGHGQSSSFGGFGQQTMVGEDIDAPISISFIDAAKGVKRSVHIKPLTTCKTCSGSGLKSGAKRASCKRCGGSGRVHIMQGGFQMASKCESCDGSGISIPKECSSCGGEGILRESKTVTIDIPAGVEDGMKLRVTGEGGDLYVHIRVQEHPFFKRKGFNILYTAKVPMTTAALGGQISIPTLEGEVDVKVPQGVSPGDTLILPGKGIPKLQKSRPGDMKVEFQIQFPKSWSPYEQLLLEQLADSIGDKNAKRSSPTYSPPDST----------AREDGDCGSGFLKR....... 420
121 0.000e+00UniRef50_A0A2A5DHC6 Chaperone protein DnaJ n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A2A5DHC6_9BACT  ali  32  2.......................................................................................NAAQKNYYDLLGVNKEASNDDIRKAYRGLAKKYHPDKTGGDEKAEDYLKEINAAYDVLKNTDKRKEYDTQ----QAYGGGAGFGGYDFSGGGGGFEDMFSA-FGGGRQQAARHNAPRRGRNLETNVTIGLLDVLDGTTKTIQLYRKETCDDCKGSGAAPGTSPVTCPDCHGTGQVSRNNGLFNTNQACGRCRGAGSTIATPCGACSGSGLVKEQRTISVSIPKGIQDATRLRVAGEGGDLFVAVSVMAHPLFRRNGADIVCDVPITFATAALGGTVEVPTLDRKLKLTVPASTQNGTQLRMKGMGLPTGAGSKRGDELIQIVVEIPQKLNKEQKVLLSEM..................................................... 346
122 0.000e+00UniRef50_A0A139AQT1 Uncharacterized protein n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139AQT1_GONPR  ali  36  29..................................................................................FHSPTRAPKRDAYEILGVQRNAAASDIKKAYYALAKQYHPDTNK-DEGAHEKFVEIQEAYEILSDEQKRAAYDQFGHSAFSGPGGDPSXXXXXXXXXXXXSDLFEQLFGAAGGRGGGMGMDMAGEDINAALRIGFMDAIKGVQRPLTFQSIIKCSTCSGSGLKTGQKLKACEGCGGTGRKVFVRGGFQMVSECPTCQGAGTIIPKRCTSCEGHGRVRDKRTVMVSIPAGIDDGMKVRLAGQPGDLYVSITVSPHPTFRREGNDIHLDVPLPFTTAILGGSIRIPTVDGDVELKVEPGTQPEARKRLTKRGAPIVGRSDRGDQWVTLKVQVPKRLTSRQQELLKEWIAEDERALGDSGAPDDKSKG................................. 426
123 0.000e+00UniRef50_A0A2H9ME79 Chaperone protein DnaJ n=1 Tax=Caldiserica bacterium CG02_land_8_20_14_3_00_36_38 TaxID=1973932 RepID=A0A2H9ME79_9BACT  ali  31  1........................................................................................MSDRNYYKILGVSKDATPEEIKKKYRELVMKYHPNLNKNNPEAPRKMAEINEAYQVLSDSDRRAQYDRFGTVGEGVGTPGGAGGFNFGDFGANFG------FGGFREETEERERVSHGADLEYSLTISFKEAVLGTTKEISFNGKGVCPVCHGSGVEPGAGYITCPTCKGSGVVRTVFGQFVVQSTCSTCHGTGKIPKEKCHNCGGLGAVNSTRKIEVKIPAGVENGMRVRIRGQGGDLYVLIRVIADNRFVREGDNLFYNAHISVPDAVLGTTISVPLIEGEEKLKVPAGTQSGIEIPIRAKGAYNVGSRRRGNLIVKIFVDIPSRLSREEINYFEKLRELESEKKSRA.......................................... 374
124 0.000e+00UniRef50_A0A1Z8NC16 Chaperone protein DnaJ n=1 Tax=Planctomycetaceae bacterium TMED10 TaxID=1986833 RepID=A0A1Z8NC16_9PLAN  ali  31  4..........................................................................................KRCYYEVLSVTQTASTDEISVAYRKMAIQYHPDKNPEDETAIGRFKEAAEAFEVLSDADKRSRYDRYGHAGLEGSGQ----------QFHDLSDIFEAFGDMFGGGIFGGGSRGRRADIECDLSIDLFAAARGIKKQVSFSRHQRCEDCDGNGAAGGTALESCPYCGGHGQVIQSSGILRMQTTCPSCHGAGSTIREKCDNCRGDGYQEEAVTCDVAVPGGIDDQMQIRLGGPPGDLYCLVHVEEHPLFTRQGNHLICKVPITYSQAVLGGTVEIPTLDGPESIEIKSGIRAGSVIKLSRRGMPDPRGRRAGDLHIQIDIDVPKKLSDEQEQAIRKLAELE----------------------------LSHVTPHRKSFLDTLKGYFVN 368
125 0.000e+00UniRef50_A0A2S8SQU3 Chaperone protein DnaJ n=1 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8SQU3_9BACT  ali  31  1.........................................................................................MARDYYEILGVAKGASADEIRRAYRKMAREHHPDVNPEREEAEAQFKEIGAAYGVLSDEQKRARYDQF------GEAGLNGGGGPDISGAGGLGDLFEVFFGGAGGGIGGNRARRRGSDIRADVRLTLEECWAGVTKELRIPTLLSCKTCSGSGAAPGTQPENCVQCSGSGRVRTFFGQFVQEAPCPRCGGRGKIIPTPCPTCKGEGRTRGERTVTIAIPPGVDEGDRVRVNGPAGDLYCFISVEESQNFQRRENDVLYVMTLSYAQAALGDTVDVQTLDGDVEVNVPAGTQNGALFRVSGKGF-TTRGGYRGDQVCVARVVVPKKLSERQKELLREFADIEKE----------------------------HLEEQPRRFFDKLKDAFG. 378
126 0.000e+00UniRef50_B0VH26 Chaperone protein DnaJ n=32 Tax=Bacteria TaxID=2 RepID=B0VH26_CLOAI  ali  29  1........................................................................................MAKRDYYEILGVDRNADEATIKKAYRKLAMQYHPDKNPNXXXXE-----------------KRQIYDQYGHSGLENQFGGTGFSWEEFMHRSDLNDIFGDIFGGGFGGRNQRSSSNRGEDLQIELSLSLQEIANGVEKTIKIGIKEPCDKCGGSGSAEG-KTETCPNCKGTGQIRQIFGRMQTVSECPTCNGEGRIIKNKCSKCYGEGRVGTVKEIPINIPPGVEDGQYIRFRGQGGDLLVLIHQKKDDLFEREGNNIILEYPITVSQAVLGDEIIVPTLTGSVKMKVPPGTQSGRLFRLKGQGIQGHNSYSRGDQIVRTIVVIPTKLSREEVELLREFDRKRDLKPGKSFAAKLKS................................... 382
127 0.000e+00UniRef50_E1RID4 Chaperone protein DnaJ n=18 Tax=root TaxID=1 RepID=E1RID4_METP4  ali  30  1........................................................................................MGAKNYYDVLNVPKDANEQEIKKAYRTLTKKYHPDVCK-EEGAEEKFKEINEAYSVLSDSQKRAQYDHMGHETFTNASKGQFGGAGFNADFGGFGDIFDAFFGGGAGQRRGPRGPQPGADLLMRVQVTLKDAVLGTSKDIDVMHTEACEECEGTGS-STKKTRVCPRCGGSGQERRPFGSFVSMTTCSQCRGRGKIPEQTCSKCGGSGHKKVKRTITVNIPAGIESGMRLRMEGYGGDLFIEVDVLADSKFKRLGDNLETSVSVSAAGAAVGTKVDITTIDDRVELKVPAGIQHGTALKIPGEGV--RRRGRPGDLLVRVNISIPKDLGDEEKELYKRLLEIESEKKDSKKG........................................ 367
128 0.000e+00UniRef50_R7KEG7 Chaperone protein DnaJ n=48 Tax=Bacteria TaxID=2 RepID=R7KEG7_9CLOT  ali  37  1.......................................................................................MATKRDYYEVLGVSKSASQDEIKSAFRRLAKKYHPDISK-EENAEEKFKEVQEAYSVLSDENKRKQYDQFGHAAFQGGAAGGNPSGGFGFDASDLGDIFEDLXXXXXXXXRTSSRKQRGSDMLLRMNLTFEEAVFGCEKDIDVDVIDECDNCHGKG---GFDEKTCSRCHGSGTVTVEQGSFVTKSTCPDCKGKGKTFAKTCSDCRGTGTVKVRKTITVHVPAGIDNGERLRLAGKGGDLYLEFSIKEHDYFKRDGNDIYLEVPITIVEATLGCKKEIPTIYGNITVSVPAGTDSGTKQRVRGKGIKD-DRRRTGDMYIIYRVQTPKKLSRDQKKLFDSLA.................................................... 359
129 0.000e+00UniRef50_A0A1V5R8E8 Chaperone protein DnaJ n=7 Tax=Bacteria TaxID=2 RepID=A0A1V5R8E8_9BACT  ali  32  1.........................................................................................MKRDHYEVLGVGRDASLDEIKKAYRRLAMQNHPDQNPGNKEAEERFKEAAEAYAVLSDSEKRRHYDQFGHDAPQAGG-----FQFDPNQFADFEDILFGDFFGGMGGRRRPGQGERGSDLQYTLRLDFKESVFGVDKEVEIPRLEACGTCRGSGCADGTSPQTCPQCRGQGQVAVRQGFLQMYAPCPRCEGRGMVIPSPCAACRGEGRIHRRSKVKFRIPAGIDRGQRLRLEGEGGDLYIVFDIAPDSTYERDGFDLHRRLDVPWPLLVVGGSHPVETLYGTEHLRLQAGTPADQVVKVPNAGIPKLRGSGRGDLYLHLRVEVPRKLTSDQERLVKELLAAFQGEGNAEDEGFLAKV.................................. 370
130 0.000e+00UniRef50_A0A2P6V138 Flagellar outer dynein arm heavy chain beta n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6V138_9CHLO  ali  32  6..........ASAGSALVPPHSRTLGFRPATACTRGCGCSALGSVPAHRGSSLRTAXXXXXXXXXXXXXXXXXXGLRLVVR--------AERDFYQILGVARDADKKTIKSSYRQLARKFHPDVNK-EADAEQRFKDISAAYEVLSDDEKRGMYDRFGEAGLKGGFXXXXXXXXXXXDFSNPFDIFETXXXXXXXXSRMRNRPVAGDDQRYDLRLDFTEAVFGCQKEIEVSRLEECKTCSGSGVKAGSTPTTCDTCKGQGQVTQVLGMFQQVGICPTCGGSGEQ-STPCGTCQGDGRVRGTKRISLRVPPGVDEGSRLRVRGEPGDLYVFIGVKAHPELRREGVTIHSDVEISYIDAILGTTVKVTTLGNTVDLKIPAGTQPGTTLVMSKRGVPKLGANARGDHLVHVKVKIPKTIGGEERKLMEQLREL.................................................. 452
131 0.000e+00UniRef50_A0A0S8A240 Chaperone protein DnaJ n=3 Tax=root TaxID=1 RepID=A0A0S8A240_9GAMM  ali  31  1.........................................................................................MEKDYYELLGVPRDADTKKIKDAYHRLAMKYHPDRNPS-PDAAEKFKEISKAYAILSDPKKRANYDAGGFEGVK------HYSQEDLFRDLDLGSIFGDMGLGAGFFHEQPRGPVRGQDLYINVQVPLEVIAKGGKEKIRYSRPVACSTCHGHGTKSGKAPAVCPSCQGSGRKVQRHIRYQQLVTCPDCNGRGTVAEAPCEVCRGSGRQEKFEALNINIPAGIDDGTVLRVPGANGDLHVHVYSAPDKRFQRRGADLWRIEYISVEDAVLGSEIKVPTLDGRVKVKIPPGTQPDEVLRLRNKGLPKFRGSGYGDLHLRIQVQIPDNLTGKERELYEALRALHKAK.............................................. 362
132 0.000e+00UniRef50_A0A1S4EQ90 protein tumorous imaginal discs, mitochondrial-like isoform X1 n=1 Tax=Diaphorina citri TaxID=121845 RepID=A0A1S4EQ90_DIACI  ali  43  10..............................................RVPPRLFSSFKYGALQLNRFHLVNPQPLIYLRHSAHFHTSSNLKRKDYYQILGISKNSSAKEIKKAYYELAKKYHPDTNKTDPNASKKFHEVSEAYEVLSDDTKRQEYDTWGATSEQMSAAGASRSRWNFKSSVDPEELFRKIFGDTGFDFFIANKYGFGSSQEVILKIDFETAARGGYKEVDVNVIDICPKCRGTRCELGTKSVRCTYCQGSGYETTTTGPFIMKTTCRYCSGSGIYIKFPCQNCDGMGQNIQRRTVSIPIPQGIEDGQTIRFPIGQDQIFVTFQVIPSSRYHRDQSDIHTEESISISQAILGGTINVEGIYGDLSVEIQPGTSSHTKIKIPYKGLKNRNSSGYGHHFVHVKIEVPRYPSEKQKDLVREFFSVEPNTNGNKDDSNQALSGYRDI-----FLFFSRLIDFIKSFLSSFKK.... 452
133 0.000e+00UniRef50_A0A1Q9NQU0 Chaperone protein DnaJ n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_3 TaxID=1841598 RepID=A0A1Q9NQU0_9ARCH  ali  33  3.........................................................................................QKRDYYEILGVSKNSSNSELKKAYRKLAMNFHPDM------AEKKGIDISEAYGVLSDSEKRSVYDRFGHEGLQGRGMG------FNGDFGGFEDILSDLFGGIFGGSSRRRSPQRGSDIQMILEISLVEAYNGAEKEIVPPMPAICPTCNGSKAKPGTKPETCRTCRGQGQVQQTQGVVNTITTCPTCRGEGQAISKKCPECKGEGRIPQKRKIKINIPPGIDDGNQIRIPREGGDLFLVLRVEEHPVFKRDGADLHRTLLIPFHTAVLGGKINIPYLDGSIIFTIPKNIKPDEKIKVERKGMPVRKGGRLGDLYIYVNIGAPEKVNKEQKEYLQKFEQLFGE............................................... 364
134 0.000e+00UniRef50_A0A1F4NTW5 Chaperone protein DnaJ n=2 Tax=candidate division Kazan-3B-28 TaxID=1798534 RepID=A0A1F4NTW5_9BACT  ali  35  1........................................................................................MMSKDYYKILGVSRGASPDEIKQAYRRLALRYHPDKTKGDKEGEQKFKEVNEAYRVLSDPARRKQYDQFGQTFEGAAGGGFARFTQDFGDLGGFEDLFDAFFGGMRGGRRRSAEVQRGRDIEINLQITFDEAAFGTTKRISVPRAVACEYCKGTGASDG-ELVSCDKCGGRGEIRVSQGTFAQVQLCNVCKGTGKKPARPCRHCRGEGRHSLTEKVEVKIPAGVGSGQTIKLSGGGGDLYVVIQVLESPDFKRKGADLYRQETLSYPVAVLGGEIKVKALEGVLKLKVPSGTKSGEVFRLAGKGLPRLDRSGNGDLFIEVEIDVPRRLTLKQKR.......................................................... 355
135 0.000e+00UniRef50_A0A0S8FZW7 Chaperone protein DnaJ n=1 Tax=Planctomycetes bacterium SM23_32 TaxID=1704029 RepID=A0A0S8FZW7_9BACT  ali  31  1........................................................................................MADRDYYEVLGVQQDASQADIKKAYRGMALRYHPDRNPGDPGAAERFKEAAEAYEVLGNEEARRRYDLYGKAGLQ---------GVPLHEFSSVDDIFSDFFGGAFFGRTRARQPTRGRNLRVSVEIGLRDVLTGTQRTIALTRSEICESCAGRGA-PEEGMRTCSQCRGHGEVESRQAFFRMRTTCPRCGGRGTVITAPCGACGGSGRRQQQVQVVVSIPAGIESGTRLRVRGPRGDLFCDVFVSEDAVFARNGTELLCEVPVSYPTAALGGSIEVPSVDGESELVVPRGTQSGDVLRMRRLGLPAMGRGGRGDMLVRVIVETPQRLTRRQEELLRELAEIEDVNVSERRKTFLAKLKSYIYGQPEEPE...................... 377
136 0.000e+00UniRef50_A0A0K2SWW1 Protein tumorous imaginal discs, mitochondriallike [Megachile rotundata] n=7 Tax=Bilateria TaxID=33213 RepID=A0A0K2SWW1_LEPSM  ali  48  9...................................................................RLFQRSLVLPQFVRGFRLGATLNAEEYYKTLGVDRSASTKEIKKAYYELAKKYHPDTNKGDTNAQKKFQAVSEAYEILSDDSKRKSYDAYGTAGPEASGFGGASGFGEGTS-IDPEELFRTIFGDGFGRGAGGFSSAFGQEFHHQMTLSFQEAAKGVTKDISVSVM---DDCNSCSGKGGSGSERCPNCNGSGMETVSTGPFMMRSTCRRCSGNGVWIKDPCKSCRGSGRMSHRKSVSVPVPAGIENGQTVRVPGKHSEAFITFNVRPSDYFQRKGNDVHTTGRISLSQAVLGGTIRIQGIYEDLTVSIPPTTSSHTSIRMKGKGIKNVSGYGYGDHYINIKIVPPKKLDPKQSAILKAFAELEPDTPGTVNGITYNKGGNKVEDPNGLVGDLREALSEEKG........... 418
137 0.000e+00UniRef50_A0A0D3CJ61 Uncharacterized protein n=31 Tax=Mesangiospermae TaxID=1437183 RepID=A0A0D3CJ61_BRAOL  ali  29  1.........................................MPRSTLIPSINPAHSFRHQFPLSSPSFSSPPSFMRCGNRR--RGVTMAAGKDHYKTLNVGRNATLKEIKSAYRALARKYHPDMNK-NPGAEDKFKQISAAYEVLSDEEKRSAYDRFGEAGLDANFNASQ----DASQGVDPFDLYSEMGDSGGMGFDFMNKRSLDLDIRYDMRLSFEESVFGVKREIDVSYLATCDGCGGTGAKSSKDVKQCSNCGGKGRVRTPFGIMSQVSNCSKCGGDGRIITDKCRMCNGNGRLRSSKKMDLVVPPGVSDRATMRMRGEGGDLFIVLQVAEKRGIRREGLNLYSKITIDFTDAILGTVTKVETVEGTMDLRIPPGTQPGDTVKLYRKGVPDTRPSVRGDHCFEVKVLIPKNLSERERKLVEEF--------------SSLRRSSSSTETRQEEHRFDSESREKPSLWQKMKSFI.. 442
138 0.000e+00UniRef50_A0A2V8SMW4 Molecular chaperone DnaJ n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8SMW4_9BACT  ali  31  1........................................................................................MAKKDYYQTLGVKKDAKADEIKKSYRRLARKFHPDVNPNDKSAEEKFKEVQEAYDVLSDEKKRKVFDRFGYYNDNLDPDSPFSSGSTSGGSSSFRDIFSDLFGGSGGAPGARPLPKKGRDIEIPLALSFEEAFTGLTTNITVNRSEQCSRCQGAG-DTGGPVVTCTTCKGTGQVMRTGGRLQFSQPCPDCEGTGRR-RTPCSLCNGKGTTPKTEQVKIRIPAGVDTGSRVRLGAEPGDLFILTNVGKHKFLERRGDNVYVTVPITVPEAALGAKIEVPTVEGKAQLKIPSGTESGQKFRLRERGFPSLRNPKRGDEFIEVKISLPKVISEETKELLRQFEKSNAENPRKAMGLD...................................... 391
139 0.000e+00UniRef50_A0A1R1WXE2 DnaJ-like protein n=3 Tax=Smittium culicis TaxID=133412 RepID=A0A1R1WXE2_9FUNG  ali  30  9........................RNSGLVAHELISTKYACHKLVSRSITTKVYSKCSAFYPFNQYQALQPQKTVPKTQKARFHVSTGNYKDDLYSTLGVSKNASISDIKKSYYQLAKKYHPDVNK-EPGSKEKFHKIQEAYDTLSDETKRSNYDQFGTADPSGSGGFGGQGFPGFGGMGSMDDIFSQIFGAGAGRSSSSQGPMNGEDIEYSVRISFEDAVAGKTVTVSTQPVLECNTCDGLGVKKGAKASTCSTCKGSGQQTFSMGGFHVRQQCSSCGGSGSAVKDKCGTCKGRGVIQSREQVSVDIPAGCDDGMVLELRGPRGSLYVQVRVSPSKIFTRKGADVFYTAKVPLSKVLVGGEMTFPTISGNVDVKIKQGSQPGDELRLRGKGMKKVKGMGNGDFYIKLNIEIPKNLTKKQQEYAKLLADELEGKSS............................................ 447
140 0.000e+00UniRef50_A0A1G2KRH2 Chaperone protein DnaJ n=1 Tax=Candidatus Sungbacteria bacterium RIFCSPHIGHO2_02_FULL_49_12 TaxID=1802271 RepID=A0A1G2KRH2_9BACT  ali  31  1.........................................................................................MKKDYYEILGVPRSSSLEEIKRAYRKLAHQYHPDKKAGN---EEKFKEANEAYQVLGNEGKRAQYDQFGFSGARGGEGAGDFGFNSRFGEFDLGDIFEGLFG--ASGAHRDTKRKRGKDIVIDITIPFEESILGGKETIEYKRTVRCARCSGTGGEPGTNIVKCATCGGKGSIRTILGSMTRVETCPRCRGAGDIPEKFCGFCGGKGLELKKESIELIIPKGTKTDDVLRLSGKPGDLFVRLRVLPHKTFKRQGDDLIMAVSIKISQAILGGHMTLEAIDGTVDLKIPEGTQSGDILRLRGRGVSESRGYGRGDLLVEVTVEVPRKLPKHLKELIEQLKQE.................................................. 367
141 0.000e+00UniRef50_A0A095XA24 Chaperone protein DnaJ n=2 Tax=Actinomycetaceae TaxID=2049 RepID=A0A095XA24_9ACTO  ali  31  3............................................................................................DYYEVLGVSREATESEIKKAYRKLARTLHPDVAG--PEGEERFKMVSEAYEVLSNTEKRRMYDLGGTDALRGGQAGGFGAGFSGF-----EDIFSNLFGAGASARGPVSRARRGGDALVQADLSLSDVVFGTEKEISVDLNLECGVCHGSMTAPGTEPVTCSDCGGSGSVQRVFGQMVSSSACSSCHGYGTRIVTPCAECSGEGRVRSVQKMKIQIPGGVEEGMRLRLPGKGGDLFVQIHVLPDAVFAREGDDLLAVMEVPMTVAVLGTESEIRTLDGMKKIKIAPGTQSGTVQVLRGLGVRKMNRSARGDLRIQINVLTPTGLDSAQKKLVRELAHKRGE-----------------------LDAQTDLTEHSESVFAKLRDKFS. 372
142 0.000e+00UniRef50_G7E531 Uncharacterized protein n=3 Tax=Pucciniomycotina TaxID=29000 RepID=G7E531_MIXOS  ali  31  1MRPPCSCASIIARVERSRHAGLRTREPQAASPTLKRQFSASRSSSISRPASRPTWQGSAVG-LRGSRHRLVQRQPGCGSRRSFHSSQPARAKNPYDVLGVDAKASTSDIKKAYYGLAKKFHPDTNK-DATAKTRFVEIQDAYDTLSDDSKRSAFDKYGAASQQQGFDADAYARGAGNASGASSDLFESLFGAFGGGSRGRRRSQRGSDVETEITIPFLDACKGTSRKVTIQPVVNCHVCTGSGTKKGAKKTTCSACQGSGSMSVVQGGFTMSTTCQQCGGAGESVKDMCGTCGGVGKVRERKTVDVEVPAGVDDGQMVRLSGKPGHLLVRINVIPSKTFRRQGANIYRDTTLPFHTAVLGGRARVPTLEEEVEVRIPPGTQPDEEMLLRGRGIKKLYKQQRGDLLLKFKISVPRSLTASQRAILEDYAADIEGRPKPSDTKPAEPEATVVDE............................ 495
143 0.000e+00UniRef50_UPI000D1C9F7B uncharacterized protein LOC9640501 isoform X1 n=4 Tax=Selaginella moellendorffii TaxID=88036 RepID=UPI000D1C9F7B  ali  29  5..................SPSAPGCCCYSRRVRSSGDGRRRMCLKLAERARFWTGSGCAFRSGEILLFTSQKRKNRVKGCSSSGMHFATMAVDYYETLGVPRTATILEVKHAYRKLAKKYHPDKAPGN---EEKFKAISAAYEVLSDPEKKEYYDKYGDADFQNGVPP-----------TNPFDIFRSVFGEMAGMRPENFQ---GADLGYELHLEFTEGIFGAEKKIEVSHLETCNSCDGSGAYLG-KVKPCKGCRGRGQQQASYGTFSRVSVCTDCEGRGEVILDYCRTCGGEGVVLTKKTIDVKVPAGVKNGNTLRVPHEPGDLYISLKVKDYPGIKREGNNLVSTISVSYVDAILGTLVEVNTLGGKAVIRIPPGTQPGDTVVLPNQGVPRLGSRTRGSHIFTIQVKIPRSLSSEEIQLVERLAHL-------------QRLKSDWKTKNTFSGRKSTQGNGETGFWQAFKNAIG. 451
144 0.000e+00UniRef50_A0A1C7MQP8 DnaJ 1, mitochondrial n=2 Tax=Agaricomycetes TaxID=155619 RepID=A0A1C7MQP8_GRIFR  ali  34  216..........................................................AHLSVASEINRSSSQVMHPSSERAFHASASCSSKDPYQVLGIKKDATPAEIKKVYFSLARKYHPDTNP-DKNAQDKFVEIQEAYDILKDEKKRADYDKYGAASQQQGFDANAFENARSSXXXDFSSLFEQLFGAFSGRGRTGAGSMHGGDLEASLGVSFMEACKGTSHTINITPVVNCGTCSGTGLKAGAKRSTCTSCGGSGTQTFVINGFHMASTCSKCHGSGTTVPSQCGECAGAGQVRVRKSVKVDVPAGVEDGMTIKVRGRPGDLLVRIHVASSKVFRRQGPNIHHDARIPLHTALLGGRVRVPTLDGEVDVRIPGGTQQGEEMVLKGRGVASMFHGSKGDLFVTFNVQLPRSLTKRQREILQQYADDEGRAPSTQSQGTRGGSATESGTSSGGSDSTPSDSDTNED........... 666
145 0.000e+00UniRef50_Q9ZDY0 Chaperone protein DnaJ n=107 Tax=cellular organisms TaxID=131567 RepID=DNAJ_RICPR  ali  31  3...........................................................................................QDYYQVLGVSKTASQADIKKAYLKLAKQYHPDT---------------------TNXQKRAAYDRFGHDAFQSQQARGGGNNGSFHP--DINDIFGDFFSDFMGSGRRKQTSSRGSDLKYDLTIKLEEAFHGIEKNISFSSEVKCDTCHGTGSEKGETITTCDACGGVGATRIQQGFFTLEQTCHKCQGNGQIIKNPCKKCHGMGRYHKQRNLSINIPAGVENGTRIRHTGEGGDLYVDIAIKPHDIYKVDGANLHCKLPISFVHAALGGEIEVPVIEGKVKLTIPAGTQNGDQLRLRSKGMSKVRSTIRGDMLTHIHVEVPKNLSKKQRELLEEFKKE-----------------------------SINEKENDSSFFNKMKSMWS. 370
146 0.000e+00UniRef50_B1XQF6 Chaperone protein DnaJ n=23 Tax=cellular organisms TaxID=131567 RepID=DNAJ_SYNP2  ali  33  4............................................................................................DFYEILGVSRDCGKDELKRAYRRLARQYHPDVNK-DPGAEEKFKEINRAYEVLSEPETRARYDRF----GEAGVSGAGAAGADYGDMGGFADIFETIFSGFGGMGTGATGGGRRRSGPMRGDDLFKEAIFGGEKEIRIPHLETCKTCSGSGAKAGTSANTCGTCNGTGQVRRPFGSFAQVSVCPTCNGEGQVIAEKCESCGGAGRKQETKKLKITIPAGVDSGTRLRVGGPPGDLYVYLAVNADKEFRRDGTNILSEIEISYLQAILGDTVKVKTVDGTEDLTIPAGLQPNKVLILEGKGVPKLNPVSRGDHLITVKVMIPTKVSREEKELLHQLAKLKGTEHSK........................................... 364
147 0.000e+00UniRef50_R7K4C7 Chaperone protein DnaJ n=2 Tax=Bacteria TaxID=2 RepID=R7K4C7_9FIRM  ali  31  1........................................................................................MAKKDYYAILGVSKTASQDEIKSAYRKMAKQYHPDLHPDDKQCAEKFKECNEAYEILGDPERRRKYDS-GEMDFENFNFGGPGRGFSTAGFEDIFDIFSSFMGGGSRSSAGAQRQPRGSDVTCSVNVSFLEAALGASKEIKLNRLERCPDCNGTGAKDSSSVKECDECHGTGRVQYVFGRQVTVGTCRKCGGAGKIVTERCKKCSGAGVVSKKKILTIHIPAGTENGAIMSINGYGGNLLVIINVEQSKLFKRDDCNLYVDVPIPFSVAVNGGDVEIPTLSGSVTHRLEEGTANGETLRIRGKGIK--NGRRTGDLFVRLLVEVPSNVDKTNKKQLAEFENQLSLKNYPK.......................................... 362
148 0.000e+00UniRef50_I4C6F7 Chaperone protein DnaJ n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=I4C6F7_DESTA  ali  32  1........................................................................................MAEKDLYAALGVKRDATTEQIKKTYRKLARKYHPDVNPGNKEAEDKFKQISEAYEVLSDPEKRKTYDEFGEEGLRAGFGAESFTDQGGFRYGGFEDIFGEIFGGG-----APRGPAKGRDIESELEIDFLTAIRGGTTRVTFQKPSACSRCGGTGRISTGTDSVCATCKGTGKTRVAQGPFNFTQTCPECQGTGRS-GEVCPQCGGTGSVLTTETIDVNIPAGVDDGSRIRLAGPPGDMFIVMRVRPHTVFKREGDNLNLDLPVTVSEALNGAQVTVPTPTGTVDLKIPPGTKSGQRLRLKGKGVPNLKTKVPGDLFVTVRIQIPVTQDPEARQA......................................................... 364
149 0.000e+00UniRef50_A0A2M7TJY5 Chaperone protein DnaJ n=3 Tax=candidate division WWE3 TaxID=422282 RepID=A0A2M7TJY5_9BACT  ali  33  4.............................................................................................YYEILGISAKASDAEIKSAYKKLAKKYHPDVNK-EASAKNTFQQVSKAYQILSDPQKRAAYDRMGHDGSQQSYSGFGQGGFSFGGAQDPFDIFEGIFGSKRYGQERRSDPI-GENIEVILNLTFGEAVTGVTKTISYERFLGCKSCGGSGAKKNEPASTCSTCQGSGQVRSNRSFFAQVTDCPNCRGTGQIIKNPCLSCSGTGRSKAKETLTVDIPAGVDTGTQIRYSGEPGDLFITCKVSLHKNFSRSGNNLVLHIHVTIAQAVLGDTIEIPTIEGKVTVEIPQGTQHEDHITIKNKGVPNLRGGSRGSLIIIVHVQIPKKLSNEQKKVFTDLKAVEKSNSS............................................ 374
150 0.000e+00UniRef50_A0A1Q6RL66 Chaperone protein DnaJ n=1 Tax=Firmicutes bacterium CAG:552_39_19 TaxID=1897035 RepID=A0A1Q6RL66_9FIRM  ali  30  1........................................................................................MEKKSYYDILGVGKDASNDEIKSAFKKLALKYHPDHNPGDEAAAEKFKEINEAYQTLSDPQKRAAYDN-----PASSAGFGGFSGENFTGFGGFGSVFDDL-FSFFGGGGGGSQKARGRDVNVKVTLTFEEAAFGAQKEVSVSRIEPCKECKGTGAKNGTEYTQCSNCGGTGRVRYVQGQMASERVCPKCGGAGKIIKETCPKCGGRAFVRVNTKLKLTFPPLMENGQLVTVRGEGGDLLIAVTVLPHKLFTRKGSDLYMTYPITVVQAMLGDKVKIPAIKGDVMLTIPEGTQSGDTVKIRSAGVDTGRRVSKGDMYVKLVVDIPKNLTKEQKEKVKAMGESIKET.............................................. 354
151 0.000e+00UniRef50_A0A1H9W618 Chaperone protein DnaJ n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1H9W618_9CORY  ali  30  1.........................................................................................MARDYYGILGVDKNASDQDIKKAYRKLARKYHPDVN-DTAEAEERFREISIAQEVLLDPQKRRIVDMGGDPMEQSQGAPXXXXXXXXXXXX---DIFEAFFGGAAGGQRGRSRVQPGSDALLRTTITLEEAFKGVKKEVTVDTAVVCNNCTGTGSESKAKPVTCDNCQGSGSVQEVQGNVMTTMDCPKCAGFGEIIPDPCTKCDGQGRVRERRDLIVNVPAGIADGMRIRMGGPAGDLYVEITTQRHPVFVREGDNLHMNLRVPMLDAALGTAVKCTDLAGEFEVHIDAGTQPGAQILLEGEGMPHLRAAGRGNLVAHVQVTIPTDLDDKGRAALEDLRRRRDNDYSQV-----------------------ETEDEDSGFFSRLRDRF.. 377
152 0.000e+00UniRef50_A0A2K8NUU7 Chaperone protein DnaJ n=3 Tax=Entomoplasmataceae TaxID=33925 RepID=A0A2K8NUU7_9MOLU  ali  32  1.......................................................................................MAAKRDYYEVLGVPKTATEQEIKKAYRALAKKYHPDVNKS-PDAEEKFKEINEASEVLLDSKKRDRYDRFGHAGVEGQAGFGGFGNFEGGRSSSFSDIFGEMFGEGNRSGFQNQRPIPGEDLVLDIELTWKELIFGTTKQVSLDLLTKCQTCHGQGAENPKDVMICPECHGAGQVVQQLGPFQSQQTCPECHGTGKIFTNKCHSCHGDSYYVTRRDVTLDIPKGLRPGQQLMISGAGGNIYLNIHVKESLIFKISGNDLIMKYNLSYLDAILGHDIIVETYDGPLRIKVPQGTNSGEYITIRDRGLKNINSHHRGDLKLLINIVVPNLVDRKTRKILEEIAQ................................................... 366
153 0.000e+00UniRef50_A0A1F9QH29 Chaperone protein DnaJ n=11 Tax=Bacteria TaxID=2 RepID=A0A1F9QH29_9DELT  ali  32  4..........................................................................................KRDYYEILGVARDVSKADLKKAYRKLAIQYHPDKNP--------------------DXNKRQIYDQFGHRGLEGAGHSGPSGFED--IFSSFGDIFEDFFG-FXXXXXXXXXXXXXSDLRYNMTIEFMEAAFGTEKTISIPKLSTCPDCRGTGCEEGTHSETCSQCHGSGQFIQSQGFFKVKTTCPYCKGQGTIISNPCRKCRGAGRVEITRKVQVKIPAGVDVGSKLRLSGEPGDLYVVINVRPHKFFQRDNTNIICAIDISFIQAILGDEITIPTLVGEKKLTIPKSTQYGDVFKLKGEGIASLRTGQRGDQIIKVIIKTPTKVSQKQVELLRQFDELDSNKISNK.......................................... 358
154 0.000e+00UniRef50_A0A0G1FEU4 Chaperone protein DnaJ n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1FEU4_9BACT  ali  34  3............................................................................................DYYQTLGVSKTATQDEIKKAYRKLAHQHHPDKAGGD---EAKFKEISQAYSVLGNEEKKKQYDQLGHAVFSQSGGNSANGFNGSGHFQDFTVNFDDIGDVFGDFFGFGRRTSKGSDMRMMLDLHFMEAVFGVDKTVVVERHESCSRCHGTSLEPGTELRTCYRCAGNGKITANQGTFQTIQSCPDCRGNGRVAEHPCSVCKGRGIEKKRAEIKVSIPAGIDDGETVRLSGQGGDLYITVRVKKHTLFVREGTTIRSEVVARFTTAVLGGKIDIPTLDGTAVLKIPAGTPSGKVFRLKEKGVPDVHGRGRGDHLVTFHVEVPTKISKKARKLLDDLKAE.................................................. 364
155 0.000e+00UniRef50_A0A1F5BXH8 Chaperone protein DnaJ n=5 Tax=root TaxID=1 RepID=A0A1F5BXH8_9BACT  ali  31  1.........................................................................................MDKDYYRILGVERKATAAEIKRVYRKLARKFHPDLNPGDKTAEAKFKEIQEAYSVLSDPKKKSQYDQFGFIGDQPPPGAGQRTYSPGFGSSSFADFFESLFG--RGAHAAQAGPERGEDLHYTMKIGFEEAISGLQTRIQLTRLVSCPACQGSGHLHSTGKGRCPTCQGSGRAHLQRGSMKFATTCPACQGTGVSRGEDCRDCRGQGVAQKTGLINVKIPAGVDAGSRVRVPGPPGVLYISIEVNPHPHFRREGANILLKVPISVPEATLGAQIEVPTLQGRTKIKIPPGTKSGQKFRLKEMGVTVAGGRTPGDEFVEVAIVPPAAHDQKVRELMKQLAKLSTENPRDKMG........................................ 366
156 0.000e+00UniRef50_A0A2E1N1C9 Chaperone protein DnaJ n=13 Tax=Bacteroidetes TaxID=976 RepID=A0A2E1N1C9_9FLAO  ali  31  1.........................................................................................MKEDYYKVLGVSKSASASEIKKAYRKMAIKYHPDKNPGNKAAEERFKEAAEAYDVLSNPEKKSKYDQFGHQAFQNGGAGFGGMXMD--------DIFSQFGDXXXXXXXQGRRVLKGSNLRVKVSLTLDEICNGVEKKIKVKRKVL---------APGVSFSTCPDCGGSGQVTRVQGRMQTSTTCSRCSGTGQIVDNKPNGADSNGMISKEETVMIPIPAGVVDEMQLKVSGKGGDLLVIISELPHKTLQREGDNLHHELYVSMPDAILGSTKEIETVSGKVRIKIESGMQSGKILRLRGKGVPNINGYGSGDLLVHVNVWTPKTLDKKQRQFFESMKENEHFDPKP--------------------------EKSEKSFFDRVKDMFS. 368
157 0.000e+00UniRef50_T2BPT9 Chaperone DnaJ, variant n=28 Tax=Tremellomycetes TaxID=155616 RepID=T2BPT9_CRYNH  ali  34  32.........................................SLSQHKPSPSLQSFTLRHFGTLLAHPRNPSTASLGW--RRSFHSSAPASAKDPYDVLGINKDASSSDIKKAYYGLAKKWHPDSSK-EKDAKEKFHEIQAAYDILSDDKKRQAYDRYGSASTQEGFDPNFAHGAGGFGGFQGSDLFESLFGGAFGGGSSRQRPVRGDDLEVGVNLSFLEACNGVMRKVTVTPVIDCKTCTGSGLKPGEKKSQCPACRGSGQRTFQVQGMVMASTCQTCGGTGSTIPKRCGECDGVGKVKEKKVLDVEIPAGVEDGMMIRVPGPPGDLLVRVLVKPSSVFRRQGVNLYHDAKVPLHIALLGGVIRIPTLEGDVDVKVKNGTQSGEEAVLKGRGVKSVRRNDRGDLIVGWKVQIPRSLTSFQRKILQAYADDIEGRNPQVHFGPLPSDPPLTSPSSPSKEPTNGETKKE............. 484
158 0.000e+00UniRef50_A0A2D6R8R4 Molecular chaperone DnaJ n=1 Tax=archaeon TaxID=1906665 RepID=A0A2D6R8R4_9ARCH  ali  32  1..........................................................................................MTDYYELLGVKKGATKAEIKKAYKKLAMKYHPDRAPEEKKKEYEEKFINSAAAVLGDEKKRAQYDQFGSAAFEGGAGGSGFQGYDFSDIMSFGDVFDSLFG---GGGRRSTRASRGSDLLYETDITLEDVSSGKEHTIPLNKMESCVTCSGKGAKN---FEECHHCHGTGTVRTPFGLFQQTGACPYCHGKGQLPQDSCSDCSGEGLVRKKKEIDVKIPAGVHHGMRLRVPGEGGDLYVQISVRRHNVFVREDDDLHLTVPISFSQAVLGDSVEVPTINGTAELKIPAGTDSETILRMKGKGLPRLQRSGTGDQMVKVHIEVPKKLSKKQKELVKQLKEEKP................................................ 357
159 0.000e+00UniRef50_A0A0G1D2H6 Chaperone protein DnaJ n=1 Tax=Parcubacteria group bacterium GW2011_GWC1_43_12 TaxID=1618909 RepID=A0A0G1D2H6_9BACT  ali  33  3...........................................................................................KDYYKILGLAKSASPDEIKRAYRKLAQEFHPDK-GGDP---EKFKEINEAYQVLSNPDKRSQYDKFGVNFEQAKAFSSFADAFDFFGGFGFEDIFENIFTAGSNGSFG-----RGQDIGADMEISLEEAYRGVEREISIYRNGVCRECDGSGAKFGSKMKDCVQCRGTGKIEHKGGGFSQIRICPACRGKGKKAEKECEACRGEGRVKEHKKLKIKIPPGIRDGQTISLVGQGGDFYINIHVNPDSRFIREGDNLLSELPISFSQAALGDKVEIPTMDGWLKLKIPEGIESGTMIRLEEKGMPRLHRRGFGDMMIKVKVKTPKRLSKKAKYLLENLKKEIE................................................ 367
160 0.000e+00UniRef50_Q03QU2 Chaperone protein DnaJ n=83 Tax=Terrabacteria group TaxID=1783272 RepID=DNAJ_LACBA  ali  35  1........................................................................................MAQSDLYGVLGVAKDASQDEIKKAYRKLSKKYHPDLNKA-PDAAEKFKEVQDAYDVLGDEQKRANYDQSGSADXXXXXXXXXXXXXXXXXXXXXXXIFNQF-FGGGGGQRNPNAPRPGRDLQYQMDLTFEEAIFGKKTKIKYNREAQCHTCGGNGAKPGTSPVTCHQCGGSGYVTTPLGRMRSQQPCPVCHGTGQEIKEKCPTCGGSGHEEERHEVEVTIPAGVDDGQQMRLQGQGGDLFIIFKVQPSKDFRRDGTEIYFDQDISFVQATLGDDVTVKTVHGDVKLKVPAGTQGGTTFRLRGKGAPRLRGNGNGDEHVTIKVVTPKNLNKGQRDALRDFAKASGESV---------------------------TGSGKGNLFNKMRDKFN. 380
161 0.000e+00UniRef50_Q6A662 Chaperone protein DnaJ 2 n=128 Tax=root TaxID=1 RepID=DNAJ2_CUTAK  ali  30  2....................................................................................STKDWAEKDYYKILGVSKDAKPEEIKKAFRKIARDNHPDSHPGDKAAEARFKEASEANDVLSNAKKRKEYDQFGSAGGFRFPRGGAQTSVNVEDFDGFGDLFGNLFGASGGRRTASRSPRRGADVEGETTISFDDAVSGTTVTMDMVSQAPCQACRGTGARAGTVPRVCSTCQGSGMASSAGGVFEMTEPCPDCHGRGMIVEDPCQVCHGSGRAKSTKSMQTRIPAGVEDGQRIRIKGKGGDLYVKVTVRPHEIFGRDGHNLTVTVPVTFPEATLGAEVEVPTLAGTVRLRIPAGTPNGRTFRVRGRGVPRSDGS-RGDLLATVEIAVPESLDDDARHVVERLRDSLPQATPRPWEVK...................................... 380
162 0.000e+00UniRef50_A0A1F7D753 Chaperone protein DnaJ n=13 Tax=Candidatus Peregrinibacteria TaxID=1619053 RepID=A0A1F7D753_9BACT  ali  34  3...........................................................................................KDLYAILGLKRGATKEEIKRAYRTLSKELHPDRNKDSKESERRFKEVNEAYEVLSDEKKRAMYDQFGTTGGPGGAGGFDFSGFNTGDLGGLGDLFETFFGGGGARRGRREQRG--RDLQIEIEVALTDVVEGIDRSLQLERQRPCKKCGGSGAEEGTKQVTCKECGGTGEITRTFGTFRQAAQCEACGGTGKTHEHPCKNCGGDGRVRSHEPVTIHIPAGMQDGQTLRVRGEGGDLFVTVRIRPDAKFEREGDAIRSTVTIPVTDSLLGTEVPVHTVQGSVTLRVPAGTQPGQVFRLKGKGMPVLNSSRFGDHYVTVNVEIPTKLSKAEQKLVEEWKKMRG................................................ 362
163 0.000e+00UniRef50_D1JCH5 Probable chaperone protein dnaJ n=1 Tax=uncultured archaeon TaxID=115547 RepID=D1JCH5_9ARCH  ali  32  1........................................................................................MPKKDYYEILGVSRDATDKAIKKAYRKLAKQYHPDTYQGDKEAEDKFKAISEAYEVLIDTDKRAKYDQIGSRVADDAFGPEGFDWSHFTHSRDVEDIFGSIFDSFFGGGEGIERAARGADVRLRLDITLEEAARGIAKRIEVPMSRPCKACGGSGTRSG-KATACPQCRGTGQIRQSRGGVITAAVCPQCKGTGRATYDLCEACGGAGTVSTRTKIELKIKKGVSTGYEIRLGGEPGNLYVVLNVLPHPIFKRQGDDLYMKTPISFAQAALGDDVMITTLDGKVKLKIPTETQTNTKLRLRALGMPKLDAVAHGDLYVEVVVQTPRNLTDKQKEQLQQ...................................................... 374
164 0.000e+00UniRef50_D8F5E2 Chaperone protein DnaJ n=1 Tax=delta proteobacterium NaphS2 TaxID=88274 RepID=D8F5E2_9DELT  ali  30  3...........................................................................................TDFYKTLGVSKDASEGEIKKAYRKLARKWHPDINPGNSEAEKKFKEISQAYDCLGNKEKRALYDEFGEDGLQAGFGGQSHGAEGFGRYQSYEDIFGDIFGGMGSSGFRSQTPSRGKDLQHDMTIDLISALKGFETELSMQKAKICGTCGGSGNDPNSKLSTCTYCGGSGRLNVAEGPMHFTKPCPHCQGYGQT-GKPCPTCGGSGQVSGTERIRVVIPKGVKEGSKVRVGGKPGDLYLIIHIKPHPFLTRKGDDLHMDVPVTVREAMAGGTIDIPTVDGTVKLKVPSGSQTGNILRLKGKGATNLKTKTKGNFLVKLVVKVPQTEDPEILAAVQKMDGIYKGDVRS........................................... 373
165 0.000e+00UniRef50_A0A1F3SN95 Chaperone protein DnaJ n=1 Tax=Bdellovibrionales bacterium GWA2_49_15 TaxID=1797384 RepID=A0A1F3SN95_9PROT  ali  31  1.......................................................................................MAAKRDYYEVLGVSRQADAAKIKDAFRELAMRFHPDRNKV-PGAEERFKEIAEAYAVLSDPDKKQKYDTQGFEGV------SDFRPDDLFGGINFDEVFGPLFENFFDRHRFHR--KKGDDLEVVIEVPLAKIMAGGTEKIKVQRREPCESCHGSGAAAGTQPKICDLCQGSGQIVTGHMMFQQISICSQCHGRGEVVERPCVQCSGPGFVTKEKELEVTIPPGVEDGMVLKIAGQPGDLLVIVQTKKDEHFQRSGSDLFYSASIPVWDAVLGSKIQIPTLDDDVIVKIPSGTQSQTSLRVKGKGLPRFQRTGFGDLYVIVEVRIPEQLKAREKELFEELRALNNESDN............................................ 355
166 0.000e+00UniRef50_UPI0007754D23 chaperone protein DnaJ isoform X1 n=5 Tax=Petrosaviidae TaxID=1437197 RepID=UPI0007754D23  ali  28  19.....................................................SSLRPPSRAASSVLRFPRRDRARTHLTAAFGRGSPAAAKDYYATLNLRRDATLQEVKTAYRTLARKYHPDMNK-DPGAEEKFKEISAAYEILSDEEKRSLYDRFGEAGLTGDYGGG----DIGSNGIDPYELFNAFFGGSMGAGRFHYGTKRGLDIRYDLLLSFEESIIGGKREVSIFRYETCGTCHGTGAKSSNDITECTQCRGQGRQRTPFGIVSQISTCLNCDGKGKVITENCTSCCGSGKIQVERNIRVDIPGGIHDGSAIRITRGGGDLYIFVHVNKKEGIHREGLDLFSDVTIDYTDAILGTTVKVETIEGFKDLYIPPGTQPGERLKFAQLGAPDINPTIRGDHNFVINVKIPKSISNQERTLVQEIAAL------KETGCISVPGEETKNRENLGERNSHSSTGKRRSLWRSIRNLF.. 469
167 0.000e+00UniRef50_R6Q7H0 Chaperone protein DnaJ n=26 Tax=root TaxID=1 RepID=R6Q7H0_9CLOT  ali  31  3............................................................................................NYYEILGVSKEATQAEIKSAFRKKARELHPDVNKA-PDAEEKFKELGKAYETLSNEEKRSLYDRYGEEGLSNA--GFDSTGPFDFGFGNINDIFESFFGGMGGFSSSPTAPQRGHDLRLDIELEFEEAAFGVEKEIKIDHLEMCKDCYGTGAEPGTKPSVCPDCNGKGRVRTILGSIQQVTVCPKCGGTGQVIGSPCKKCQGEGRLEVEKAIKVKIPAGVDNNAKIRVAKEGGDLYIVMHVKPHKEFKRDGFNVYSELYISLPQAVLGDNVIVNTIHGEKELVVPSGIEYGKILTIKNAGIPFLHPEKRGDHLVLIKYKAPKSLNEEERRLYKKLFELSENKKPNEKLIDKFKSAIHS.............................. 375
168 0.000e+00UniRef50_A0A1F4DX24 Chaperone protein DnaJ n=2 Tax=Bacteria TaxID=2 RepID=A0A1F4DX24_9PROT  ali  32  2......................................................................................ATTAQRDYYDVLGVARDADGKAIKDAFRKLALQYHPDRNK-EPGAGERFREIAAAYAVLSDPKKRAEYDAHGFAGV------AGFSPQDLFGGINFDDIFGSFGGGLFFFGRRAAGPPRGENIEVELEVPLERVLRGGEEKLRYERPAGCPTCHGSGAKPGTEPRKCDKCGGTGRQVKSQGVMQQVSTCPACAGRGTFIDQRCPECKGSGQVVREETLTVKIPAGIEEGTALRVAGHPGDLFVVVRSAADPRFERMGSELWRMESIGVADAVLGTALKVPTLDDPVTVTVPPGTQPDTVLRLRGKGLPDFGGRRRGDLFVRIKVHVPERPSAEERKLYERLRAL.................................................. 359
169 0.000e+00UniRef50_A0A2P6TDP8 Flagellar outer dynein arm heavy chain beta n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TDP8_CHLSO  ali  28  3.......................AQCVACAARGAASRPAARQQPPRPARASAASAAPSSAFGARSAAAGRRQQRRSLGSRLVVR-----ADRDFYQILGVSRDADKKTIKSAYRQLARKFHPDVNK-EADAEERFKDISAAYEVLSDDEKRGMYDRFGEQGLKGGFXXXXXXXXXXXDFSNPFDIFETXXXXXXXXARSRNRPVQGDDQRYDLRLEFTEAIFGCSKEIEVSRLEDCSTCSGSGVKAGTTSSTCTTCKGAGQVRTPLGMFQQVATCPTCSGTGEQFT-PCGTCQGDGRVRGSKRISLRVPPGVDEGSRLRVRGEPGDLYVFISVKPHPELRREGVTIHSDVEISYVDAILGTTVKVTTLGSEVDLKIPAGTQPGTTLVMSKRGVPKLGSNARGDHLVHVKVKIPKTISGEERKLMEQLRELQGAKPASRGCPPSLAPRTMEPVGAEGQQQHEH.................. 462
170 0.000e+00UniRef50_A0A0S8BTD4 Chaperone protein DnaJ n=4 Tax=Bacteria TaxID=2 RepID=A0A0S8BTD4_9DELT  ali  32  1........................................................................................MTKPDYYEVLEVSREVTTTELKRAYRKKALEYHPDRNPDNPEAEEKFKVCAEAYAVLSDPQKRQMYDRF--GHAGLGGAAAPGFGDIGDVFSQFQDIFGDLXXXXXXXXXXPNAPMRGADVRTDLRLSLREAAFGTTKQIDLSHPSPCEACRGTGAE-GGELVACTTCGGRGQVARAQGAFVLSTTCPTCRGRGMQAKAACAECHGAGEVQTERVVKINIPSGVDTGQSLRLGGPAGDLYVTVHVDRDDVFERQGFDLVHRLSVTYPQAALGAKIEVPAFEEDQELKIPSGTQPGETLTIRGGGVPRLNGRGRGDLLCVVEIEVPKHLTREQKRLLKDLSRTFEPS.............................................. 364
171 0.000e+00UniRef50_A0A2N3H0K5 Chaperone protein DnaJ n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3H0K5_9ACTN  ali  33  1........................................................................................MASTDYYDVLGVSRDASAEEIKKAFRTKARETHPDVSDGD-NAEEEFKRINEAYEVLSDDQKRSNYDQYGTADPRQAGYG-----DMGDVFGGFEDIFS-VFMGGMGGMGQQRVRLEGRDMRGQTVITLQEAATGVEKDVPLNRVGPCDTCNASGAAPGGSVKTCPECNGAGQRRTQRGVMESVTPCERCSATGKIAEPPCPTCGGEGRTRVSETVRVSVPAGVSDGATLRVPGKPGDLLLTVRIAPHEYLHREGDDLHAMAAINIAQAALGGTINVPGLFGDQAVEFSAGVQSGDTVRVRSSGMPRMRG-GVGDLIVHLRVDVPKKLNKKQRELLRELGESLGTGKGGPTKLERLKD.................................. 363
172 0.000e+00UniRef50_A0A0C7CCJ9 Putative Proprotein convertase PC7 n=1 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0C7CCJ9_9FUNG  ali  34  3..............................................................................QKRCFHATAPSAKRDPYEVLGVKKNATASEIKKAYYALAKKYHPDTNK-DKDAREKFVQIQEAYEILSDDEKRKQYDQFGHGFDGGGMGGGPGAGSGFPGGFDPNDIFSQXXXXXXXXXXXXGRPSAGDDIQIPLTLSFMEAVKGATKYVQVNRVTDCQSCRGSGVRPGKSKETCKVCHGAGVQTIMMGGFGMQTTCQACGGEGSSIPPGCPACNSMGKVRERKTVQVTIPPGVDQNSRIRVSGEGGDLFVTLNIQPSKIFRRQDSDVFVDAKIPFYKAMLGGRVRIPTIDGDVELKIPSGSQPGDNIALRGRGIQRFRGTTRGDQIVTLKVELPRSLRGRQKEIIEEYASLVDEEYRPKDNPIRNPNPSPDTPPPSPKMSPQDA................. 407
173 0.000e+00UniRef50_A0A137PBJ9 Uncharacterized protein n=1 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID=A0A137PBJ  ali  31  15........................................SKLSKNTLNGCVKGYNSQNCNILSKAGSGL-----NFGQIRQFHNTNTNLKQDYYDTLGVKKEASQSEIKKAYYQLAKKYHPDTNKGDDKAKEKFLKIQDAYETLSDNQKRAAYDQFGHGGGNSXXXXXXXXXXXXXMGFDPESIFSQGGGFGAGKGSRSGFVMPGEDIQVSISLSFMEAAKGCTKKVHVQPLSKCEPCKGHGTKEGKKPTTCYVCKGSGQEIFNTMHGMLARTCGTCGGSGTYISDQCGTCDGLGRVRKSEYVDVDIPAGIDNKVRMVLQGPAGDLYIVVNVQKSKIYSRHGQDLHVNAQVPFHVAALGGFARIPTIDGDVEIKIHPGTQTNDEMVLKRKGLSKPQSHNRGDQYVHVHITVPKSLSLEQKRILEDFAVSVDSKFKRTTPGPSFNNNPEDTVEESEHKEEGSEDKKKSGFFGKI---FGS 473
174 0.000e+00UniRef50_A0A2N9LQ77 Chaperone protein DnaJ n=7 Tax=Acidobacteria TaxID=57723 RepID=A0A2N9LQ77_9BACT  ali  30  5..........................................................................................KHEYYETLGVARKASTDDIRKAYRKLARKYHPDLNPGDKSSEERFKNVQEAYDILSDPKKRQMYDQFGFAGPQTSHPGMDFSGFDFSDFGGFRDIFSQFFGG--RGEAQQQPAEKGGDLEYVMHIDFWQAIKGTQARLEITRYEVCDTCHGSGT-SGGGEVTCPQCKGSGNVSQMAGAMKFNLTCPRCGGAGKL-RNSCPTCGGEGRMPRTESVDVRIPPGARSGSRLRVPGPPGDLYITTQVEEHPFFKREGDNIEIQVPIAVWEAALGAKIEVPTIDGRTLLKIPQGTRNGQRFRLREKGVMNSRTNVRGDQIVEVGIEAPDPRDERTRELLRELSKVQPEDPR............................................ 389
175 0.000e+00UniRef50_A0A2T2QYZ3 Chaperone protein DnaJ n=1 Tax=Parcubacteria group bacterium SW_4_49_11 TaxID=1919225 RepID=A0A2T2QYZ3_9BACT  ali  36  1........................................................................................MANRDYYEILGVSRDASEKEIKKAYRKLAHKYHPDKEGGD---EDKFKEINEAYQVLGDQEKRKQYDQFGTAGFQGGAGGQGGTGGFGGAGMNFEDLFEDIFSEFFGGAGGGQRSARGRDMQTEVELTLKEAHEGVKRTMTIHKTSACDRCHGSGGDPDANWQTCSTCQGAGQVQTMLGNFVEERVCTTCNGQGKIPDKKCTQCNGSGTVTGPEEVEIEVPQGIQDGQTIHVPGKGGDLYVNVRVKNDTTFRRDGDDLYMDRRVPFTTLVFGDKVNVATLDDSIRLKIPAGTQSGERFRLSGKGMYRLYGRGRGDVYVTVRAETPDNVSKEVKKRLKELQE................................................... 366
176 0.000e+00UniRef50_K9VG11 Chaperone protein DnaJ n=7 Tax=cellular organisms TaxID=131567 RepID=K9VG11_9CYAN  ali  35  4............................................................................................DYYEILGVSRSADKEEIKRAYRRLARKYHPDVNK-EPGAEERFKEINRAYEVLSEPETRARFDRFGEAGVSGAGAPG---------FQDFGDSFADIFESFFQGFQGGSGPVRGDDLRLDLRLDFREAVFGGEKELRIKHLETCETCTGTGAKPGTRPQTCSTCSGSGQVRRPFGSFTQVSVCPTCNGTGQVIEDKCETCGGRGQKEVMKKLKITIPAGVDNGTRLRVGGPPGDLYVFLAVNEDPLFKRDGTSVSSEVKISYLQAILGCRLEVETVDGPTELVIPSGTQANTVLTLEKKGVPRLNPVSRGDHLITVSIDIPTKVTAEERELLMQLAKLKGDRTGK........................................... 363
177 0.000e+00UniRef50_L7J6T2 Chaperone protein dnaJ n=2 Tax=Magnaporthe oryzae TaxID=318829 RepID=L7J6T2_MAGOP  ali  34  325............................................................................HVSVKAFHATSRAAHKDPYKVLGVDKTASASDIKKAYYGLAKKFHPDTNK-DPTAKEKFGEIQSAYEILSDATKRQQYDQFGAAGFDPNQGGGDPFGGGNPFGINMEDLFSAFTGQKGXXXPFGPQTVVGDNIEVQASISFAEAAKGTSKTVTINPLVSCKTCKGSGLKAGAQRTTCKTCQGTGRVHTINGGFQISSTCTKCSGTGSVTPSDCGTCHGDGVTRERTTIKVDIPGGVEDGMRLRVDGEGGDLFLLVRVQADPKYKRTGSDIVYTATIPLTTAILGGEVKIPTLDGDVNVKVATGTNTGDIITLSGMGMKKLGSRGKGDLRVEFKVAMPKYLSANQRTIVEMLAEDMGDKTAKRIMNFKMPSSTNDAD-----------SHQNEGFLKSIWHNLTN 768
178 0.000e+00UniRef50_A0A2M6WKK0 Chaperone protein DnaJ n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M6WKK0_9BACT  ali  28  1.........................................................................................MAKDYYEVLGVDKKASSETIKKAYRKLAHKYHPDKADGD---EARFKELNEAYQVLSDSNKRAQYDQFGSSFSQGAGFNPGGFNINMDDLGDFSDIFEQFFSG----GRARRTYNRGNDLQIAQEITLEEAYTGVKREIEFHALTRCEGCSGLGYFDKDGTKDCVKCDGKGEVKEVFGSFAQVRVCSDCNGRGKIPNKPCKDCHGSGRINSNRKIKVDIVPGINDGQLIKVTGAGGDLYVQVRIKRHELFVRKEDDLYTKKKISLIDVLLGKDIIIKTIDSKETIEIEPGSHLNEMILVKAKGMPRLHGSGQGDLYIKLDVTTPKKLSKKAKQLIEELKKEYE................................................ 350
179 0.000e+00UniRef50_D5GE67 Uncharacterized protein n=1 Tax=Tuber melanosporum (strain Mel28) TaxID=656061 RepID=D5GE67_TUBMM  ali  32  6............................PVLPRAVRVLRTSSNPITNFRCSYAPTLPR---------SLPVPRNSNHSPRRSFHSTSQASVKNPYSVLGLDKNASTSAIKKAYYSLAKKWHPDQNK-DSSAREKFQEIQSAYEILSDPEKKEQFDQYGEAAFKPSAGFNPGTGAGFGQSGSFEDLFSAFGGSSGRGTSGSEGGPFGDNIEVETTISFMEAAKGVSKDIHIHAYLPCKTWAGTGMKSGTQRQPCGRCGGTGRVHFMQGNFQMASTCDACKGAGVVIPSECGTCDGWGVTKEPRTITIDIPAGVDTGMRIKVDNEGGDLFVHLRVAPHKYFRRKGLDVYYTATIPLTTALLGGRIRVPTLSGEEDIEVPLGTTTGDTTKIYRKGMRGFDSVSVGNFTVEFKVNPPKTLTARQRILLEMLAEELDDKTRRIMGVNSEKQGPSPYEQHKNENFIKRAWH............... 466
180 0.000e+00UniRef50_A0A1G2BFY5 Chaperone protein DnaJ n=6 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1G2BFY5_9BACT  ali  31  1.........................................................................................MAKDYYNILGVAKDASPEEIKKAFRKLAHQHHPDKEGGD---EAKFKELNEAYQVLSDTKKRQAYDQFGEAGVNEDMMRQSGNSGGPGVEFDLGDILGDFFGN--GRRRGSRQKQGGQDIQMDMEIDFIEAVFGIKKTVELYKTEKCGHCHGNGAEPGTPIKECKTCQGKGTVQTMIGNIRTQAVCPGCQGEGKIAEKKCAQCQGGGVEKKQVQIEVSIPAGIDSGQTIRLEGKGGNLYLNIYVRKSAEFERQEDNVLSTIKVPYEIFVLGGKVTVKTLDGEAEMKVPSGTESGKLMRLRNKGIPHLQASGRGDHLVKLEVDIPKHPGRKYKKLLKELSE................................................... 365
181 0.000e+00UniRef50_A0A0S6VQY4 Chaperone protein DnaJ n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0S6VQY4_9BACT  ali  31  6............................................................................................NYYKILGIPEQADDTEIKSAYRKLALKYHPDRNAGDKFAEEKFKQVTEAYRVLSDEKKRAEYD-LGRS-PSHQESRAASARNKHANFDEVFDIFDNVSSSKTSSSHKKRQQVRGADLTHELSISFEEAALGTTRVIEVTRMEQCLRCRGTGIEPRTYPMLCPACLGKGRIRQSHGFLGFTQVCQECNGSGRVYQKDCAECRGDSRLPQTRKISVRIPPNVHDGASLKVAGEGGDLLIHVHVEPHEFFGRKDNDIWCEVPLTITQVVLGDTIEVPTLEGKVRIRVPAGTQPDRIFRLAQKGVPSQADGQRGDLFVKVKLQIPTEVTPRQRQLLEEFGRLSGERS............................................. 356
182 0.000e+00UniRef50_D1Y5R0 Chaperone protein DnaJ n=5 Tax=Synergistaceae TaxID=649777 RepID=D1Y5R0_9BACT  ali  31  6...........................................................................................RDYYEVLGVARDATTVEIKRAFRLKVRDCHPDTHPDDPEAEQKYKEINEAFSVLGNQEKRQRYDRFGTADDTGNPFAGAG----------PEDIFGDLFGSMFGGRSRPNAPARGSDLQMVLSITLEEAATGVAKRVAIPRWEPCDHCHGSGSEPGHEPRECPTCHGAGEVRTRFGDTLSVSTCPTCGGRGTVVEKACTECGGEGRIHRRREQEIKIQPGVDTGTRLRVPGPPGDLYIVMQVRDHPLFQRDGNDLHRTVSIPFPLAVMGGPSTVGTLDGDVSFDIPEGTAPGQTIRVKGKGMPRLRGSSRGDLFLHVTVDVPKGLSERAAELVKQLAEEMDVATGEKEGLFDKLFGN................................ 372
183 0.000e+00UniRef50_A0A0G0SC61 Chaperone protein DnaJ n=71 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0SC61_9BACT  ali  31  1.........................................................................................MAKDYYETLGVSKGASKDEIKKAFYKLAHKYHPDKKEGN---EAKFKQVNEAYQVLSDDTKRSKYDQYGAGFFSGFGDFSAKGGSAFGGDFNLNDIFSDFFGGGMSGDRREQ--KRGRDISTEINISFSDSIFGANRQILITKTSSCFTCHGSGAKAGYSMVSCKTCNGQGKIRTIFGNISSAKICETCLGAGEVPKEVCETCKGKGVLRREEEISIIIPAGIRDGEMIRMTGYGGDLYIKINVTPHPVFKRDSNDLVMNLNLKLSEALLGAEYPIQTLDGEIQVTIPEGVSINEILRVRGKGVPT-GKNKRGDLLIKLNIKLPSKLSRKSRELIEQLQKE.................................................. 368
184 0.000e+00UniRef50_M2M9U6 Uncharacterized protein (Fragment) n=13 Tax=Pezizomycotina TaxID=147538 RepID=M2M9U6_BAUPA  ali  33  1................................................................................RHFHASTSFATKDPYKVLGVESGASAGEIKKAYYGLAKKYHPDTNK-DPKAKERFADAQSAYELLSDDKKKAAWDQYGAAAFDQGAGFDPSGSGGFGAEFNFEDLFSAFXXXXXXXXXXXXSAPFGENIEVQTNISFMDAAKGVQKDIVITPLVQCKTCTGSGLKKGISRSSCKSCDGTGTVHFMQGGFQMASTCSTCGGTGVQIPKECGTCRGNGAVRERRTVTVDIPGGVEDGMRLRVMGEGGDLYVFIRVSPDSKFSRNGSDVLYTASIPLTTAVLGGEISVPTLEGEVKVKVATGTGTGDKITLPGMGMKKLRRGNNGDLRVEFKVQMPKYLSVNQRTIVEMLADEMGDKSAKR--VMNLNQFKQEPPSSSPKQGQNADEHKNEGFLKNMWH.... 445
185 0.000e+00UniRef50_A0A0G0VDS8 Chaperone protein DnaJ n=107 Tax=root TaxID=1 RepID=A0A0G0VDS8_9BACT  ali  34  3...........................................................................................KDYYKILNVDKGASKDEIKKAFRKLAHEHHPDKGGD----EAKFKEVNEAYQVLSDETKRSQYDQFGSNFDQAGAXXXXXXXXXXXXXVNMDDL-GDMXXXXXXXXXRQRAQAQGQHIQVDLQLTFKEAIFGTEKEIQITKNSACDRCGGVGAEPGTSMKTCDACAGSGVQQTILGSIKTRTACESCHGQGEIPNTKCSTCNGSGIEYKKKSLRVEIPSGVESGMKIRVRGQGGDLYVVLYVKTDPRFERIGENIYTHHKIGFTQAALGDEIEVETLDGRVKLKVPAGTQSGDKLRLRGKGVPRAR--ARGDMIVVIQIVTPRKVSRKEKKLFEEL..................................................... 346
186 0.000e+00UniRef50_A0A2N1J9T9 Uncharacterized protein n=1 Tax=Malassezia vespertilionis TaxID=2020962 RepID=A0A2N1J9T9_9BASI  ali  32  180..........................................................................................AKDPYGTLGVSRDASTKDIKHAYYQLAKKYHPDTSK-EPSAKERFVSIQNAYDILSDEKKRATFDQFGSADGPAPGSGGPFSGFSGFQGGNAESIFESLXGAGFGGRAAQPGFARGDDIDATVNLTFEEAAKGTSKNVVINPIEICGTCHGDGLKQNAKRTTCQVCHGTGTRTFVQGGFQMASTCPACHGQGTVVADECASCHGSGRVRKKRTVNVRIPAGVDDGYRIRQEGSPGALYVRIHVAPSRIWRRQGNNLFYPAHIPFYTAVLGGKVRVPTLDGEVDVRVPAGTQVGEEMVLRGRGIPRLGSDTNGDLMVQFDVTIPRSLSKRQKELLQAFANEYEGKTVQEQEKKADAEPAPEPEPKKRDVKKAKYDTDRE............ 599
187 0.000e+00UniRef50_A0A1Q9N0V3 Chaperone protein DnaJ n=1 Tax=Candidatus Lokiarchaeota archaeon CR_4 TaxID=1849166 RepID=A0A1Q9N0V3_9ARCH  ali  31  4.........................................................................................KKRDYYETLGVAKDANDDDIKRAFRTLAKKYHPDLHPDDKTAEEKFKELQEAYSVVSDPEKRQRYDQLGFAGVEGTVDISGNGFNFSDLFGGIGDIFGSFFGGGRNRGGGRQQPRQGEDVEKEVHVTLEDTVFGTKREVKFKRAIPCSHCNGIGAEPGSDVKKCPQCKGQGQVRQVFGTQVYITTCPQCRGEGKTFDKPCTACKGRKIEFEERTVNINIEPGIEHGTILKAPGMPGDLLVGILVEPHSIFGREGNDLYCMLEIDFVTTIFGGEVDCPVIRGGIKLRIPPGTQFATELRVRDEGVPYLRSSQKGDMYVKLKILLPKDLTKDQTVLLKRFQDLYHGKK............................................. 367
188 0.000e+00UniRef50_A0A1G1X203 Chaperone protein DnaJ n=5 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1G1X203_9BACT  ali  34  4............................................................................................DYYETLGVSRSATQDEIKKAYRKLAHKHHPDKGGGD---EEKFKEINNAYEVLRDAKKRSQYDQYGHGFDGSGPGPAGGFTINMDDLGGMGDIFESVFGGSNRGRSARRSRG--SDIESNIEISFRESATGVTKTVQQRVYDTCSKCHGNGAEPGTPITTCTTCNGAGSTQTPLGTFAQRVACQACRGEGKIAKTPCTTCHGEGREKMNRTLDISIPAGIADGQTIRVTGKGGDLYVNVHVQTDRNLARDRDNVRSQVAISFIDAALGAEKLVEMLSGAKTIRIPAGTQPNAEFRFEREGFPHLQSSGKGDHIVTVKVEIPKKLSKKQRELLEQFREAPKKK.............................................. 364
189 0.000e+00UniRef50_A0A067NRF2 Uncharacterized protein n=2 Tax=Agaricomycotina TaxID=5302 RepID=A0A067NRF2_PLEOS  ali  35  16.........................................................................................AAKDPYQVLGVKKDASQAEIKKTYFSLARKYHPDTNP-DKSAQAKFLEIQEAYDILKDEQKRASYDKYGAASQQPGFDPNAFSGFGGGGFQDXSDLFSQLFGAFGNGPGFGEASTRGADLEATIGISFLEACKGTVRKVNVSPVVNCNTCTGTGLKKGAKRTTCRTCNGTGTRTFVISGFRMASTCPECSGAGSSVPGECTVCHGVGKLRMKKSVQVDIPAGVEDGMTIRIPKAGGDLLVRVNVAPSKVFVRQGANLYHKAKIPLHTALLGGRVRVPTIDGDVDVRVPGGTQQGEEMVLKERGVASVYGGDKGDLFIAFSVQLPRSLTPRQRELLQAYAD---DVEGRVPHKETVVDPPNKGPIHEDEDPSADQSEEERG........... 417
190 0.000e+00UniRef50_A0A1G1EX04 Chaperone protein DnaJ n=1 Tax=Nitrospirae bacterium GWB2_47_37 TaxID=1801692 RepID=A0A1G1EX04_9BACT  ali  30  2.......................................................................................SAAVKDYYKTLGVAKNDSQDDIKKAYRKLARKYHPDLNPGDKSSEEKFKEINEAYAVIGDPQKRAEYDRAGTTFEQFGGFEGFGGFDSGEAF-DLGDIFGNVFGTRFG---AERHYARGENILIGVELTLEDAFAGATRPITITRTMNCDACGGSGAES---WQTCPACKGTGRVQAAKGFFKIAQTCHECGGTGKKITSVCKKCGGRGKTVYTDTTKVKIPAGVDHGSIVKLRGIGNDLHIEISIKPHPVFKRKGDDIYVQIPVTFGEAALGAKIEVPVIDGATMMKLPAGTQGGQRFKLSGKGFISPRSKQRGDEYVEIEIAVPKDVPEKAKEAIKAIESLYKEDPRK........................................... 353
191 0.000e+00UniRef50_A0A1Q7RF32 Chaperone protein DnaJ n=7 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7RF32_9BACT  ali  33  3............................................................................................NYYDVLGVDRKARLADVKKSYRKLARKYHPDLNPGDKRSEERFKQISEAYDVLSDPEKRKKHDQYGEGFAAGAEGPFRGSGPAADMGFDFGDLFASFFSEILGRRDGDTAPRRGEDVTHALNVGFFDALRGLTTELTIDAETACPRCNGSGTVPSRARRPCPDCAGTGRISHVSGALRFATTCRRCGGQGSLGSEGCGNCRGTGVLRRRETIKVHIPAGVDNGSRVRVGGKGGDLYIVTNVGPHPFFRRIGDNIHCTVPITVSEAALGSRIDVPTIDGSASVKIPPGTASGQKFRLRGKGAPLLRGSGRGDQYVEVQIVTPRANDEKSRQLLRELGALTPGEE............................................. 368
192 0.000e+00UniRef50_A0A135VD72 Uncharacterized protein n=2 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A135VD72_9ARCH  ali  34  1........................................................................................MASDDYYERLGVGRNATPEEIKKAYRALAKKYHPDRNPGNQHAEETLKGINEAYEILSDPEKRANYDRWGTADFQG------------INMDGFGDIFSEIFRGFSGFGDFGFGPPPGQTLRVTIPLSFEDAFFGVEKEIAFNRMIHCESCRGSGASAGSSPRACPTCRGRGQVMRSMGGFMVSQTCPSCGGVGEVIDTPCKECSGKGLQKERREIKVPVPPGVEDGQALRIRGGGGDLILVFAVEPHDTFIRKGLHIYMEMEIPFSLAVLGGEVEVPTMRGMSKMKVGKNTQGGTIFRMKGKGVYSDDGR-KGDQLVRVVIHIPKKLTKEQKKYLDKFDSVFD................................................ 347
193 0.000e+00UniRef50_A0A2N2F1B8 Chaperone protein DnaJ n=1 Tax=Elusimicrobia bacterium HGW-Elusimicrobia-1 TaxID=2013763 RepID=A0A2N2F1B8_9BACT  ali  33  3...........................................................................................KDLYEILGVKKTASLDEIKQAYRSLAIKFHPDKNPGDKSAEEKFKEINAAYEVLADAKKRDLYDRMGPAAFTGGGAAGQGGYADGVDFGDISDLFGDVFDGGRSFRYKRQRAERGVDIRIGIELALRDALSAVEKHLEVPRMEPCAACRGTGAKGGAAPRTCRDCGGRGQVVSSRGFFTYASPCPECGGKGTVIDEPCTSCRGTGLERRLHKITVKVPAGVADGTVLKIAGYPGDLYISIRLRKDPQFDRQGDDVIFETHLHYHQFVFGADIEVPTLEGTATVKVPPSTTPGTILKLKDHGIPHLGRRGRGDQLVKLKLKMPQNMSERQKLYLRQYAQSLAE............................................... 363
194 0.000e+00UniRef50_A0A2A9NLK4 Uncharacterized protein (Fragment) n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NLK4_9AGAR  ali  35  4.......................................................................................SAAPKDPYQVLGVKQDASQAEIKKTYFSLARKYHPDTNP-DKKAQEKFLEIQEAYDILKDEKKRADYDKYGAASQQQGFDPNAFSSFGATGRGDPSDLFEQLFNFGGGRARGSSDSMRGADLETTVNLSFLEACKGATRRVNISPIANCGTCSGSGLKKGAKRSTCSACGGSGHRTFVINGFQMASTCNACGGVGSTVPRQCSSCDGVGRVQVKKTVTVTIPSGVEDGMTVRVPGQTGDLLVRVNVAPSKLFVRQGSNLYHKAQIPLHTALLGGRVRIPTLDGEVDVRLPGGTQQGEEMVLKGRGVPALHGST-GDLFVTFMVLLPRSLSKRQRELLQAYADDVEGRTPPATTKKESEDSRSDSDSENGRAPFIDTS................ 415
195 0.000e+00UniRef50_Q7V9C8 Chaperone protein DnaJ n=41 Tax=Cyanobacteria TaxID=1117 RepID=DNAJ_PROMM  ali  31  3............................................................................................DYYDLLGVSKDADGDTLKRAYRRLARQYHPDINK-DPGAEDRFKEIGRAYEVLSDPQTRGRYDQF-----GEAGLGGAAGMPDVGDMGGFADLFETFFSGFGGARPRRRGPQQGDDLRYDLKIDFEQAVFGQEREIKIPHLETCDTCNGTGAKVGSGPTTCSTCGGVGQVRRPFGSFTQVAECPSCEGTGQVIADPCPACAGQGVRQVRKKLRINIPAGVDTGTRLRVAGEGGDLYVFLTVKSHPQLRRDGITVLSEVNVSYLQAILGDIIEVDTVDGNTSLEIPAGTQPNAVLTLENKGIPKLNPVARGNQRISINVKLPIRLSDEERGLLEELA.................................................... 352
196 0.000e+00UniRef50_A0A2E1E3F5 Chaperone protein DnaJ n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A2E1E3F5_9CHLR  ali  30  3.........................................................................................SRRDYYEILGVGKTASSEEIKKAFRKLALEYHPDRNK-DKDAEKKFKEVNEAYQVLSDPEKRQSYDQYGHDGVKGN-----FQDFDLSNFGGFGDIFDAFFGES--RSQRTSSRRKGRDLHKEVAITFEESAFGTEKKISIERVSECKNCSGTGAKDGSSLDTCSSCKGSGQIKRVQGQFAQSGICGDCSGRGKIIKEKCSSCSSKGAILEKKDIXVNIPEGIEPERIIRLPQEGGDIYLKVDVXDHEYFSRKGRNVYLTVELDVFQAMLGDNLEIPTLEGFLKVKIPPGTQNGDLIQLKGKGFTDIGDKSRGSQINVMKVTIPKNLSNDQKEKAEELKTLLSEKNKEKS......................................... 359
197 0.000e+00UniRef50_Q27237 Protein tumorous imaginal discs, mitochondrial n=281 Tax=Protostomia TaxID=33317 RepID=TID_DROME  ali  47  11......................................FRQLPAVRRCLAAAAFSTPRATSYRILSSAGSGSTRADAPQVRRLHTTRDLLAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDTYGQTAENIGRQGGGSQSWQFRSSIDPEELFRKIFGEGNFRTFADSKFGFGQAQEMVMDLTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGRCQYCNGTGFETVSTGPFVMRSTCRYCQGTRQHIKYPCSECEGKGRTVQRRKVTVPVPAGIENGQTVRMQVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVYEDQWINVEPGTSSHHKIMLRGKGLKRVNAHGHGDHYVHVKITVPKKLDKKRLALIEAYAELEEDTPGQIHGIANRKDGSKQATAGASEEP..................... 452
198 0.000e+00UniRef50_A0A2R6K211 Chaperone protein DnaJ n=2 Tax=unclassified Halobacteriales (miscellaneous) TaxID=38063 RepID=A0A2R6K211_9EURY  ali  33  3...........................................................................................EDFYDALGVSRDASEEEIQEAYREKAREYHPDVS-DDPNAEEKFKQAKKAKEVLTDDEKRRMYDQMGHERFEQADKRGAXXXNPFGDVGGMNDIFDQFF-GGGGGGRDRNAPRQGQDLRTRMTVSLEAAYEGISRDFSLTRPEACSDCDGAGHPPDADSQTCPECNGQGQTTRVQGRVQQTQTCRRCEGDGILYEETCSTCGGDGRVQREATLQVDVPAGIEDGQTLRMGGEGGDLLIEVRVEPHPDFERDGDDLRFDAAVSFPQAVFGDAIEVPTLDGNVEMELDAGTQSGETFRLRGKGMPRLRGRGHGDLYVTVQVVTPSDLNEEQRSA......................................................... 360
199 0.000e+00UniRef50_J3LLI0 Uncharacterized protein n=12 Tax=Poaceae TaxID=4479 RepID=J3LLI0_ORYBR  ali  27  2..................................AAALFVAANSNPTPNPAPSLHPQQRAVCC--VLRFPRRARARTHLTAAFGRGSPVAAKDYYATLNLRREATLQEVKTAYRTLARKYHPDMNKS-PGAEEKFKEISAAYEILSDEEKRSLYDRFGEAGLSGDYGGG----DIGSHGIDPYELFNTFFGGSFGDSMGPGRFNRALDIRYDLLLSFEESIIGGKRGVNIFRYETCGTCDGSGAKSSNDITECTQCRGQGRQRTPFGIVSQISSCLNCDGSGKVITEKCTSCCGSGKVQVERNIRVDIPGGIHDGSAIRFTGGGGDLYIFVHVNKKEGIHREGLDLFSDVTIDYTDAILGTTVKVETIEGFKDLYVPPGTQPGERLKFPQLGAPDIKKPTRGDHNFVINVKIPKTISNHERALVRELAALKGTGGISVPGEETANGG------NLRERDLHSSIGKKRPLWGSIRNLF.. 462
200 0.000e+00UniRef50_Q1IT18 Chaperone protein DnaJ n=53 Tax=Bacteria TaxID=2 RepID=Q1IT18_KORVE  ali  30  4.........................................................................................QTKDYYGALGVKKNASAEEIRKAFRKLARKYHPDVNPGDKKAEDKFKEISEANEVLSDPKKRKIYDQLGFAAQGGQDIPFDFSGFDFSGGGGFRDIFSSLFGGGRGGHEERPRPQAGTDLEYQVNVPFWDAIRGTTVKLNIQRREVCSNCHGEGEIGGT--HTCPQCHGKGKIETGGGPMKFNVTCPTCHGTGK-ARTQCPVCHGEGAITRNEPLEFKIKAGTRDGQRIRLAGRGGDLYIIVKAGEHPVFRREGDDVYVTVPVSAVEAALGTKIEVPTIDGRALLKIPPGTNSGQKLRLREKGVPNADGTKRGDEIVEVKLIVPKVSDERSKEILRELQKLNPEDPREE.......................................... 396
201 0.000e+00UniRef50_A0A0G0RJA2 Chaperone protein DnaJ n=17 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0RJA2_9BACT  ali  30  1..........................................................................................MKDYYKILELEKGATKEDIKKSFRRLAHKYHPDKTGGDDV---KFKEISEAYQILSDDQKRQQYDMYGNADFNTGGQGGPFGGFDFSGFFDLGSIFGDFFGGAG------RQARRGRDISVDIQVTFAEAIFGIERKILINKTSRCDSCVGTGAESGSKTKTCPTCNGKGKIQESQGTFATTKDCSKCHGSGQVPEKVCHTCHGDGVIKKQQEITVGIPAGIEAGQMIRLSGQGGDLYVKVHIERHPTWLRQDANLTTTIKVKLSEALLGSDYKLKTLEEELTLKVPAGTNNGDVLRLKGKGVP-IRAGRRGDALIKVQVVMPARLSKKAQKLIEELKDE.................................................. 356
202 0.000e+00UniRef50_L1IHL1 Uncharacterized protein (Fragment) n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1IHL1_GUITH  ali  35  1...........................................................................................KDLYEVLGVPKSASSQEIKKAYFQKAKKLHPDVNKEDPKAQEKFSELNNAYEILSDEQKRRMYDMGGMDNAAGGFGGFEGFQGFQNFGGDPMDIFEEL-SGMFGGRKNSRRRGAGKDVHVQIDLSFMEAAKGCSKTIRVRKKDTCKPCNGEGAEPGTKRRTCPTCRGTGEVMTAMGFIQVQSVCSTCNGEGSTVDTPCKRCRGSGKVEAEEEITVQIRGGLDPDVRLRMPGPPGHLYISVNIKSHPFFWREGADVHLEYPLSVSQAVLGCKIKVPTLEKEQEIALPAGIQPGSTRVLTGHGARHMDGNRFGNLVVHFKVVVPKNMTEKQKEMMKQFAEEE................................................. 352
203 0.000e+00UniRef50_E5DVR0 Hsp40-like protein n=1 Tax=Brachionus ibericus TaxID=183141 RepID=E5DVR0_9BILA  ali  48  57..........................................................................HSTKLKNFFISNNLQAKKDYYQILGIPKTASPKIKKKAYYQLAQKYHPDKTAGDKT---KFQEVSEAYEVLGDEKKRQEYDTFGMAGNGMGNDGQAGFGGHYQSQVDPEELFRTIFGDAFKRGRFGAGADSGPQYEVALDLSFEEACRGVNKELNIRVLDTCKSCKGTRCAPGHKPVKCKQCNGTGMESIQTGPFFMRTTCRACYGHREVISKKCIECAGKGQTYQSKRVNVPVPAGVEDGQTMRMNVGKQEVYITFKVTPSKIFRRDKEDVHSDVSVSISQAILGGTIKVTGIYDDHQLRIPAGTQSHERFRLSGKGIKRIHSSGYGDHYVYIKIKIPTKLTKEQQALIKTYAETDSDVNGSVEGLTKTTNGKKE.............................. 443
204 0.000e+00UniRef50_A0A0G0YD17 Chaperone protein DnaJ n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0YD17_9BACT  ali  31  1........................................................................................MSGKDYYQSLGLERNASPEDVKRAFRTLAHKYHPDKPGGN---EEKFKEINEAYQVLSDPEKRQKYDQFGSGAFDGGFQQNGFDFSGASGFGDLGDI-FGDLFGFGGGTRQGSRVRKGNDIEMDVDLSFKESIFGIRKDIHVQKICACEHCHGTGSEPGAPVDTCKTCGGSGVQRTLFGAMQARVVCESCHGEGKIPTKPCGSCHGQGVVRTKRNLSVDIPSAVEDGSILRLRGKNGDLFLRLHVKSDVRFEREGMQLFSTVHIGFTQAVLGDSIDVETIDGSVELEIPAGTQSGTEFRLRGKGVPH--GNRRGDHIVTVQLSTPRHVSKRERQLLEEL..................................................... 350
205 0.000e+00UniRef50_A0A2H0BRS2 Chaperone protein DnaJ n=1 Tax=Candidatus Uhrbacteria bacterium CG22_combo_CG10-13_8_21_14_all_47_17 TaxID=1975041 RepID=A0A2H0BR  ali  32  1....................................................................................MTSPIMPKDYYATLGVSKEASEDEIKKAYRRLAHKHHPDKGGD----AAKFKDASEAYEVLSDKQKRETYDRFGSAAFEQGAPGAXXXXXXXXDFGDLGDVLGEMFG---FGGTRSRRERRGRDLEVAVELSFKDAAFGTKQEIRLYKQDVCSHCKGTGGEPDAKMNTCSECQGRGQVRTMFGTFQSAVTCPSCHGRGKKPDKVCTRCQGNAVERKEETLAVEIPPGMETGSVLKVPGKGGDLYVKVRVKPDSFFNREGHNVHSQVTIPFSILALGGDIKVPTLDGDETLKVASGTPAGTHITIKGKGIPYLRSKGRGDHVVQVDADVPKKLSKEQKTLLEKLHD................................................... 365
206 0.000e+00UniRef50_A0A0A8GV09 Chaperone protein DnaJ n=35 Tax=root TaxID=1 RepID=A0A0A8GV09_9PROT  ali  28  5.............................................................................................YYEILEISKTSDKETIKKAYRKMALKYHPDRNQGNKEAEDRFKLVNEAYEVLSNDEKRSIYDRYGKEGLKGQASGFGGFND-----FDLGDIFSSFFEEGFGFGKTSRQKKESRDLKISIKITFKEAVFGCKKKVDFTYKTFCKTCNGSGSENG-KESTCEHCGGKGQVGIRQGFMTFVQTCEYCSGSGNVIKDKCKICQGKGYEEIKDSIELDIPEGIDNGMSLRAQNKAGDLYIKIIVEEDEKFIRHEDDIYTIVPVFFTQAALGKTIKVSTIRGEADLKLPVGAKDKEKFELVNQGVKNLHSGKLGSHIVQIDIKFPKTLNDEQKNLLQQLEKSFG-------------------------LAEEESFIEQESLFDKIKSWFS. 371
207 0.000e+00UniRef50_B0CP71 Predicted protein (Fragment) n=37 Tax=Agaricomycotina TaxID=5302 RepID=B0CP71_LACBS  ali  31  4...........................................................................................KNPYDVLGVKANATAAEIKKSYFALARKYHPDTNP-DKNARDKFVEIQDAYDILKDKDKRAAFDKYGSSSQQPGFDPNAFTQGGGFGSGSHADIFESLFGAFGGGRSRSTGPQRGEDLEAAVGVSFLDACKGTTKTINVSTVVDCGTCSGSGLKAGASRSKCGTCGGSGTQTFVLGGFHMASTCSTCSGTGTTVPRQCSSCGGIGKVRVKKTVQVKIPAGVEDGMTLRLAGVNGDLLVRVNVARSQAFTRQGSNLYHDARIPFHTAVLGGRVRVPTLEGDVDVRVPGGTQPGEEMVLKGRGVPPLYGSGSGDLFVRFAVTLPRSLSKRQRELLQAYADDTEGRAPSKALMIPTPAKAETSSPENPGEGDESGE................ 400
208 0.000e+00UniRef50_M1Q1D0 Chaperone DnaJ n=1 Tax=uncultured organism TaxID=155900 RepID=M1Q1D0_9ZZZZ  ali  32  1.........................................................................................MAEDYYDILGVSKDASKDEIKKAYRKKAKKYHPDRNPDDAEAREKFKKISEAYEVLADDEKRQRYDRYGKQGVEQDFGSGGFQWSDFSHRDDVEDLFSDLFSEFFGGRRASRRQRRGSNLKMTLEVSLKDIREGKEKNFKLNRQTQCDECG-GSGSKSGGTKTCPNCGGSGEVKQVQRRGIQQSQCSECDGTGQIVENPCPKCNGSGVLNKREKISIEVPPGAQDGTRLRVRGPPGDLYIILRVKPHDKFKRSRNNLIMETEVTMTEAALGTKIKVPTLEDKVEVKVPEGTQPGDQLRLSGKGLPRPNRRGYGDLIIKINVVIPEELNKEQKQLLEDFAGIEKEKNKSW.......................................... 378
209 0.000e+00UniRef50_K0P5N2 Chaperone protein DnaJ n=2 Tax=Candidatus Cardinium TaxID=273135 RepID=K0P5N2_9BACT  ali  29  1.........................................................................................MEKDYYNILGVERNATAEDIKKAYRKIAMQYHPDKNPGNKAAEEKFKAATEAYDVLSNPEKKHQYDQFGTSGYQ----GGSRSYDDDIFEGDLNDLFQDFGSFFNSGRRTRRTANRGEDLRIRIKLNLEEVALGTEKKIKVKRYTSCAACGGNGAENGLSVEKCVPCKGQGVVRTMLGNMLTEAICSHCTGTGSRIKTYCSDCQGEGRKFIEDLITFKVPKGVKKDMELTLRGKGGSLIVQIDEEENDLLKRKGNNICYTLHVSFIDVTLGCEMEVPTIYGKVRLKIPPGTSSSEVFKLKGKGITDINGYGKGDQLVFIQVWIPQELTKEEKEMLLSL--------------------------QGSPNFIPKPNKKEESFFDRIKSFF.. 375
210 0.000e+00UniRef50_A0A0G0S3D8 Chaperone protein DnaJ n=18 Tax=root TaxID=1 RepID=A0A0G0S3D8_9BACT  ali  31  5.............................................................................................YYDLLGISKGATDDEIKKAYRKMAHKYHPDKSGGD---EAKFKEVNQAYQVLSDKSKRQQYDQFGQTFDGNGGGGAGQNGGFEFGNEGYEDIFSNIF---GGSSRGGRRRAQGADIRVDMEITFVEMVSGVEKEVRLYKKVVCDHCDGEGAEPGSGMKTCPTCKGQGRVQTLFGSFSQVTECPECHGNGKIFEKKCSKCGGDGRVKEEEVIKIKIPAGIMDGQAISMSGYGGDLLVQIHVLAHKKFKRKGNDILSTEFVPFSIATLGGKIEVATITGSLILKIPAGTPSGEVFRIREEGVPDLSGRGTGSQLVTVVVKVPKSLSREQKKLLEQLSD................................................... 369
211 0.000e+00UniRef50_P28616 Chaperone protein DnaJ n=52 Tax=Borreliaceae TaxID=1643685 RepID=DNAJ_BORBU  ali  29  1.........................................................................................MKKDYYEILGLSKGASKDEIKKAYRKIAIKYHPDRNQGNEEAASIFKEATQAYEILIDDNKKAKYDRFGHSAFEGGGFEGFSGGFSGDIFEDFGDIFDSFFTGNKGQERNRKHA-KGEDLGYNIEISLENAYFGYKNNINITRQMLCDSCLGKKSEKGTSPSICNMCNGSGRVVQGGGFFRVTTTCSKCYGEGKIISNPCKSCKGKGSLTKQETIQLNIPPGIDNNQQIKMKGKGGDLYVKILIRSHKVFKRNGKDLYAMLPISFTQAALGKEVKIKTISKEIKIHIPKGINNEEQILIKNAGMPILQTEKFGNLILITKIKTPKNLNSNAIKLFENLGKELKD............................................... 355
212 0.000e+00UniRef50_H3EXI7 Uncharacterized protein n=21 Tax=Chromadorea TaxID=119089 RepID=H3EXI7_PRIPA  ali  38  13..................................................SLSTTPVSASLPNARALNLTAKHAVIAVKSAELHTSAPLANKDYYKTLGVEKKADAKSIKKAYFNLAKKYHPDVNK-TKEAESKFQEISEAYEVLSDDTKRQQYDTFGSDGNGMHGRGGAGAQWNYQTHADVNEIFRRAFGFGKGGNFAESQYGSNQTEELVLDLSFEEAVRGTTKTVNVRVIEDCFKCKGSAVEPGYKKVSCPYCNGSGMMTQKQGGYFFQQPCNRCTGTGQYNKNPCQECEGQGSTVQRRPISLQVPAGTHDKETIRYQTGKTNVLVHFNVARSNKFTRQGDDIHVDVEITVAQAILGGTVRVPGIYEDTSIQITPGTGSHTKLRLSGKGVKRANAHGSGDQYINVRIAVPKYLNDEQRRIMKEWAATDKPKTGSVRGIVEEEVKAEEQPKQEEQGQKGAGEQEEEGWLGKMKRSF.. 473
213 0.000e+00UniRef50_A0A1F5V5H8 Chaperone protein DnaJ n=1 Tax=Candidatus Fischerbacteria bacterium RBG_13_37_8 TaxID=1817863 RepID=A0A1F5V5H8_9BACT  ali  29  1........................................................................................MTEEDYYSILGIGRTASLSEIKKAYKKLVRKYHPDLNPNDSSSEEKFKKIQEAYSALNDPKKKEVYDKYGKAGLGSDFSNFEGFDFTNFGTSSFKDVFSHLFDNMRTSKKQQYKTEDFEDIVYPMSITFMESIHGLTAEISLSRMVNCYMCSGTGFSKQAQEVVCSICNGTGRMSKARGYLRFETSCNTCDGKGKITKGKCLHCGGKGKVSKTERMKVKIPPGTDNNSRIRVTGKGGDLYLAITVNPHPIFTRKGDNIYLTIPITITEAALGAKIEVPTIDGHTTMKIPPNTKSGQVFRLKGKGSPSLRGNYKGDFYIEVVIWMPEIYDEESRDLLKKFNLRHNENPRTE.......................................... 371
214 0.000e+00UniRef50_H3G867 Uncharacterized protein n=3 Tax=cellular organisms TaxID=131567 RepID=H3G867_PHYRM  ali  39  4.........................................................................................SKRDFYDVLGISRDASKNDIKKKYYQLAKKYHPDTNKADPNAAKKFAEATEAWEILGDDDKRQKYDAYGHAGVDEQAGYGGAGGFQGQGFEDIFGEFFGGQGFGGRSRHSANQPQRGGDIQVDITLSFMEAVKGATRDLNITANVECDSCDGSGAKPGTKKKTCPTCNGSGVQIMQQGFFAVETPCRRCHGEGSIIESPCGKCRGKGAVKKPRTVEVKIPEGVDQGMNLRLGGPSGHMYVGIHVLPDPFFKRRGTDVLVEVPISVAQAVLGGTVVVPTLTGEVEMRIPRGTQPDTVLQMRGKGIKELNSNRRGSQMVNLQ....................................................................... 332
215 0.000e+00UniRef50_A0A2E1MFK9 Chaperone protein DnaJ n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E1MFK9_9BACT  ali  30  1..........................................................................................MRDYYEILGVQKGSSPKEIKNAYRKMAFKYHPDKNQGNELAEKKFKEAAEAYDVLSNDDKRSRYDQFGHAGIKGNGAGHPGFTDLNDIFSNFGDIFENMGGGGGFGDFFNQRRSRGTDLKLTLPVTLEDIFSGKVKTVRVQKYILCDDCNGNGCAKGYGLNQCSVCNGTGEVRKVQGQVVNVQPCYNCNGKGQVISNPCKNCKGDGRVRKHSSIEIEIPPGVVTGSYLTKRGAGGNLIVIFDEVDHPLYLRDENDIIIDAYIDYSTAVFGGKIEVPTLSGKIKLKIPKGIKGGQLLRVRNKGLPELNSHRVGDFLVRININIPKNFNSKVKQIIEELKQE.................................................. 357
216 0.000e+00UniRef50_A0A1W9S0E2 Chaperone protein DnaJ n=1 Tax=Candidatus Coatesbacteria bacterium 4484_99 TaxID=1970774 RepID=A0A1W9S0E2_9BACT  ali  34  1........................................................................................MAVKDYYEILGISESASQDEVKKAYRKLAKMYHPDKNPGDKQAEERFKEIGEAYNVLSDPEKRKQYDMMRKYPFTGGFGAGEPFDEDLFGFGGLGDLFESFFRGFGGGTHQETKPRKGDDIHMNMEIPFDLSVKGGKAVVKVPKDVVCKTCGGSGAAPGYDVVVCPRCKGTGSVSYKLGGYAISRTCPECLGRGTRPKKPCPTCGGLCYTRGVKKVRVRIPKGVKDKTRIKIKGQPGDLYITIRVQPDPKYVRKGNDIVIKKDIALDQAILGDTIEVTNPYGKVRIKIPPGTQPGKKFRVKNMGIINELEKKKGDLIVEINVRIPKNLTKEQKEFIKTFSK................................................... 372
217 0.000e+00UniRef50_A0A292PSR9 Uncharacterized protein n=1 Tax=Tuber aestivum TaxID=59557 RepID=A0A292PSR9_9PEZI  ali  31  6............................PVLPRAARALRASSNPIANF---------RCFHTPTLSRPLLALRNSNYSQRRPFHSTSQAAVKNPYSILGVGKTASTSEIKKSYYSLAKKWHPDQNK-DPSARERFQEVQAAYEILSDPAKKEQFDQYGEAAFDPDSGFSPGAGAGPGQGGDFS--FEDLFGSFGRSGGGRGSRGFGDNIEIEVTISFMEAASGTSKDIRIHPLVQCKACSGMGVKPGTMKKQCSLCYGTGTRVHHMQGFQMASTCERCRGTGTVTPSECGTCSGSGVTKEARTITIDIPAGVDTGMKMRVDGEGGNLFVHIRVTPHKEFSRKGSDIYYTATIPFTTALLGGQTKIPTLDGHVDIKVPMGTNTGDMIAISGKGMPGPNSPGRGDLKVEFKLNPPRTLTPRQRILLEMLADEFKDKNARRIMNVNSKND----------GASYYEEHKNEGFLKRAWHNLT. 472
218 0.000e+00UniRef50_UPI0008F9E3C4 protein tumorous imaginal discs, mitochondrial-like n=1 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9E3C4  ali  43  18.................................VNSSLIISKQSFSVLSKCACDSY-WTQASRPKDATLRSSNSLGKHPRNQFHTSKSLLGKDYYDILGIPRNASPQEVKKAYYQLAKKYHPDQNKTDPNASKKFQEVSEAYEVLSDDTKRKQYDSWGSQGPGRQGSYQTYGEWQFHSSIDPEELFRKIFGDRGPFSFSRSHFGFGPAQEIILKLSFVQAARGCTREVKVNVVDPCPRCKGSKCELGYKPMMCPYCDGTGTVTMSKGPFVIRQTCGHCQGSRVFIGLKCVECAGKGKVVAKRIVKIPVPPGVADGQTVRMSVNDNELFITFKVDPSAYFRRERANVFTDAEISISQAVLGGTIRIEGIYEDHTIFIKPGTSSHQSIILPNKGLKKIDAIGYGDHTVQIKIKAPGSLTEKQKALIQAYAELEEDTPGHVQGVDATK--------GKEEKSMAGEDKESKSLLQRIKNLFG. 475
219 0.000e+00UniRef50_A0A1J0PA71 Chaperone protein DnaJ n=6 Tax=Bacteria TaxID=2 RepID=A0A1J0PA71_9SYNE  ali  29  3............................................................................................DYYDLLGVGRDADADSLKRSYRRLARQYHPDVNR-DPGAEDRFKEIGRAYEILSDPQTRARYDQFGEAGVSGGGAP------DMGDVGGFADLFETFFSGFGGGAQRRRGPRQGDDLRLDLNISFNEGVFGQERDVQIRHLETCSTCSGSGAKTGSGPTTCGTCAGAGQVRRPFGSFTQVAPCPSCEGSGQVIANPCGDCGGQGVQQVRKKLRITIPAGVDSGTRLRVGGPPGDLYVYLSVQAHDKLHREGIHIHSDVAVNYLQAILGDKIEVDTVDGPETMEIPAGSQPGAVLTLSGKGVPRLNPVARGNHLITIKVQLPTKVSSHERELLEQLAGHHSDKGHPHKS........................................ 361
220 0.000e+00UniRef50_A0A1M4TWS1 Chaperone protein DnaJ n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1M4TWS1_9ACTN  ali  34  9..........................................................................................EKDYYKILGVSKDASDKEITKAYRKLAKQYHPDANPG---SEEKFKEISAAYDVLGDQTKRKEYDEARSQGPMGGGFGGGAGANFDFKVEDLGDLIGGLF-NRGRGTSRGTGPQRGKDLEAEVHLSFEEAAKGATTTVNVVGDSSCSTCGGTGAAPGTVPQVCARCQGSGSISDNQGFFSFSQPCPACGGRGIVVTKACPTCRGTGVERRSRQVKIRIPAGVEPGQRIRIRGPAGDLIVLVHVGRHERFGRSGNDLTITIPISYPEAALGTVISVPTLEGKISLKVPPGTRSGKTFRVRGRGIPSSKKGGTGDLLVTVEVWVPESLDQKQRKLLEELAKYTPEPPR............................................ 361
221 0.000e+00UniRef50_A0A2A5D9N2 Chaperone protein DnaJ n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5D9N2_9BACT  ali  33  1........................................................................................MSQRDYYEVLGVGRDASDTDIKSAYRKLALKFHPDRNK-DEGASDKFKEATEAYGILSDGDKRARYDRFGHAGVGGGPGGSGGPAVDFGDFSQFGDIFESLFGMGGGRGRSQGKP--GRSLRASVEISMQEVLEGTKRTLTLRRNETCESCEGSGAAPGGVKETCTGCGGQGAVHQQQGFFAVRTACPRCQGEGTVISKPCGTCRGQGLAQKEREIEVRIPEGIEDGAQIRLGGPDGDLFVEIHVTEQEGFHRDGRDIYTEVGLSWPQAVLGDKIIVETLDGEARMSIPSGTPTGKLFRISGQGLPRLHGGSRGDLLVRIYVEVPTKLTREQKSLVKKMRELEEKKTKKAS......................................... 370
222 0.000e+00UniRef50_Q27237-2 Isoform B of Protein tumorous imaginal discs, mitochondrial n=99 Tax=Ecdysozoa TaxID=1206794 RepID=Q27237-2  ali  48  11......................................FRQLPAVRRCLAAAAFSTPRATSYRILSSAGSGSTRADAPQVRRLHTTRDLLAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDTYGQTAENIGRQGGGSQSWQFRSSIDPEELFRKIFGEGNFRTFADSKFGFGQAQEMVMDLTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGRCQYCNGTGFETVSTGPFVMRSTCRYCQGTRQHIKYPCSECEGKGRTVQRRKVTVPVPAGIENGQTVRMQVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVYEDQWINVEPGTSSHHKIMLRGKGLKRVNAHGHGDHYVHVKITVPKKLDKKRLALIEAYAELEEDTPGQIHGIANRKDGSKQATSE.......................... 447
223 0.000e+00UniRef50_A0A2H0TG40 Chaperone protein DnaJ n=27 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0TG40_9BACT  ali  34  1..........................................................................................MKDYYNILGISKTASKEEIKKAYRKLAHEHHPDKNSGT---DAKFKEINEAYQVLSNEKKRAEYDRYGRVFSDGQQSQGDFGFSGAEPFGDISDIFEDFLG-FGGGRSRRTRTKRGRDISIDIDLTFEEAIFGTKRKILLRKNVECVECKGSGNAPGSKIKKCETCDGSGTVRSQFGTFSTSVECSKCRGYGQTAEKQCKNCAGSGITRKEEEVSIGIPPGIESGEVLSLVGQGGDLYIKIRVRPHEVFVREGKNIVMLLEIPLTDALLGGEKVINVLDGEIKIKIPAGVDFGEVLRVRGRGVP-IESGGRGDLLIRIKVRNPKNLSRKARKLIDELKEE.................................................. 355
224 0.000e+00UniRef50_M9SJS4 Chaperone protein DnaJ n=8 Tax=Euryarchaeota TaxID=28890 RepID=M9SJS4_METAX  ali  31  5..........................................................................................KRDYYEVLGVSKTATPDEIKKAYRSLAKKYHPDVSTEPKEAEAKFKEVSEAYEVLSDEDKRRMYDQYGHAGVDGQFGQGGFSWEDFTHGDDLNDIFGDLFGGMFGGRRRQNAPRTGESLRYDLSIDLVDVLKGKTVQINVPHTSECSDCH-GTGGKGGKTQTCPICGGSGQQRTMFGDTIQVTTCRRCNGSGRTYSEECPKCHGRGRVSKNAKVDINIPPGVEEDMRLRVGGPSGDLYVVIHIKDYKGFKRDGSDLWVDVDTTYPRLVLGGVVKVKNIEGKIEATIPSGTQVGGVLKITGQGLPSVGRSARGNLYVRLGITVPKRTSDYEKELLQKLDEEAGSKKTRKSKIKDK.................................... 374
225 0.000e+00UniRef50_A0A0K9QZP4 Uncharacterized protein (Fragment) n=5 Tax=Chenopodiaceae TaxID=1804623 RepID=A0A0K9QZP4_SPIOL  ali  25  2...............................QAAVHLCCSTPQPIPTFSTHYFQFPICHIHHKHKQQFLHPVIRFPHPKRRAFRVIRAAAKADYYTSLNIDRNATLDQIKSSYRNLARKYHPDKNPG---SEDKFKEISAAYEILSNKEKRALYDRFGEAGLHGESVGPSFDAQEVDPFQVFDSIFGEFFGGQGMGFERRNRGRLNLDIWSDLNLTFEESVFGGKQEVEVPCLETCGVCGGTGAKSTNCIKSCTDCGGRGRVRTPFGVVSQVSTCLSCAGDGKVVTDDCAKCGGLGSIRSKRSFDVVIPPGVDDGATMQLRGEGGDLYLVLRIKGKDGVWREGLNLFSRIRISYTEAILGTMIKVETVEGSKELYIPSGIQPGDVVKLPSMGVPKPNRSGRGDHVFIVDIQIPKRISDRERELVEELASLQAPSSEHHSHQKGKSGSSLLKSVGKLFRRGRQSG................ 450
226 0.000e+00UniRef50_A0A1I8HSH5 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8HSH5_9PLAT  ali  46  77....................HLSVAEVNGTKHLERWPHESRGWWRGSHGSGVSLRDPRQATSLASVAGSTAAMPVSCLARRRLHSSRQLLKRDYYEVLGVGRQASQKDIKKAYYELAKKHHPDVNKNDPTAAKRFQEVSEAYEVLSDESKRNQYDTFGMHGPQGQQXXXXXXXENYQGSIDPEELFRRIFRDAGFDFXXXXXPGAAENIEVTLNLTFEEAARGVNKEVTVGVKDTCVRCSGSGSEPGSKPMVCPQCNGTGMESLTTGAYFMRTTCRRCGGARQIVKNPCVDCRGAGQTTQRKRLVIPVPAGVEAGQTLRVPVGRQEIWVTIQVERSRNFRREGADIHSDVDVSISQAVLGGKVRVPGLYEDLTIAIPPGTGSHERIRLPGKGIARFNSFGYGDHYIHVRVRAPRRLTEAQRALMLGFAEFEGPADRTRGSVDGVTQAPESD............................. 534
227 0.000e+00UniRef50_A0A2H9LFT4 Molecular chaperone DnaJ n=1 Tax=Candidatus Diapherotrites archaeon CG08_land_8_20_14_0_20_30_16 TaxID=1974403 RepID=A0A2H9LFT4_9  ali  31  14....................................................................................SRRDIVSKDYYKILGLNKNASETEIKDAYIKSVKKYHPDLNPGSKEHEDKFKEVNEAYETLKDPQKRKQYESFGSEYAQGNYSQANQQSSRNTGQFDFEDIFKNFGGDFFDSGSQKQRRTRAADLQYTLQISLEDAFNGTNKKIEIPTQENCPQCKGSGYLGNT--KTCNQCGGQGQVKRVFGSMVTVTVCDKCGGKGKSYDKKCDVCRGQGIVKGKKTLDVKIPRGVSPGTILRLQNEGGDLYLKILFESHPKFSLEHYDLYSKEHTDLITAILGGEIKVDTLEGKANLKVPQGTQSHTVLRMKGMGMPELNSSKRGDQYVKVIIDTPTNLTKDQIEALRIIFGKDKDVPK............................................ 383
228 0.000e+00UniRef50_N6X9G8 Chaperone protein DnaJ n=14 Tax=Actinomycetaceae TaxID=2049 RepID=N6X9G8_9ACTO  ali  33  1..........................................................................................MNDYYEILGVTRDASQDEIKKAYRKKARQLHPDYAG--PESEEAFKELSIAYEALSDPEKRRLYDAGGADALRGGASPFQGAGG-------FSDFFDAMFSGFSGASSGPPRRRRGADQLIGVDITLKEAVFGTQKTVSFATYIECETCHGSMCAEGTQPVTCSNCGGSGTVTRMFGQMQSRAACGACGGYGTIISSPCQECAGQGRVRSRRSYPIDIPAGVTEGTRIRVPGPQGDLYLEIRELTDEVFVRRGDDLHMWTTIPMTTAALGTDFMLSTFDGERTVTIPAGTQPGEEIILKELGVGRLQRPGRGNLHVHIEVEIPKKLDARSRELLEELAALRKE-------------------------GRVEPQRRDHSMFEKLKEKF.. 368
229 0.000e+00UniRef50_R1G1R8 Putative mitochondrial chaperone protein n=11 Tax=Pezizomycotina TaxID=147538 RepID=R1G1R8_BOTPV  ali  33  3.........................................PPGTPMRSDSPAACSEEGKWPPRTESGLPLTPDAQL-----FHATANLATKDPYSVLGVGKSASSSEIKKAYYGLAKKFHPDTNK-DPGAKDKFADAQSAYELLSDPEKKKAYDTYGSAAFDGGASGFGGGAGPGGPGGNPDFNFEDLFGAFXXXXXXXXXXXXGDNIEVQTNISFMDAAKGTTKEIFITPHVQCKTCDGSGLKKGTKKSSCQVCHGTGQRVVSMGGFQLATTCEACGGVGVSVPKECGTCDGEGAVRERRTVTVDIPGGVEDGMRLRVSGEGGDLYVFIRVAPDPKFQRSGSDVLYTATVPLTTAVLGGEIRIPTLDGDVKVKVPTGTGTGDKITLGGMGMKKLNSRKKGDLRVEFKVQMPKYLSANQRTILEMLADEMGDKNAKR----VMNLGNMNQETKDKIDEVEKNKHRNEGFLKSAWHNLT. 484
230 0.000e+00UniRef50_A0A2V2ETF1 Molecular chaperone DnaJ n=2 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2V2ETF1_9FIRM  ali  31  1........................................................................................MADKNYYEILGVDRKATEADIKSAYRKLVKMYHPDLHPNDANAAAKFKEVNEANEVLSDPQKRAAYDELDHPGMRGGAGGFSGFGGAGGFSGFGGDIFNDIFSGFGGGGAQQTAAAQGEDITKEVVLSFLDAAKGCTKEVRYYRNEPCPTCKGTGAKNGTAYKTCDKCGGSGQVRYTQGRTIRMATCDACGGTGKKITDMCPDCKGKGYVRKETVVTLNIPAGADTNSYIRRGGVPGDLIVIFRVEPHKIFKRKDKDLYIELPISYKTAVLGGKIRVPGIDDTFEYLIPEGTQSGTVFCVRGKGLKT--RVGTGNMYITVQVEVPTKLTRDQKKALEELDGQFDIKQTAKMRTFKDN................................... 371
231 0.000e+00UniRef50_A0A2H5ZHR1 Chaperone protein DnaJ n=7 Tax=Bacteria TaxID=2 RepID=A0A2H5ZHR1_9BACT  ali  32  1........................................................................................MPEKDLYAILGVPRNASQEEIKRAYRKLARRYHPDVNPGNKEAEEKFKEISEAHEILSDPEKRKLYDEFGMAGLQAGFDAERAFGGGFGRFESFEDIFSDLFGE-----RARPGPRPGADLETEVEIDLLDAVRGRTMEISLQRPEICGTCLGSG-EDIASSTTCGECLGSGRIQVARGPVRFSRTCPRCGGAGRISTRACPKCAGSGQTVQVERLQVRIPPGVDEGSRVRLQGKGGDLYLRVHVRPHPLLERRGDDLYMNVPITVGEAISGASITVPNPGGSLRVQVPPGSQSGKLLRIRGRGVPHLHGGGAGDLYLRLMIHVPTQDTQAVREAARTLDEQTRPHPR............................................ 368
232 0.000e+00UniRef50_Q058J9 At3g17830 n=70 Tax=Magnoliophyta TaxID=3398 RepID=Q058J9_ARATH  ali  30  10...............................................IPSINPAHSFRHQFPQPNASFYLPPTLPIFSRVRRFGISGMAAGTDHYSTLNVNRNATLQEIKSSYRKLARKYHPDMNK-NPGAEDKFKQISAAYEVLSDEEKRSAYDRFGEAGLEGDFNGSQ----DTSPGVDPFDLYSAFFGGSDGFFGGMGESGGMGDIRYDLRLSFEEAVFGVKREIEVSYLETCDGCGGTGAKSSNSIKQCSSCDGKGRVRTPFGIMSQVSTCSKCGGEGKTITDKCRKCIGNGRLRARKKMDVVVPPGVSDRATMRIQGEGGDLFIVLQVDEKRGIRREGLNLYSNINIDFTDAILGATTKVETVEGSMDLRIPPGTQPGDTVKLPRKGVPDTRPSIRGDHCFVVKISIPKKLSERERKLVEEF-----------SSLRRSSSSTGPTETRQEEQSFGSEPRKEPSLWHKMKNFI.. 457
233 0.000e+00UniRef50_A0A151BF90 Molecular chaperone DnaJ n=1 Tax=Candidatus Bathyarchaeota archaeon B23 TaxID=1779367 RepID=A0A151BF90_9ARCH  ali  39  1........................................................................................MRRKDYYRILGVDRNATQEEIKRAFRRLALKYHPDRNKS-PDAEERFKEISEAYAVLSDPEKRRQYDLFGYEGIQTRYSPEDLFNRTIFFGFDFDDLFNRLFRDFATFQRGAPTPERGRDLETEVEVTLEQAAYGAEVEIDVPRMRRCPRCRGSGAEPDRGMVTCPSCGGTGRIRRISGFTQMIRICSRCGGRGVIPAEPCKGCGGLGLVERRARIRVRIPPGIEDGSSLVLRGEPGDLFITVRVKPHPQLERRGLDIIYEAEVSFPKAALGGEIKVPTLRGERSVRIPPGTESGAVIRLRGLGVRS--PYGVGDQLVKIKIRVPKVLTPRQRELIEELARVLDE............................................... 362
234 0.000e+00UniRef50_A0A1V5RLS7 Chaperone protein DnaJ n=1 Tax=Candidatus Omnitrophica bacterium ADurb.Bin314 TaxID=1852855 RepID=A0A1V5RLS7_9BACT  ali  35  3.........................................................................................QKRDYYEVLGVSRDVTEDGLKKAYRKLALRYHPDRNPNSQEAEEKFKEAAEAYAVLNDSDKRARYDQFGHSLGGGGFSGFENFQDSFGGFSDFGDLFEDFFGGGGGGGRRSGARGRRGDLEYPVTLTLEEVLSGKAMELEIPRRETCTECGGSGAEKGSRKKVCADCGGRGEVRITQGFFSMRRTCPKCGGEGESIEKPCHVCRGEGRVRKVRKLQVNVPAGIEDGSRLRVTGGRGDLYIHVTVEKHKVFERQGHDLYAETLIPYTVAVLGGKADAVTLTGKTELTIEPGTPSGKIVKVRHEGLPAVNPDRRGDLYLRVQVEVPLKPSKAERELLEALAAERGDKVASKKG........................................ 365
235 0.000e+00UniRef50_A0A0L0HI24 Chaperone DnaJ n=1 Tax=Spizellomyces punctatus DAOM BR117 TaxID=645134 RepID=A0A0L0HI24_SPIPN  ali  31  1.........MTCTSTATVHVNKALLRTSTCLNVAGRPFVAKARCISSVRQREYERPLRPTGNLRNCNCKGGFEGLGSSTKRTFHSSSLSPKRDAYQVLGVNRDASANEIKKAYYKLARDYHPDTSK-DPNAKDKFIEIQEAYDILSDDQKRANYDQFGHSAFTGGEGPGGPFGGGGSFHGNAQDIFEQLFTGGFGGMPGMGGMGGGRNIKTSMNVSFMDAAKGTTKPITFTSIVKCKPCTGSGMKAGHKPQRCNVCGGAGQVSFVRGGFHMASTCQACGGTGVRIPAKCGTCDGVGRVKEKRTVEVKVPPGVYDGLELRLPGPEGDLFVRLNVQSHPTFKRDGADVLVNADVPLEKALLGGTIRIPTIDGEVELQVPPGTQPMEKKRLRRRGVRKIDGDERGDQWVTLNVALPKTLTEKQRKLLEEAFDVEG--TGKKGNPGSSNPGPKDSEEGDKNPGKEETG---KGFFDKLKK.... 511
236 0.000e+00UniRef50_A0A162A0Y0 Uncharacterized protein n=11 Tax=Pentapetalae TaxID=1437201 RepID=A0A162A0Y0_DAUCA  ali  26  5....................NPSPPNEIPKRKMIQLANL-RSEHLFNSSGFFSSLIPPSFNSISRKPGYSFLSRNN-QRSRYAGVVRAVSARDYYSVLNLKSNATLPEIKAAYRRLARKFHPDMNKG-PGAEDKFKEISAAYEVLSDNERRSLYDRYGEAGLRGDYDGANGSSYE----VDPFEVFGTFFGDPNGAFGGRDESRQGLDISHDLYLSFEESIYGAEIETEVSCYEMCENCGGTGAKYSSSMKSCTNCGGRGGVVTPFGIMSQVSTCSKCEGNGNMITDPCQNCGGRGKIQTKRTIKVVIPPGITDGVTMQLRGEGGDLLLVLHVNKKKGISRDGLHLYSNVNVDYTEAILGTIVKVETVDGLRDLQIPSGVQFGDTVKLPHMGVPDINPSKRGDHHFIVKVQIPKHISVEERTLVEKLASI-----KASSTKYSSSFPENFRSHSDQFEASRSKSNNGTSFWKSVKSFWG. 478
237 0.000e+00UniRef50_C9SJE1 Chaperone protein dnaJ n=42 Tax=Fungi TaxID=4751 RepID=C9SJE1_VERA1  ali  29  1..........MNTSSLLTKAAAAPSRLLPVQACRRPKLGEALCKHAQIHTAAFAASSRPSVRF-----LSPANSSAPSSKRAFHATTNLATKDPYKALGVGKSASASEIKKAYYGLAKKYHPDTNK-DASAKETFGEIQSAYEILSDPAKKQQYDQFGAAGFNPFHGFGGQAGGGFGGGFNFDDIFSAFTGGQGGPFGFREEVLVGDNIEVHASISFMEAAKGVAKTLHITPLSTCGTCSGSGLKAGTKRTECKTCHGTGRVHTMNGGFQMASTCGSCGGTGSTVPRECKPCSGNGVVRERKTITVDIPAGIEDGMRLRVDGSGGDLYVFVRVASDPKFRRAGSDILYTANLPITTAMLGGEVTIPTLTGQVNVKVATGTSTGDRLTLSGMGMKKLGRGGSGDLKVEFRVSMPKYLSANQRTLIEMLANEMGDKTAKRIMNVSPTGSTVDPDAS--------DSHKNEGFLKSMWHTLTN 508
238 0.000e+00UniRef50_A0A172TJY7 Chaperone protein DnaJ n=11 Tax=root TaxID=1 RepID=A0A172TJY7_9BACL  ali  32  1........................................................................................MSKRDYYEVLGVDKNASADDIKKAYRQAARKLHPDVNKXXXXXXX--------------XQKRSTYDRHGHVDPNQGFGGGADFNGGGFG-----DIFDMFFGG-GGRQRDPNAPQRGNDLQYSMTIEFKEAIFGKETDITIPRTEDCDTCHGNGAKPGTKPETCTTCKGSGQQEVVQGRMVNRRVCSTCSGRGQVIKDRCNTCHGSGKVKKQRKIHVKIPAGVDEGAQLRISGEGGDLYIVLRVKAHEFFEREGDDVYCEVPLTFAQAALGDEIEIPTLTEKVKLKIPAGTQTGTYFRLKGKGVPRLRGYGQGDQHVKAVLVTPTNLTEEQKEMLLQF----------------------------GGSINDTTHSNHQSIFDRLKKAF.. 368
239 0.000e+00UniRef50_A0A2E4FX39 Chaperone protein DnaJ n=1 Tax=bacterium TaxID=1869227 RepID=A0A2E4FX39_9BACT  ali  33  2............................................................................................DLYQVLGIDTSATDSEIKRAYRKLARQYHPDVNK-DPNAQTKFNDLQKAYDVLSDSQKRAQYDQYGVTDDQPXXX--XXXXXXXXXXXNMEDIFDSVF--GGGGRRGNHGATQGDSLRYDCTVTLEDVVDGCSRTIEYDHLAFCKTCDGTGAKTGSSVATCSRCQGTGEIRHVQGQFAQVSTCPECQGEGKMIKEKCLGCKGHGVSKKKKSLDLNIPGGISSGTKLRVDGPPGDLYVVIQVRNHAKFDREGDDLYSEETISIVEALLGVQLDVKTIEGTATLRIPEGTQPGTRFRLKSKGIKHLKGFGRGDQYVKVSVNIPKKLSKQQREIIQSFQ.................................................... 345
240 0.000e+00UniRef50_A0A1X2IYX0 Uncharacterized protein n=2 Tax=Mucorales TaxID=4827 RepID=A0A1X2IYX0_9FUNG  ali  34  4.................................SRTTWRTASCSSHALKNAIKTSCQRSVNSIKNNVSGVDALPAIHRQKRSFHASAHMSKKDPYDVLGVQKSASQGDIKKAYYALAKKYHPDTNK-EKDSREKFVQIQEAYEILSDEQKRQQYDQF-GHGFEGGGPGGAGGFHGGPGGFDPNDIFSQFFGGGFRGGSDPFRNVVGDDLQTPLTLSFMEAVKGATKVVQVNRVTNCSTCHGSGLKDGKQKSTCGVCQGSGVQTIAMGGFHMQTTCQACGGAGSSIPSACSPCSGVGKVRERKTVQVHVPPGVDHNSRIRVTGEGGDLFVSLNVMPSKIFRRSNYDILLDAKIPFHKALLGGKIRIPTVDGDVELRVPSGSQPGDNIAMRGRGIQRLRSTVHGDQIITLKIELPRSLRGEARDLIEKYASLVDEDYRVEXXXXXXXXXXXXXQPSSSNENA.................... 459
241 0.000e+00UniRef50_A0A2V7PMS7 Molecular chaperone DnaJ n=3 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7PMS7_9BACT  ali  31  1.........................................................................................MKQDFYVVLGVQKDASETDIKKAYRKLAMECHPDRNNGDKAAEERFKLVTEAYEVLRDPEKRAAYDRYGHQAPRGGGGGFSSMHF------DLSEVFMRDFGFASFGGGQRRDRRRGHDIKVGLKLTLAEVASGTTKTVRIKSLESCPECAGSGAKTGTQPVPCGTCGGSGEVRRQFGQFLTVSPCPTCAGEGTVLHDPCPRCGGDGRVKGEKTIQIDVPAGVADHHYLTLRGQGGDLIAVLDIKEDPRFERHGDDLVYDLGITFTQAALGAEVKVPTPFGETMLRVEPGTQTGMAYRLRAKGLPRLGEGGHGDLHVRIHVWTPNKLNAEQRKLLEQLSEIEDEPPQEEEGSKFWDTIRRALGLESNPEA..................... 394
242 0.000e+00UniRef50_A0A2N1W589 Chaperone protein DnaJ n=1 Tax=Candidatus Goldbacteria bacterium HGW-Goldbacteria-1 TaxID=2013807 RepID=A0A2N1W589_9BACT  ali  32  1........................................................................................MQLKDYYKVLGLTDKASGDEIKKAFRQLAKKYHPDAHPGDKAAEDRFKEISEAYEVLSNPEKKAQYEKLGRGGQNGNYQGNADFSSIFGDMGGFSDIFDMFFENGPQRRGQSQGPQKGDDVIIRIKIPFDLSLKGGETIVKVPRDSQCTLCNGTGAAPGTSAQQCPTCSGSGSIHFSQGGFMINKPCPKCDGRGTVIITPCMKCAGTGSEKEIEKIRIKIPQGVTDGIKIKISGGRGDLYVIFGVEESNQFERRGDDLYYGASINLAQAVLGSEIEIPLMDGAVKVKIPAGTQPGSAQKIKGKGAKSIKTGKTGDLIIVINVEIPSKLSDKEKKLMQELAKLKD................................................ 374
243 0.000e+00UniRef50_M5BIE7 Casein kinase 2, alpha polypeptide n=2 Tax=Rhizoctonia solani TaxID=456999 RepID=M5BIE7_THACB  ali  34  342..............................................................................TRRVFHSSASAAQKDPYQVLGVKKDATAADIKKAYFALARKYHPDTNK-ETSAKDKFIDIQSAYEILGDSEKRTAYDQYGSASQQQGFDPNAFAGARGPFGGSQADIFETLFGSAFGGVRGNRRSVRGSDIETSVGIEFLEACHGTSRTINVTPVVDCKPCSGSGLKPGAKRSTCGSCRGTGTRTFVQSGFQMASTCTECGGTGTTVPNQCGDCGGLGKVRIRKTVKVDVPAGIEDGMSVRVSGAPGDLLVRINVAPSKTFRRQGVNIHHDARIPLHTALLGGKVRVPTLDGEVEVRVPGGTQQGQECVLKGRGVPALYGSEKGDLFVSFAIQIPRTLTQRQREILQQYADDVEGRSSPQADQTTSTAGSGSSREPSAGKQDG................... 762
244 0.000e+00UniRef50_A0A2H0L5S9 Chaperone protein DnaJ n=1 Tax=Candidatus Peregrinibacteria bacterium CG11_big_fil_rev_8_21_14_0_20_41_10 TaxID=1974792 RepID=A0A  ali  31  2............................................................................................NPYELLGVEKSASPDEIKKAYRKMAQKYHPDRNPDNPESEKKFKEVSAAYEVLSDPQKRQQYDTFGSTAGNGGGGFGGAGGFDFSSGEGFADIFES--FFGGGGGRQKQRTNNGRDMEVQIEVEFLDAAFGSNQKIGYQRQAKCKTCTGSGAEPGSKVVNCSRCSGTGQIKEQRGQVMTTRACNECEGRGQRPEKVCHTCHGQGRNSVREDLTIKIPKGVSHGATMRLSGKGGDLYISIRVKSHPRFKREGDDVYSDLKIHVLQAVLGDEVEVETIHGKKVLKLNAGTTEHKVYRLKGEGVPHMEDAGQGDHYFRIQIQMPDKLTKKEKDLYIQLADEANLKISPQK......................................... 362
245 0.000e+00UniRef50_A0A146HND9 Uncharacterized protein n=2 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146HND9_9AGAR  ali  34  193.....................................................................SSFPGPQLAPRRAFHASRPRAQKNPYDVLGVAQDASAAQIKKAYFALARKHHPDTS-TDKGAQEKFVEIQAAYDILKDEEKRKAYDQFGPTSQEPGFDPNAFSGFAGGNFSGFQDLFSQLFQGLGGNTRSGFQTSRGSDLEASVRISFLEACKGTSRKINITPVVDCAPCSGNGLKPGAKRSTCTTCKGSGTRTFVISGFQMASTCNTCGGSGSTVPSECSHCGGVGKVRSKSTVQVEIMPGVEDGVTLRIPGKPGDLLVRIHVTASKDFTRQGTNLYHKTRIPMHTALLGGKVRVPTLDGDVDVRLPGGTQQDEEMVLKGRGVPSPHGGGVGDLFVSFSVQLPRSLTARQRELIQQYAD---DVEGRQSGDTAKNTDASTNDNAGAAIRPRSHWD............... 610
246 0.000e+00UniRef50_A0A1Q5PMZ5 Chaperone protein DnaJ n=2 Tax=Actinomyces liubingyangii TaxID=1921764 RepID=A0A1Q5PMZ5_9ACTO  ali  33  3............................................................................................DYYEILGVERDASAEEIKRAYRKLARKLHPDVAG--PDAEDRFKEVTVAYEILSDPQKRQQYD-----------LGGEGGDFFGGMGFDAADLFSTFFGGTAAQRGPVPRGRRGQDSLATLDVTLEEVTFGAEKEVKINTAIKCSKCEGSCCEPGTSLRTCGTCGGSGSQMRQLGMVQTSVPCSTCAGHGTIIETPCGECAGEGRVRSSRTLKVDVPAGVEHGTRLRLSGQGEDLYIEFHELRHPTLRRRGDDVHTQITVPMTAAALGTVVEIETLDGMKEVNINAGTQPGASIRLSGLGVTHLNRRGRGDLHVLVDVAVPTGLNEEQRELLEKLAEVRGEERKAPAG........................................ 350
247 0.000e+00UniRef50_R5T9S1 Chaperone protein DnaJ n=1 Tax=Clostridium sp. CAG:1219 TaxID=1262772 RepID=R5T9S1_9CLOT  ali  32  1.......................................................................................MAESKDYYEVLGVSKNATEDEIKSAFRKLAKKYHPDANGGNKEAEAKFKEVNEAYSVLSDKTKRAQYDRFGSNFEQAGFNGAGGYGGFSGIDIDLDDILGSVFGGGFGGFSKKQGPTKGADLRYNMNITFEEAAFGAKKEISITKNEKCDVCNGSGAKPGTSKVKCDKCNGKGKIKFTQGTFSSVKTCDKCSGTGEVINTPCEKCYGKGSLRKNKRIEINIPAGIDNGQAICIGGENGDLFIVVNVSPHKIFTRKGMDIMCEVKVPYTILVIGGKIKIPTLEGDIEYQIPEGTQNGTKFKIRDKGIKGIHSTQRGNLEFTVDVDIPKRLNDKQREILKQFAVEMGEEVNVKK......................................... 380
248 0.000e+00UniRef50_A0A2H6IPX2 Chaperone protein DnaJ n=3 Tax=Bacteria TaxID=2 RepID=A0A2H6IPX2_9BACT  ali  30  5..........................................................................................TDDFYERMGLKKGASEAEIKKTYRRLARKYHPDLNPGDESKEKKFKEINEAYEVLSDPKKRSEYDQFGKAAFEGGQGHGGFRSQDFGGFEGFEDIFANLFGGGG----QRQGPSRGPDLSTHLDISLEEACKGVTRSISLRRDVSCKSCGGTGAES---YQTCPYCKGSGSIKQSRGFFNLGQPCPQCRGTGKSVTKTCTACSGNGSTLTTSNIKVKIPAGTDTGSKVKLGGPPGSLYIELTVRPHPIFKREGNNLFVDVPVNISEAVLGGKIKVPTIDGSVTMTLPPGTDSGKKFRLKGKGVPNRKGGITGDEFAVIKIVVPRNVTDKTKEALKEIGKAYE................................................ 351
249 0.000e+00UniRef50_UPI0009A71AAA molecular chaperone DnaJ n=1 Tax=Phoenicibacter massiliensis TaxID=1944646 RepID=UPI0009A71AAA  ali  31  1........................................................................................MAGKDLYSVLGVDKNATEAEIKKAYRHRARELHPDVNKA-PDAEEKFKELNEAYDILSDPQKKAQYDRFGTIPGTASSAGPGGAGYFGGGFGGMGDIFSTFFSGFGGSAGVRQVRKEGRDMQIGLRITLEEVATGCKKEIVYDRLAPCQDCHGTGLGENGKEVKCDACNGTGRVVTVQGDMQTATACSVCNGTGTKIEGACSECGGQGRVPDRQRVSVEIPAGIQDGQQLRVSGYGGDLIVTIRVQRHDYYERHGNDLHVSLSVPMVQAALGANLEIDGLDGEVTVKVPEGSQTGDKIRVKGHGLPKFRGAGRGDMIIHVKVEIPKKLKKKEREILESLAEEMGQPTSDTRSPLEKLRDAFN.............................. 382
250 0.000e+00UniRef50_A0A2H3E0C1 Uncharacterized protein n=2 Tax=Armillaria TaxID=47424 RepID=A0A2H3E0C1_ARMGA  ali  32  148......................................................................................ASAAPKDPYSVLGVNKDATAAEIKKVYFSLARKYHPDTNP-DANARDKFVEIQEAYDVLKDEKKRAAYDQYGSTSQQPGFDPNAFSGQGFGGFKDFSSGFSSFFESLFGNGPGSRQRSRGEDLEVSVGVSFMESCKGTKRSVKISPVVDCLTCSGLGLKPGAKRTTCTACSGSGTRTFVISGFQMASTCPSCSGVGSTIPSQCGSCGGVGKVRAPQTIEVDIPPGVEDGMTIRVPGTPGDLFVRVSVAPSKQFTRQGANLFHEVKVPFHTALLGGRVRVPTIDGDVDVRLPGGTQQGEEMVLKGRGVPEVRNGLSGDLYVTFSVVLPRSLSKRQRQLLQEYADDIDGRSTSKDSKGGNKASQSSSPSQGKGTGHDNGMPS.............. 554
251 0.000e+00UniRef50_A0A0G0TJI7 Chaperone protein DnaJ n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0TJI7_9BACT  ali  36  1.........................................................................................MAKDYYKILGVASGASSDEIKNAYRKLAHKYHPDKSGGD---ESKFKEINEAYSILSDPEKKKRYDSFGSAGTGGAAWGPEDFGYQGAGFEDLGEIFEEFFG--FGRPKRRASQGRGKDIIVDIELSLEEAFAGQSKEVVITKFANCERCSGKGAEPGTPLSTCKTCQGRGMEQTFFGTFTRLTTCPNCHGRGEIPEKPCTTCRGEGRMKRSVKMDISIPPGVADGETLKVSGAGGDLFLNIHIKPHVVFQRKGNDLWNRVEVSFPQAVMGTKLDVPMIDGSIKLTVPAGTPSGKILRIKGKGMPIVGGRGRGDSYVTIVVRVPQKISKK............................................................. 346
252 0.000e+00UniRef50_C4Z1J3 Chaperone protein DnaJ n=110 Tax=Bacteria TaxID=2 RepID=DNAJ_EUBE2  ali  33  4..........................................................................................KRDYYEVLGVPKDADDAAIKKAYRQLAKKYHPDMNPGDKEAEIKFKEASEAYAVLSDAEKRRQYDQFAAFEGGAGGAGAGGFDFDFGDMGDIFGDLFGGMFGGGGSRRNSNGPRRGADVRVNVRITFDESVRGTTKKIDVTLKDECSSCHGTGAKPGTSPETCSKCGGRGQVTFTQGMVRSQQPCPDCHGTGKIIKEKCPDCYGTGYISSKKTIEVNIPAGIDNGQCVRIQGKGGDLLVAVIISASTEFERDGYNIFSNVVISYPTAVLGGEIKVKTVDGEVLYEVKPGTASGTRVRLKGKGMPSVRNAQRGDHYITLIVDIPTKLNQEQKDALMAYEKALTGNER............................................ 365
253 0.000e+00UniRef50_A0A1V6AV09 Chaperone protein DnaJ n=14 Tax=Bacteria TaxID=2 RepID=A0A1V6AV09_9BACT  ali  31  1.........................................................................................MARDYYEILGVGRSASDAEIKKAYRRLARKHHPDLNPNDKAAEAKFKEISAAYEVLSDPKKKARYDQFGFAGERPASGGFEGFDFSDFGGGSFRDLFQNIFXXXXXXXXXXXXPERGEDLLYTMKVGFEDAVRGVQTKIRLNRRAACPACGGSGSKSG-EAKTCPTCRGSGKAFQQRGYMKFSGVCPACGGRGTVAGRDCGDCRGQGTREMPETINVRIPAGVDTGSKVRIPRKPGDLYIQIETLPHPLFRREGMSLHVKVPITVPEATLGAKIDVPTLDGPAVIRIPPGTKSGQRFRLKGKGAPQPGARIRGDEFVEVMIVPPPFGDERVRDLMKKLEPLYGGSPRAGMNEEV..................................... 373
254 0.000e+00UniRef50_A0A2M7UQE5 Chaperone protein DnaJ n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_10_14_0_2_um_filter_38_24 TaxID=1974774 RepID=A0A2M7UQ  ali  30  33.......................ARLLRRAYMLARAIWLRHARYFSNKISSLF----------FPSTSINRVLDKIFRKRYNQSVKIIMAEKNLYEILGVPKAATDAEIKSAYRKSALKYHPDKHKGDKDSEQKFKEINVAYEVLSDKQKRQQYDTFGSTNPRGGFDFNGMNFDFGGSAGGFADIFEGGMSGGRSKRSRKSGPIRGSDIEANIRISFEDAVFGCEKELEITKSDVCKQCNGKGAEPGSSIVTCTACGGTGEIKSVRGQMATSNICDECNGEGRRPEKVCSVCHGTTRVRVKDRVKIKIPAGVDNGSTLKLAGKGGDLYILLVVEQSRKFIRDGLDIHSETEIHLLQAVLGGEITVDTIHGEKTIKIPAGTGDSKVFKISGAGIKKENGQS-GDHYTKIKVKIPDKLSKKERELYLSLADEAGFDMKKNGGLFW..................................... 469
255 0.000e+00UniRef50_B7IFE0 Chaperone protein DnaJ n=28 Tax=Thermotogae TaxID=200918 RepID=DNAJ_THEAB  ali  33  1........................................................................................MAKKDYYEILGVSRNASQEEIRQAYKQLIKKWHPDRNQNRKEAEEKFKEIQEAYEVLSDPEKRAMYDRFGYVGDVPPNAXXXXXXXXFKDFGDFNDIFNIFFGDQRSSRQKQRRAKRGEDINITVDVPFEQVFTGTTIPIEYDRYEVCSHCNGEGVEPGSGWVSCPKCHGTGVVRTFLGVIVNQYTCNQCGGTGKIPGETCHVCGGSGRIRKRHRVEVKIPAGVDNGTVIRVQGGYGDLYVNVRITGHIDFERRGNDLIKEIKIDYVEAILGTKVKIKMPDGRVKVKIPSGVQDGENIYVYGEGVPDMRTGRRGDLILKIKVDIPKRVSRSEKKLLKEIAKLRGKDVDEEE......................................... 379
256 0.000e+00UniRef50_A0A1J6KS28 Chaperone protein dnaj a6, chloroplastic n=12 Tax=Pentapetalae TaxID=1437201 RepID=A0A1J6KS28_NICAT  ali  30  11.........................CTASNINPNCSLSSFNFPKTLTFSSSLS--PPLKFVYIKPNLFPLNRKRRRFVSVSAAAKSTSS---DPYSVLNVSRNATLKEIKASYRKLARKYHPDVNRS-PGAEEKFKEISAAYEVLSDDEKRSLYDRFGEAGSRGEYNVPG----NGAQGVDPFEVFSEYFGEXXXXXXFRNMGRQDLDIRYDLDLSFEESIFGGQRDIEVPSLDACDSCGGTGAKSSSCVKVCSDCGGKGGVVTPFGIMSQVSMCLNCGGNGRIVTDHCRKCGGRGQVQSKRSIKVVVPPGVHDGATMQVRGEGGDLYLIIHVKQNREIWRDGLNLYSKVDVDFTEAILGTVKKVTTVDGMKDLQIPPGCQPGEKIKMSKMGVPDMNRSSRGDHLFLINVQIPKNLSDAERTLVEKLASLR................................................. 431
257 0.000e+00UniRef50_A0A267H6N4 Uncharacterized protein n=8 Tax=Bilateria TaxID=33213 RepID=A0A267H6N4_9PLAT  ali  49  24.................................................................AAGSTAAMPVSCLARRRLHSSRQLLKRDYYEVLGVGRQANQKDIKKAYYDLAKKHHPDVNKNDPTAAKRFQEVSEAYEVLSDESKRKQYDTFGMHGPQGQQHPXXXXXENYQGSIDPEELFRRIFRDAGFDFXXXXXPGAAENIEVTLNLTFEEAARGVNKEVTVGVKDTCVRCSGSGSEPGSKPMVCPQCNGTGMESLTTGAYFMRTTCRRCGGARQIVKNPCVDCRGAGQTTQRKRLVIPVPAGVEAGQTLRVPVGRQEIWVNIQVERSRNFRREGADIHSDVDVSISQAVLGGKVRVPGLYEDLTIAIPPGTGSHERIRLPGKGIARFNSFGYGDHYIHVRVRAPRRLTEAQRALMLGFAEFEGPADRTRGSVDGVTQAPESD............................. 432
258 0.000e+00UniRef50_A0A1C7NQG8 DnaJ 1, mitochondrial n=4 Tax=Mucorales TaxID=4827 RepID=A0A1C7NQG8_9FUNG  ali  37  28............................................................................SCYKKGFHTTHSARHQDPYKILGISRSSSQNDIKKAYYKLAKQYHPDTNK-DKKAREKFVQIQEAYEMLSDEEKRKQYDQFGH-----HDRSGGAKGFYSSSGFDPNDIFSQFFGGGFGDGGDPFRTTSGEDIQVPLTIDFMEAVKGVTKTITVQSVTHCPTCQGSGLRAGHAKSSCHLCHGTGFQAIQMGGFHMQSTCQACGGLGQSIPPQCPTCQSAGKVRENKQVQVTIPAGVDNHSRIRVPGAGGDLFVSLNIKPSPVFRRQDADIFCDAKIPFYKAMLGGKVRIPTIDGDVELRIPPGSQPQDSIALRGRGIQRLKGSSRGDQIVQLKIELPRSLQDKQRDIIKKYAALVDEKPSE........................................... 402
259 0.000e+00UniRef50_A0A0G1SR43 Chaperone protein DnaJ n=1 Tax=Microgenomates group bacterium GW2011_GWA2_46_7 TaxID=1618502 RepID=A0A0G1SR43_9BACT  ali  34  3...........................................................................................KDYYKTLGVDKNASTEEIKSAYKKLALRYHPDKNKGDKTAEEKFKEINEAYQVLSNPEKRSSYDQFGTAGFDFGGAGRGFDGFNFSSFGGFGDIFDAFFGGGRRKKKRGS------DIEIIISLTFEEAVFGAEKEISYSVLDECPNCQGRGGEN---MKTCKQCNGSGKIRTILGSFSQTTICPGCNGRGETPENKCRNCSGAGRTRQQKTLNVKIPAGVNNDSSIRIAGEAGDLGLRIKVKPHKEFSRRGYDIYSEKEISFSSAALGEKIEVNTIYGPVQLNIPAGTSSHTEFRLKDKGVLHPTRKTKGDHFILIKIKVPKKLTREEKELLEKWKKISD................................................ 363
260 0.000e+00UniRef50_A0EHM5 Uncharacterized protein n=4 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0EHM5_PARTE  ali  33  22.........................................................................................SKKDLYELLGVPKNASQNDIKNAYYGLAKKYHPDANPS-KDAKEKFAEINNAYETLSDENKRKVYDQAGAQDPFAAYRGKAQDFQFD------ESIFGD-FASFFNMGGESERQIKGADIFIQLEISFMDSVNGAQQTIQFEKIGVCSTCNGTKCKPGTAPGRCTNCGGRGSINYRQGAMTIQMACTKCRGTGVSIKNPCTTCKGAGIQKQATSEAVNIPKGIADGQNLRVTGKGGDLIIKVQVKPDSYYKRDGYDLITNAYISVAQAVLGDQVKIKTLNGEQQISIKPGSQDGEKIRLSGLGITKLNSNQRGDQVVNLKIQIPTNLNEQQRKLFEELAKLEKSETKGQSTV-------------------------HEGVFEKVKNIFN. 389
261 0.000e+00UniRef50_A0A0Q0WE17 Chaperone protein DnaJ n=1 Tax=Desulfuromonas sp. SDB TaxID=1735325 RepID=A0A0Q0WE17_9DELT  ali  30  1.......................................................................................MASKRDYYEVLGIDKKASEADIKKAYRNLAKKYHPDLNRGEDEAAEKFKEISESYEVLMDSNKRKLYDQYGHEGLSQSFGQGGFSMRNFSHMDDLRDIFGSFGGFQQGYGARRKGPQRGRDIEIALKLTLEEMTKEINKNIQLSRHETCNLCQGKGFQKKEDQITCPVCNGTGQTKKVHGRMISTTTCSKCGGSGEIIKNPCSQCKGEGLIREKAKVEIKLPPGVQQGHAGKHGGPRGDLIVNIKEIPHEIFIRAGRNILCRYPIKFSTLVNGGKVKVPTLDKPVLMTIPKGTQTGHVFKLKNKGIPGMRGAAYGDQLVEVIVWTPQKVDSEARKQLQKFEKLVNDQPPQP.......................................... 384
262 0.000e+00UniRef50_A0A1V6D0K8 Chaperone protein DnaJ n=14 Tax=root TaxID=1 RepID=A0A1V6D0K8_9BACT  ali  34  3.........................................................................................QKRDYYEILGVEKSASADELKRAYRRGALKYHPDNQKGDKEAEAKFKELAEAYEVLSDPVKRQRYDRFGHEGLRGAGM-------HDFSSMGFADILSMFGLDDXXXXXXXXXXXRGYDLETEVELSLEEVAKGADQTLEFERMDLCETCSGSGSKPGTTPERCRTCGGHGKVQQQVGFFGVSVACPKCAGRGTIVSDPCGDCRGSGRRRKKRTLVLHVPAGIHDGQVIVARGEGGDLHCRVHVRPHPLLERRGDDLICQVPISFSQAALGGKIAVPTLNGRQEIDVPSGTQNGDVVTLKKAGLPSRRSGRAGDQHVIVLIEVPKRLTAKQRELLTAYADTEN----------------------------VHVTPGRKSFFDKLKDYFG. 375
263 0.000e+00UniRef50_A0A2E5DG52 Chaperone protein DnaJ n=4 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5DG52_9CHLR  ali  31  1.......................................................................................MAEKRDYYEILGISKNASDEDIKSAFRKKALEYHPDRNKSE-DAESKFKEVNEAYQILSDSEKKNRYDQFGHAGVSGAQGGGAGFEGFGGGFG---DIFDAFFGGS-QSNSGRKASYRGADLEYPITLSFEEAVFGGEKGITIEKLFPCDTC---------KPVSCGNCNGTGQIRTMFGQFTQVVTCQTCSGTGESFDNKCQTCKGAGRFKNSKNLFVTIPQGIDDGMQIRLQGEGGDLYVIVKVEEHDIFERSGNNISMDIPLNIPTLVLGSTIRIPTIQGEENLTIPPGTQSGQVFRIRGKGIVDVRKNKRGDQLVTVNVKIPKKLNKQQTELYKKLQEITEDDTKKNVSDWLKNK.................................. 359
264 0.000e+00UniRef50_A0A212DXL9 Chaperone protein DnaJ n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A212DXL9_9BACT  ali  30  3...........................................................................................KDYYKILGVLKNASQEEIKRAFRRLAHQYHPDKAGGD---EQKFKEINEAYQVLGNEEKRQRYNQFGADFAQQRAARGSDGFNFNFGDLDLGDIFGDIFG---GRRGRTAGTRKGNDISVDIEISLEEVFSGISRNVEINKNNLCSICRGDGAEPSLGTKVCDKCKGSGKIRILFGTFIQESVCDKCGGAGKIPEKNCLHCKGTGIIKSRDSIALNIPAGIEDGGALQFSGEGGDLYVVVHIKPHKIFQRKNADLYCDLTLKFTQLALGCGVEIPAIDGNLKLNMSAGTEAGEMIQLKGKGLPNFQRYGRGDMYVKIKVKMPKKLSKNAKKLLEELDKE.................................................. 360
265 0.000e+00UniRef50_A0A1Y2HEY9 Uncharacterized protein n=1 Tax=Catenaria anguillulae PL171 TaxID=765915 RepID=A0A1Y2HEY9_9FUNG  ali  30  3.....................RSPLCLRASSPALSSTPAAAAAVAATRSLSTRQCLSTSASRRSTPTSTPATPPHLTLPRRALHTSRSHSKRDFYETLNVPKSASEKDIKRAYYQLAKKYHPDTS-SEPNAKEKFVEIQQAYDVLSDTSKRQMYDSMGHAAFDPSMGGPGAGGAGGPXXTDPNDILNQMFGGMFXXXXXXGAAARGEDIETELRISFDDAVHGCQKPLRLALNVQCSPCTGSGLKPGTKVSTCRACHGSGTQVFYQAGFQIQSTCRVCSGTGKSVPSACNECHGAGQVQRSKTIMVDVPAGVDDGMKVRLSGKGGDLYVRLKVMPSAVFTRRDMDILVAAKVPLRTALLGGVVKVPTIDGEVELKVPEGTQPGEKKLLRNRGVVNVNKPSRGDQVVELKVEIPKNIDSDLKDKLRAILDELDGIKPAPASESKDKQNSSSNSKASSSDAETK.................. 481
266 0.000e+00UniRef50_Q49762 Chaperone protein DnaJ 2 n=780 Tax=root TaxID=1 RepID=DNAJ2_MYCLE  ali  31  1.........................................................................................MARDYYGLLGVSRNASDADIKRAYRKLARELHPDINP-DEAAQAKFKEISMAYEVLSDPEKRRIVDLGGDPMENAAASPSGFGGFGGLG-----DVFEAFFGGSSASRGPIGRVRPGSDSLLPMWLDLEECATGVTKQVTVDTAVLCDRCQGKGTNGDSAPIPCDTCGGRGEVQTVQGQMVTARPCPTCRGVGVVIPDPCCQCVGDGRVRARREITVKIPSGVGDGMRVRLGGPAGDLYVEVHEQAHDIFVRDGDDLHCTVSVPMVDAALGTTITVDALDGMSEIDISPGTQPGSVIELRGQGMPHLRSNTRGNLHVHVEVMVPTRLDQHDTELLRELKRRRSRDVAEVRSTHAA----------------------GGGLFSRLRETFTN 377
267 0.000e+00UniRef50_F2NBX3 Chaperone protein DnaJ n=2 Tax=Desulfobacca acetoxidans TaxID=60893 RepID=F2NBX3_DESAR  ali  32  1........................................................................................MLERDAYEILGVARDASDAEIKKAYRKLARKYHPDVNPDNKEAEKKFKEISAAYDILANPEKRTQYDQMGAAAY-YATPEAARGYEEAFTGRDFSDIFRD----FFGGGAAYGGPTPGEDLAYALEIDFLEAVRGTHKTITLEKQIICPGCKGSGYEYAGQV--CPACGGRGVVEKKVDNVRMLINCAACQGTGRTGQQSCRRCGGRGVVLGSETVEVKIPPGVDQGTKLRLAGKGGDLFLIISVRPHPQFTRQGRDIYYKTTLSLFDAVLGGKITVPTLDKTVSLTIPPGTQNGQRFRLKGKGV-GTGGARTGDQYVEVHVTIPKQLSPKAKELFQSLKDSL................................................. 344
268 0.000e+00UniRef50_A0A2T2U914 Chaperone protein DnaJ n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A2T2U914_9BACT  ali  32  3...........................................................................................RDYYDVLDVDRDASQDELKSAYRKHAMKYHPDRNPDDPDAEKKFKEAAEAYEVLSDEEQRRRYDRFGHAGVQNGAGGGGRARGRPGAFQDISDIFEQFNDIFGGRARXXXXXXXGGDLRIRLKLTLEEISEGVEKDVKVRRYVPCETCEGTGSEEGAGFVMCDQCNGNGEVRSVFGQMVNVRTCPKCGGEGRKIKSKCPDCGGEGRKKTEETITIPVPAGAMEGHHLTMRGPAGDLQVEIIEKQHEHFTREELDVYYNLYISFPEAALGTEAEVPTLKGRARLEIDAGTQAGKILRMKERGLPELRSNRRGDQLVRVHVWTPRDLTSEQRRQLEEWNGDENFEPEP------------------------EELDNRKSFFSRVKDVFT. 418
269 0.000e+00UniRef50_A0A2H5VNW6 Chaperone protein DnaJ n=6 Tax=Bacteria TaxID=2 RepID=A0A2H5VNW6_9BACT  ali  32  1........................................................................................MTRRDYYEILGVTRRATRAEITRAYKKLARKYHPELNPGDEEARRRFEEIAEAYEVLSDPKKRALYDRYGPEAREKKTTDIIFEGFDFSAEESFGDFLEELFG--SSEQKRAKGPQRGADLEVPVALSFEQALRGTTIVVTVARRQTCPRCEGRGEIEG-PVGTCFRCGGTGRRPTTRGPLRLSMRCQQCEGTGRSAP-ICPVCHGETRIPVKESVEVKIPAGVDTGSRVRVGGPPGDLYIVPNVQAHPFFVRKGDNIYCTVPITITEAILGAKIEVPTLWGKATLRIPPGTQSGQIFRLREQGAPSLRGDVRGDQYVEVKVVIPRLIDQRSRELMREFERLNPENPR............................................ 359
270 0.000e+00UniRef50_A0A269YJK4 Chaperone protein DnaJ n=7 Tax=Rothia TaxID=508215 RepID=A0A269YJK4_9MICC  ali  30  3............................................................................................DHYSTLGVSKDASPEEIKKAYRKKARQLHPDVNPSEEAAEE-FKRVTLAYEVLSDNEKRRNYDATGEQGRAGFPGGAXXXXXXXXXXXXXQDLF-DMFTGGGGQSGPASRVRQGQDALINVSISLKDAVFGVEKTVELNTAVTCKSCEGEGTAPGTHPETCETCHGQGRVQSILGTVMQQVECPSCQGYGTVIKHRCPECHGQGRVGEKLPLTFTVPAGVNDGARIRLRGKGGDLYIDLNVKRDKYFVRDGDNLTTTVNIPMVAAVLGTTVPLETFDGVQEITIPEGAQSGDIVTLNGLGVTRLHSDKRGDLQVRIQVTTPTNVNSEQRELLQKFAELRGEDLHEGTHV-----------------------KQKHGLFSRLKDQF.. 377
271 0.000e+00UniRef50_A0A255SSU4 Chaperone protein DnaJ n=2 Tax=Prevotella TaxID=838 RepID=A0A255SSU4_9BACT  ali  33  1........................................................................................MAKRDYYEVLGVEKGASEDEIKKAYRKIAIKYHPDRNPGNKEAEEKFKEAAEAYDVLHDPQKRQQYDQFGFSGPXXXXXXXXXXXXXSMNMDDIFSMFGDIFGGXXXXXQRRPQQHRGNDLRLKVRLSLEEVAQGVTKKFKVRKDVVCSHCHGTGSEGGGETETCPTCHGSGVIQSIFGMMQTQGVCPTCNGEGKIIKNKCKECGGTGVTKGEEVVEINIPAGVAEGMIVNVPGKGGDIQVLVEEEPNDTFIRDGKDLIYNLLLDFPTAALGGDVEIPTIDGKLRVKIDSGTQPGKTLRLRSKGLPEVQGYGKGDMVVNISVYVPKTLSRDEKKELEKMKDSDN................................................ 373
272 0.000e+00UniRef50_A0A2N9H8B7 Uncharacterized protein n=1 Tax=Fagus sylvatica TaxID=28930 RepID=A0A2N9H8B7_FAGSY  ali  28  1MVRSNGVRLVHWLASRSLASNFFHQSKYSIYETVCKGAYRNFNTGVCNPSRILGNYSSKNVSQKNWL-LLGALNANWGTARSIHSTGLNATCRFYC-LEASPKCSSLELSKN-KNLAKKLHPDTNKDDPEAEKKFQEVQRAYEVLKDDEMRQQYDQVGHEAYVQQGDGGFPNDFHNPFKDFFRDIFEDFF----------SRRLGGEDVKVSLELSFMEAVQGSTKTLTFQTHVACEPCGGRGVAPGVKPEKCSRCKGLGTISMQQGLFMVQITCPQCHGERETVPHKCKSCRGKRVVLGTKSVKLNIMPGVDNDETIKVGNQPGDLYVVIKVREDPVFRREGADIHVDAVLSITQAILGGTIQVPTLTGDVVLKVRPGTQPAQKVVLKKKEIKTRNSYSFGDQYVHFNVSIPANLTPKQRELIEEFAKEEQGE.............................................. 473
273 0.000e+00UniRef50_A0A0G0P5X5 Chaperone protein DnaJ n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0P5X5_9BACT  ali  31  3...........................................................................................KDYYKTLGVNKSASQAEIKRAYRKLAQEHHPDKNGNDA----KFKEINEAYSVVGDEAKRKQYDQFGFVPGSGAGPGAGGRGPNFEDFGGFGDIFETFFGG--NRRSGATSQRRGADIEATISIDLIDVLNGTEKEVTLSKWISCDKCKGSGAEPGFGIKTCPTCKGSGQIQTFLGTFAQNQICPECEGAGKIPEKKCTKCAGKGRIRESKKLLVKIPKGVDNGSIIKIVGEGGDLYLHVSIKGDSRFVRQGANLLTQISISFNKAILGTVADVPVVGGSIDLKIPAGTQPGQVIKIIGKGLPYLNTSKIGDLLVHVNIEIPKKINSTQKKLLEDWDSKKG................................................ 366
274 0.000e+00UniRef50_Q9HHB8 Chaperone protein DnaJ n=230 Tax=Archaea TaxID=2157 RepID=DNAJ_HALMT  ali  30  3...........................................................................................EDFYDVLGVSRDASKDQIKNAYRKKAAKYHPDVS-DEEDAEEKFKKVQKAKEVLTDDEKRQMYDQLGHERFQQAQKRGAGGGGGGRGQGNFEDIFNNLFNG--GGGQRRSRPQQGRDVAQRITIDLEDAYHGVERDVTIRRREVCPECDGEGHPADADVNTCSECNGSGQQTTVQGRVQQTTTCRACGGEGKTYSEDCSECRGSGRVRRTRDVTITIPAGFRDGQRLRYRGEGEDLFVEVNVRDHEEFDRDGDDLQYTHPISFPQAVFGATVEVPTLDGEAELKVPAGTQSGSTFTVSGAGMPHLDGRGNGDLHVEIHVVTPEDLNSEQREALKQFAEAGGEEVKE........................................... 374
275 0.000e+00UniRef50_A0A2U3CFZ7 Molecular chaperone DnaJ n=1 Tax=Candidatus Heimdallarchaeota archaeon B3-JM-08 TaxID=2012493 RepID=A0A2U3CFZ7_9ARCH  ali  33  5..........................................................................................KKDYYEVLGVQRDADVKDIKKAFRKLARKYHPDMNPDDPSAEEKFKQVAEAFEVLSDNEKRPLYDRYGHEGLSGASFRDFSGMGLDDLFGGFG-IFENIFNAFGGGTQSRSRARRGQDVRLNIDLSFDEAMKGIKKSIKVPNWAQCPVCHGNRIKKGESLIKCSTCGGVGEVRQVQGQMINITTCPKCRGEGEKLKKECETCNGVGKVKQTRTVEAHVPAGVDTGMRVVVQGEGGDLYLVVNISPHPFFQRNGAEILLEYPISFLDAVLGTKLTIPTINGDEKVTIKPGTESGKIITLRKKGAPNPNRSGRGDMHIGITVKFPSKLEKSVKQTLQKLQEEDEAK.............................................. 365
276 0.000e+00UniRef50_A0A1F9QJ49 Chaperone protein DnaJ n=7 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9QJ49_9BACT  ali  31  1........................................................................................MASNDYYRTLGVARNAGPDEIKTAYRKLAMKHHPDRNPGNNESESAFKEINEAYEVLSTPEKRQVYDQYGAEGLKAGAGGGRGGFGGFQGGADLGDMFGDLFENLFTQGQGGGRGRPRADLKYEAEITLEEAFSGVKVPVNFDRTEVCQECEGTGARGKTGIKKCPTCHGAGRVQYSQGFFSFSQACPDCGGQGEVISSPCKACGGAGRQKKSASINVKIPAGVEEGAVLRVSGGSGDLYIQVRLKHHAHFERQGRDLTYECPVAVWQAALGGETEVPVIEGRVKIRVPQGTQHGKVFRVHDQGMPGPGGRPRGDLLVKIKLEVPHDLTPRQRELFEELSRLAGHEVPAPDGKDKS.................................... 370
277 0.000e+00UniRef50_A0A1X2IV85 Uncharacterized protein n=23 Tax=Mucoromycotina TaxID=451507 RepID=A0A1X2IV85_9FUNG  ali  35  13............................................LSRHPASRSYSFPATYFKNRPLKTTLRALPCVDQQKRIFHATAGIKKEDPYKILGVKKTASQGDIKKAYYALAKKYHPDTNKA-KDAREKFTQVQEAYEMLSDEEKRAQYDQFGH-GFEGAYGQTSSSTQGFPGGFDPNDIFSQFFGGGGQXXXXSFRTMSGENLQAPLTITFMEAVKGTKKTIYIQQVTNCVTCKGTGLKTGVKMDTCKVCHGTGMQTVQMGGFNMQTTCTKCGGVGSSIPSECKTCDGLGKVREQKSIQVDIPPGVDDKARIRVSGQGGDLFVSLSIQPSKIFKRQDKDVFLDTKIPFYKAMLGGTVRIPTIDGDVELKVPKGSQVDDKIALRGRGIQHLRGAARGDQIVTLKIDLPRSLRGEQKSLIEKYAQLVDPEYRNDKS........................................ 454
278 0.000e+00UniRef50_A0A287PFI7 Uncharacterized protein n=9 Tax=Poaceae TaxID=4479 RepID=A0A287PFI7_HORVV  ali  26  14.NRTRTGQFGVRGQGSQRRSMAAALYLPANPNPLPNPTSTLRQPLPRPSTSGELHFRPRLVPRRARARTHLPAA--FGREPPAAAAAERAGRDHYATLNVRRDATLKEVKSAYRTLARKYHPDMNKS-PGAEEKFKEISAAYEVLSDKEKRSLYDRFGETGLHADYGGGDFS----AHGVDPYELFNAFFGSFFGDSMGPGRFNRGLDIHCDLLLPFEESILGVKREINISRHETCGACHGSGAKSSNSITECTQCRGQGRQRTPFGIVSQISSCLNCGGSGKIITEHCTSCYGSGKVQVERSIKVDIPGGIEDGSAIRLTGGGGDLYIFVRVEEKQGIHREGLNLCSDVTIDYTDAILGTTVKVETIEGLKDLYIPPGTQPGEKLKFAQLGVPDIRPNHRGDHNFVVKVKIPRNISDQARSLVEDLAALKGTRGISVPSDETIDRG------NLRDGSYHSSARKKTSFWGSVRNLF.. 502
279 0.000e+00UniRef50_A0A1Q3Q3H6 Chaperone protein DnaJ n=14 Tax=Bacteroidetes TaxID=976 RepID=A0A1Q3Q3H6_9BACT  ali  28  1.........................................................................................MKKDYYEILEVSKTATADEIKKAYRKIALKYHPDRNQGNKDAEEKFKEAAVAYEVLSDAEKRKKYDQFGHAGVDGQAGGHYQNTEDIFGGGGNFDPFEAFFGGASRSGGQRQKGRKGVNLRIKVKLSLHDIAFGIQKNIKVKKHVVCHTCSGSGAKDASSIGKCSHCNGSGVVRTILGQMQTTTTCPVCNGRGESITKKCATCHGLGTEYGEESIQLDIPAGLQDGMQLSVAGKGGDLIVQIEVENNTELEIEGQNLIYSLTVNFADAVLGTQVEVPTIEGKAKFKVPAGTPSGKIFRLNGKGLPSVNSYGRGDQLIVLNIYSPKHISA-------------------------EEKKLLEKLKDSPNFSPKPGEQTEQGFFERMKGFFGS 388
280 0.000e+00UniRef50_A0A1M5RKA6 Chaperone protein DnaJ n=13 Tax=Bacteria TaxID=2 RepID=A0A1M5RKA6_9FIRM  ali  35  1..........................................................................................MKDFYEILGVKRDASFEEIKRSYKKLAKKYHPDLNPDNKDAEKSFKEINVAYEILSDEQKRKTYDLYGEDGVNGNYQDSGFGGFGDIFGDI-----FDMFGGGFRSTRNSKSPTKGQDIRYDINLDFREAVFGVEKDINIRRQEDCSVCHGTGAEPGTDKHTCDKCHGSGQVKVQFGRFVRVVTCDKCNGTGEILDDPCHKCHGSGKEVNNKKINVKIPAGVDDNTIISMKGEGGDLYIYLSVKEDSVFKRTGNDLHLEIPISYVDAVLGGEIKVPTLTSLVDFEIPKGTQGGTTFKLKNEGVSFVKKEGKGDLYFTVDIIVPKKV................................................................ 337
281 0.000e+00UniRef50_A0A1N5RW83 Chaperone protein DnaJ n=208 Tax=root TaxID=1 RepID=A0A1N5RW83_9MYCO  ali  31  4.............................................................................................HYETLGVSRDASPEEIKKAYRKKARTLHPDVNPS-PEAAEEFKRVSHAHDVLSDPEKRRIYDATGNE--NGTAXXXXXXXXXXXXXXXXSDIFETFFNGAQSSRGPASRARQGQDALITVRIDLREAVFGAEKEVMVDTAVTCPECSGKGTQDGTEPETCEVCHGRGQVQRQLGNVVTTAECPHCHGFGTVIKHPCQECYGEGRVRQRRPLTVKIPAGVSTGTRIRLSGPNGDLYVEIRVSPDEVFTREGDDLHASITVPMTAAALGTSVTLETFDGPREVTVEPGTQNGQTVTLRGLGATRLRGSGRGDVIAHLQVTTPTRLNDEQRELLRKLAQLRGEDDGAGQTVQR---------------------GSGQGFFSRLRDRF.. 377
282 0.000e+00UniRef50_A0A1F8N988 Chaperone protein DnaJ n=5 Tax=Bacteria TaxID=2 RepID=A0A1F8N988_9CHLR  ali  33  1........................................................................................MAKRDYYEILGIDRNADQAVLKKAYRNLAMQTHPDKNPGDAEAAETMKQVNEAYAVLCDSRKRALYDRYGHAGLE------GYTQEDIFRGVDFGSLFDSIFEGFGGRNSARRRPRRGADLRYDLSVTLKEAAFGTVKTIVLPKVEKCSACGGTGAQPG-GLVDCRRCRGTGQIVMEQSVIRQITVCGDCRGRGKTVKKACKECRGKGIGEKTKEISVDIPAGCDTGYRIRVDGEPGDLYIVIDTERDPVFERHGDDVYLQKEISFTTASLGGQVDVPGLEGSLKLDIPEGTQTGAVLRITGEGIPGLNGHGRGDEYVIVKVVVPTKLSRREKELLRELETLRRRSRGESHGEDRES................................... 375
283 0.000e+00UniRef50_I0GJ82 Chaperone protein DnaJ n=1 Tax=Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01) TaxID=511051 RepID=I0GJ82_CALEA  ali  34  1........................................................................................MANKDYYEILGVSRNASQEEIKKKYRELVMKYHPDLHKDDPEAAKKMAEINEAYEVLSDPEKRAQYDKFGTVGPNVGGFERGYGPSYDFSG----DIFSDIGEGFGFGTGARERVERGEDIEVEVTIPFKDAVLGTEKEIPIRKKETCPVCKGTGAEPGTGYTICPTCNGTGRQRTPFGEFVVQTTCPTCHGTGKIIKEKCHNCGGTGVVEKLSKVTVTIPAGIEDGTVIRIRGEGGDLYVRVKVEKDPRFIKEGNKIYYVAHISVPEAVLGTEIKVPLIEGEEVVKIPPGTQHGTEIKLRRKGVRRPY-----DYVIKIVIDIPTTLTSEEAFYYEKLKEIYETKNRKR.......................................... 364
284 0.000e+00UniRef50_A0A1F7G120 Chaperone protein DnaJ n=1 Tax=Candidatus Riflebacteria bacterium RBG_13_59_9 TaxID=1817875 RepID=A0A1F7G120_9BACT  ali  32  1.......................................................................................MAQMKDLYEVLGIERGSTEKEIKTAYRRLARRYHPDVNPGNPEAEQRFKEIQAAYSLLSDKEKRRQYDTYGSSYFSPGVGPKXXXGMEGFGTGPSSDLFEDLIGRGTTQTRADTRPRRGQDVYQSVTVGFLDAANGTNITLGLSREVTCDRCNGSGAEPGSQLHDCPTCNGTGQLARSASFFRQVSACPQCQGQGRVPATGCMRCRGSGTTVKTERVNVRIPPGVDTGSKVRVPGKGGDLLLNITVRPHPYFQRKDCNVLVEVPITFEEAVLGAEIEVPTLSKRVRMKIPPGTDSDKEFRLRGKGFPQLSKAGCGDLLVRVRIVTPERVSLRSRELIREFSKEYPANPR............................................ 374
285 0.000e+00UniRef50_A0A0C9M7A4 Pheromone processing endoprotease KexB n=1 Tax=Mucor ambiguus TaxID=91626 RepID=A0A0C9M7A4_9FUNG  ali  32  794....................................................................TRIKRDVSTLQVTQLESPTSAPKKDPYEVLGVKKSSTASEIKKAYYGLAKKYHPDTNK-DKDAREKFVQIQEAYEILSDEQKRQQYDQFGHGFEGGAPGGGNPYGGFGGGSGDPNDIFSQFFGGGFGGRPFHNRPTPGDDLQVPLTLSFMEAVKGATKYVQVNKVTNCDTCHGSGLGEGKKKETCQVCHGSGVQTIMMGGFHMQTACQSCGGAGSSIPAGCPSCNSMGKVRERKTVQVKVPPGVDQNSRIRVTGEGGDLFVTLNIQASKVFRRQDSDIFVDAKIPFYKAMLGGRIRIPTVDGDVDVKVPSGAQPGDNIALRGRGIQRLRSNARGDQIVTLKVEFPRSLKGKQKEIIQEYAALVDEEYRPKEEPPIQVAPDTPPPSPSSENGDENSDKKEGGFF---KNAFG. 1226
286 0.000e+00UniRef50_A0A1F8NEF0 Chaperone protein DnaJ n=1 Tax=Chloroflexi bacterium RBG_13_60_13 TaxID=1797635 RepID=A0A1F8NEF0_9CHLR  ali  33  4..........................................................................................KKDYYSLLGVPREASHEEIRKAFRRLAFRYHPDHN-HHEGAAERFKEIVEAYQVLSNTNKRMTYDRFGHADDGRRFDGFGDFAAG------LGDIFDAFFGGSIPV--QRRTPQQGADLHCALNITFEEAVRGCRKEVEVLRLENCSRCFGNCCEPGTQPTACPNCNGMGEVRRTFGRFVNRVVCSHCDGEGSLVVHPCTQCQGTGKQRIQRTVSVTVPAGIENHAQMKLQGEPGVLHIAISVQEHEHFKREGNDVVYELPIDFAQAALGDDLNVPTLDGKSKLKIPPGTQNGTVLRIKGKGIPYANHPGRGDQLVKVKVVTPENLNAAQRQLFLDLGQSLGRAKPRRRNK....................................... 358
287 0.000e+00UniRef50_A0A2V7WPT6 Molecular chaperone DnaJ n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7WPT6_9BACT  ali  31  1.......................................................................................MATRRDYYEVLGVSRGADAGELKSAYRRLALQYHPDRNPDDPAASEKFKEASEAYAVLSDSERRQRYDRF--GHSGLGSAGGGFGGFDPSTFADFTDLFGELFGFSG----PRERPMAGSDLVYRMEITLKDAAFGIDAPIVVSRLERCSDCDGSGAEVGTSPTTCPACRGRGRQRVSQGFLVVTRPCPNCGGEGKIIEKPCRTCRGEGRKRGQRKLEIRIPAGVETGSRLRLAGEGGDLYVVLTILPHEIFAREGDDLVLALNLPFPTVALGGEVSVPTFDGEHKVAIPAGTQPGNEVKLRGRGLGRLGKSGRGDLVVRVGVSVPEKPTAKEKELLREYARLIGAPVGSGSRVIDSAKK................................. 364
288 0.000e+00UniRef50_R7MGM6 Chaperone protein DnaJ n=2 Tax=Terrabacteria group TaxID=1783272 RepID=R7MGM6_9CLOT  ali  33  1........................................................................................MNKRDYYEVLGVSKSASADEIKSAFRRLAKKYHPDVCKEEGGAE-KFKEAQEAYAVLSNPTERAKYDKYGFDAFDNPGANGGRGGYDFSGF-DFSDMFEDMFGGFGGRQSKGTSSRRGSDLLYEMKIDFMEAALGTKKDITLDVVESCPDCNGLG---GFDKETCPYCNGRGVQNTIFGAIRSRVTCSNCVGSGYSFKTKCRTCSGRGKIKQRKTYTVEVPRGVDTGDRVRMSGKGGDLYIEFTVSPSSFYKREKDDLYIDLPVTVTELILGGKRTIKTIDGEIELKIPSGSQTGDVLRAKGKGIKNARTGKIGDLYIVLNLVLPNKLTREQKDLFEALSK................................................... 360
289 0.000e+00UniRef50_A0A0R3UAW3 Uncharacterized protein n=1 Tax=Mesocestoides corti TaxID=53468 RepID=A0A0R3UAW3_9CEST  ali  49  1.................................................................................................LGVNKDASQADIKKAYYQLAKKYHPDINKSDKSAAQKFAEVSEAYEVLGDDEKRRSYDSFGGSSP-GGFSAASNGFDNFHSTIDPEELFRRIFRDTGDRNFAESTFGFNTTREVVVNLSFEDAAKGVTKDIAINVVVPCSTCEGSRCQPGTGMVTCPNCHGSGQETVSTGPFVLRSTCRRCSGSGNVVRYPCRACNGTGQAIGREQVKVAIPPGVEDGQVLRVSVPSQELFVTVRVEASQHFRRDGADVHSNVTISLAQAALGGKIRIPGIYEQVV--IPAGSSSHDRIRLPGKGISRVNGRGYGDHYVHLRVSTPKRLTELQRALLLAFAETETDVKGSVDGVASTESG................................. 350
290 0.000e+00UniRef50_UPI000DAC4E26 molecular chaperone DnaJ n=1 Tax=Bradymonas sediminis TaxID=1548548 RepID=UPI000DAC4E26  ali  32  4............................................................................................DYYQMLGVARDATHAQIKRAYRALALQCHPDRNCECPEAETRFKQAAEAYEVLSDRTRRALYDQYGRAGVKMKGPSPA---DINDIFSEFGDIFGDIFG-FGSCSGQSKSGARGEDLRFDLSLSFEEAAFGTSKVIEIPRREECDACEGSGAEPGTTSVICPSCKGLGQIQHRQGLFTLSSSCAACEGSGERVHEACAACTGAGFIADVREVTVKIPAGVGTDTKLRLRGEGGDLFVVLHVEPSAHFERQGANLVYQAEISFIDAALGCQIEVPTLDEPVTVTFPPGTQYGDRQTLKNLGIAQIGSDRRGDLIISARLKTPDTLNDKQRRLLEEFVKAGSEHAGEVGAETSSARARLSDQTA.......................... 370
291 0.000e+00UniRef50_A0A0S7XR03 Chaperone protein DnaJ n=1 Tax=candidate division KD3-62 bacterium DG_56 TaxID=1704032 RepID=A0A0S7XR03_9BACT  ali  34  5..........................................................................................TKDYYQTLGIKRDGSDKEIRAAFRRLARKYHPDVNPNDKNAEAKFKEINEAYEVLSDAKLRQQYDRFGHDGWRHAQQAPPGGGFDFGVGPNFGDIFDMFFGSRGGAAAQQPGATRGVDAEADVEISLEEAFRGTTREISLTVPESCPVCGGTGAAADGS-QVCPECRGQGR----GGPLGL-GVCQRCGGQGRIVTKPCGGCRGRGQTERQRRLEVKIPAGVRTGSRVRVGGAGGDLYLNIRVRPDRRFTRKGDDLHSEVAVSFPQAALGAEIDVATMKGKVRMTVPPGTSSGQTLRLSGLGIPHLRGGGTGDQYVKVKIVVPKDLSSEERALIDKLARLRGQQSP............................................ 364
292 0.000e+00UniRef50_A0A1V5RQ58 Chaperone protein DnaJ n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1V5RQ58_9BACT  ali  33  1..........................................................................................MKDYYEILGVSKNASQKEIKEAFYKLAHKYHPDKGGE----ADKFKEINEAYQVLSNPEKRAQYDKYGQTFEQAGGMPFDFSNFGFDDYSNFGDIFSEFFNQ---DKRKPEKEKRGKDLEVKLNITLEEAAFGAQKEITFKTYVKCEHCQGKGYEPGSKLKDCSRCGGEGVIRTLLGSFTQIIDCPKCHGQGKIPEKPCKVCGGDGRYWGTRVIKVDVPIGVRQNETIKIKGEGGDLYLKIQILPHPVFERKQDDLYMTLKLSFPEAALGTEKEITTLDKKIVVKIPAGIQSGELLRVKGKGIRHFNSFGQGDLFIKALVETPQKVSRRAKELLIELQKELGNN.............................................. 374
293 0.000e+00UniRef50_A0A1Y1V606 Uncharacterized protein n=4 Tax=Neocallimastigaceae TaxID=29007 RepID=A0A1Y1V606_9FUNG  ali  27  12.............................VQSIVNTTLINSAPALTSISNTINCHKSVSVNGKKNYSGLLNSKNIIKTQKRDFHATVPSKKKDLYEVLGVKKGASAKEIKTAYYKLAKTYHPDTNKS-KEANEKFIEIQNAYEILSDDKKRAQYDQYGHAAFDPNARAQGFQGRGGFGGFGGFDIFEQMFRGFGRAGNRKHHGMLGRDIKTTMTIDFMDIVKGTKKELKYYHMVFCHDCDGTGTNNKSTPGKCPKCNGTGQEFIQHGGFGMARPCSQCHGEGFYIPKRCKKCDGKRLVRKLDTVEVPIPKGVDSMVQLRLAGKGGDLYISVNILPHPIFKREKNDIHVNVNLPLTTAILGGKVTIPTVDGDIEMDLPAGIQPEDKKILRARGLYIMDTNVRGDEWIHFKVEIPKHINKKQRELLKLFQEEEEKKHPIKKAKKAIHSKMNQAKXXXXXXXXXXXXXKE............. 488
294 0.000e+00UniRef50_A0A0G1GQ18 Chaperone protein DnaJ n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1GQ18_9BACT  ali  36  3...........................................................................................KDYYQILGVDRNALDEEIKKAFRKKAHEYHPDKAGGN---AEKFKEINEAYQVLSKPERKKQYDQYGTEGFGGQGSGGFRSGGVNFDFGDLGDIFSDFFGQQSRPAGQRSHTANGHDLEINLSVDFNEAVFGIGKTLEIVKMVGCRHCLGNGAEPGTKIETCARCQGQGQISTTQGAFRSVSTCPDCQGEGKRASQNCSQCQGRGTLKDKVRLKVNIPAGIDDGETIRLAGQAGDLYLNLSVRPSAEFRRQGYDIHTFQKISFSQASLGGKVKVKTVDGEVSLKIPIGTQNGRQFILKEKGVPRLRGRGRGNQLVTVEVLVPKDLNRQQKKLVQQLADE.................................................. 372
295 0.000e+00UniRef50_A0A1F7QFJ5 Chaperone protein DnaJ n=9 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1F7QFJ5_9BACT  ali  31  1.........................................................................................MARDYYGVLGVSREATDAEIKKAYRQLAMQSHPDRNPGDKDAEERFKEANEAYAVLSDPDRRAHFDRF-----GTAGPGAGPGFGDAGFGSLFEDIFENFFSGA--PRGRRSRAVQGEDLQYELKLALEEAAAGIDTKIQIPRLEACEACGGGGVEAGSRLETCGLCHGRGEVRRSHGFLTVAQPCPKCQGSGQLNTHPCAQCRGEGRRRAERLLAVKIPPGVEDGMQLRLSGPPGDLYVLLRIREHDLFVRDGADLHCDVPVSFPQLALGAELVVPVLNGTTTLRIPAGSQPHAILRLRGKGMPRLRQRGHGDACYRLVLEVPHTLNESQREALAAFESA.................................................. 343
296 0.000e+00UniRef50_A0A2M7FEI2 Chaperone protein DnaJ n=3 Tax=root TaxID=1 RepID=A0A2M7FEI2_9BACT  ali  33  1.........................................................................................MAKDYYQILGISKDASVDDIKKAYRKLAMQHHPDQGGD----AEKFKEINEAYQVLGDAQKRQQYDQFGSAGPXXXXXXXXXXXSNMGGFSDLGDIFESFFGGGFSQQSQPQGPVRGEDEEAVLTVDFMTAVFGGEEQVEIVLLDQCATCKGDGAAPGAKIVTCSTCSGTGQVRRNQGNVTTASVCHECHGKGKIPEKYCPDCAGHGRVKKSTKLKVKIPAGIDTGTTLKLQGKGGDLYVRMNVRASRKFERHGYDIHTSLDIQIPQAVLGDEVEIETVHGVKKLVIPAGIESGKKIRLARSGVPKIGSSEVGDHIVTVRVLIPKKLSRKEQELFMELASE.................................................. 352
297 0.000e+00UniRef50_D3FAG4 Chaperone protein DnaJ n=13 Tax=Bacteria TaxID=2 RepID=D3FAG4_CONWI  ali  34  3........................................................................................ATKPDLYKILGVGKNATDEEIKKSYRKLARQYHPDTNQGDARAEERFKEVSAAYDVLSDPEKRKAYDR-GTGPFAAGGGTTGGFDPNAFGGGSFRDIFSDLFXXXXXRTGTRPRAQRGRDLETEVSLTFQEAIDGTQASLAVPTSTRCETCHGSGARPGTAPTVCPVCHGRGVESQGQGLFSISTPCSRCSGTGTIIEDPCPTCGGSGARRTIKRLKVNIPAGVRDGSRVRIGGEPGDLFVVTRVADSPVFKHLGDRVEVEVPLTVPEALLGATVEVPTLRGSKKLRVAPGTKHGTVQRLRGEGAPRLGGRGRGDIHYRFVIDVPRDLTSDQRRAVDELAKTMNGNPRAR.......................................... 368
298 0.000e+00UniRef50_A0A2D6RLX9 Molecular chaperone DnaJ n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2D6RLX9_9ARCH  ali  35  3............................................................................................DYYDTLGVKKGCSKEEIKKAYKTLAKKYHPDLNKDNPQAEQKFKEINEAYSALSDENKRANYDRFGSTGEQ-----FSGYNQRGFEGFDMGDIFNSFFGGGT------TRKQRGRNLKAELELTFNEAVFGTKKEIKITKYDQCKECNGKGGK---DTISCPDCGGSGRIRTPFGTFAQTATCQNCQGSGESVKHICKDCQGTGKIRATKKVKVKVPKGVDDGTTLRISNEGGDLYVELFVQPHEIFERKDDDIFLELPISFSQAALGDQIKVPTIREKVKMKIPPGTQSGTIMRLKGEGVENVNGYGNGDQHVKIQVVTPKKINKTQKDLLKRLAKENKEELKIKKGFFEK.................................... 351
299 0.000e+00UniRef50_A0A0E3ZC68 Chaperone protein DnaJ n=4 Tax=Leptotrichiaceae TaxID=1129771 RepID=A0A0E3ZC68_9FUSO  ali  31  1........................................................................................MAKRDYYEVLGVNKNASQDEIKKAYRELSKKYHPDLNPDNKEATEKFREVSEAYEVLKDDKKRQMYDNYGQAAFENGGASGAGGFEGFNTGGFNSDIFESAFGGGQTSGFHTSTRSRGRDLEYRVRLTLEDIVNDKEVKIEYTRDGKCSSCSGTGAENGN-LTTCGNCQGQGHITTILGYMKQTVVCSTCSGTGRVPKKLCTDCQGTGIKKEKVSKTIKIPSGIEDGTRMILRDMGGDLYIRVEVKKHDIFKREGLNIYLTVPITLTEAILGTTKQIPTLYGTENVEIKAGTQYGNRKVLVGKGLKFKGSV--GNQIITYTIEIPVNLSEDQKKLVSKLDTSLEKDN----------------------------YRETESFFQKIRKFF.. 379
300 0.000e+00UniRef50_A0A2D6E9E4 Chaperone protein DnaJ n=4 Tax=Bacteria TaxID=2 RepID=A0A2D6E9E4_9BACT  ali  30  4.........................................................................................TKRDYYEVLGVERGASVEEIKKAYRKKALEHHPDRNPGDAGAEEKFKEATEAYEVLHDPEKRQRYDQFGHASVSGQPGGGGFGGQG----FDLSDALRAFMRDFGDVFGRGSGPGRGRNLQVRIVLSLEDVVEGVSRKIRLKRMGSCSDCNGSGGRAGAGPTACGQCGGSGQIRRVQGQFVQVAPCGACRGTGRAVGDPCPACRGEGRREVRETISVEIPAGVAEGNYIRHGGPAGDLIVVIEEKPHELFERHGDDVVCDVPVSFPMAVRGGHVEVPTLRGVASLTIPAGTQSHQVFRLRGQGLPHLHSSRKGDQHVRVRVWTPKKLSREEKLILDKLGEIMNEKTPAPCG........................................ 374
301 0.000e+00UniRef50_A0A142WTL3 Chaperone protein DnaJ n=5 Tax=Bacteria TaxID=2 RepID=A0A142WTL3_9PLAN  ali  33  3.........................................................................................TQRDFYEVLGVEKSASADEIKKAYKKLALKNHPDRNPGDEEAIERFKEAAAAYEVLSDDDKRARYDRFGHAGVNGGGFGGGAGHGDVQ---DIFEAFSDIFSGFGFSXXXXXXPARGADVRVAVTLDFRSAALGCEREVSINRKKSCTRCSGSGCEPGTSPTQCDYCGGQGQVVQAQGFFRVQTTCPACRGAGHIIRHKCNTCYGSGREDHRVTLNVKIPAGVDSGVQLCLQGEGGDLYVDITVKDHPVFRREGMHLLCRVPITYTQAALGTKIEIPLLEGRDELDIPAGTPPGEVFRLRGKGIPDPRRGRKGDLHVEIELIVPKKLSEEHEGLLRKLAEVEKTQVTPHQKTWYEKLKDLFKGEAEEAQ...................... 385
302 0.000e+00UniRef50_A0A2M7UK76 Chaperone protein DnaJ n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M7UK76_9BACT  ali  33  2............................................................................................DYYETLGVSRSATPDEIKKAYRKLAQKYHPDRAGGD---AQKFKQVNEAYQTLSDDQKRAQYNQYGASFEQMRNQGQAGGFRDFRDFFDFSDLFGDIFGQSFSGRRRQN---RGADIDLEMAIDLEDAIRGAEREINVDKYSSCSTCNGSGVAPGSGFKTCPQCGGSGQFQNQQGLFSIKTICPNCQGQGKIPEKQCDDCRGQGRIKKKATIKFKIPAGIQTGQVINLSGQPGDLNIHIILRPHKFFQRSGDDLYFDVKARFTQLVLGDKIKVPTPQGDVWVNIPKSAQPGSQIRLRGKGVPHLQSHGAGDEIIRLILEVPRRLSGKQKKLLEELQQ................................................... 360
303 0.000e+00UniRef50_A0A2H6FTW7 Chaperone protein DnaJ n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H6FTW7_9BACT  ali  30  4.........................................................................................STKDYYEMLGVNKGTSQDDIKKAFRRLARKCHPDLNPGDKSAEQKFKDINEAYEVLGDPKKRADYDQFGKTPFEAGKGFAGFATGSGFDFGGTEDIFSDLFSGFG----QEEVSLRGNDLRTSLGITLEEAYRGVTKPIILTREAPCKTCGGSGAES---TRSCTTCKGAGVLQQKRGFFSMRQTCPACKGRGKTVTKACGACRGNGSTVVTEKIKVKIPAGADTGSRVKLGGPSGDMYIDLTVRPHPTFKRDGRDVYVEVPVTVGEATIGGKISVPTLDGNVSMTLPPGTDSGKKFRLKGRGIPNIRTGARGNEFVVIKIIVPKTVSAKTKEALQEVEKAYKDKKAASS......................................... 365
304 0.000e+00UniRef50_A0A2N6BCQ5 Chaperone protein DnaJ n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2N6BCQ5_9DELT  ali  35  1........................................................................................MARKDFYKTLGVSKDATEDEIKRAYRKLARKYHPDVNPGDKASEEKFKEISEAHEILSDKEKRAQYDQFGDSPFGGGGQQSWGGGGGFNTGGFDFDLFGNIFGQGG---AQPRGPRKGADLEYELEVSFTEAILGAQKEISVRRNASCQTCGGSGHEASGGGQRCPQCQGSGRVSVKLGPMTSQQPCPSCGGTGRTQGPPCKNCGGSGKNAKNERLRVKIPAGVETGSKIRIAGGDGDMLIRIKVAPDNRFTRQGNDIISEVEVPLSDALLGGHALVPTLTEQVKMKIPAGTQNGQRFRIKGKGVP-----GKGDLYAAIKVKIPRSLSAKAKETLESLREELKG............................................... 345
305 0.000e+00UniRef50_L8HJD7 Chaperone protein DnaJ, putative n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8HJD7_ACACA  ali  34  48..................................................................CSNHTHCGIRNHSTVSSFTAATRKEEDLYETLGVPRTASADEIKRQYYKLAMQYHPDRNKGDKKAEEKLQKINAAYTVLKDEDKRRQYDQFGSAAFDGSGGGGFEGFDPNDIPVDMRDI-FEGIFSGFGGGGGRRAKTKGDDVEVPLRINFHEAVNGCEKDISYMGKLPCPTCHGSGAAAGSKAKKCPRCNGQGIEQIAHGFIPIATQCRQCGGEGTIISDPCGTCKGQGIISGNRKIQVKIPAGVDDGANIRLGGKPGNLFLRVHVSPDKVFKRDGVNVHTDIPVTLAQAVLGGTVKVPTLSGEVEIKVPPGTQPEEKRVLRNQGVSAVGQPGKGHHYIHFKVEIPTKLTPKQKELMEEWQKEEEQSGGIADKLK...................................... 433
306 0.000e+00UniRef50_W2V038 Chaperone protein DnaJ n=1 Tax=Candidatus Xenolissoclinum pacificiensis L6 TaxID=1401685 RepID=W2V038_9RICK  ali  30  3...........................................................................................EDYYQILGVSKDADASAIKKAYYRLAREHHPDK-GGKP---EDFHKIKQAYDVLSNPERKANYDRFGTDDV--GGATGGSSDGNFGGGAEFTDIFREFFKTNDFGRTKESASARGSDLRYDMRITYNHAYKGVTMPISYTTQVMCTPCNGTGGKNGARQVNCGVCHGSGYSRTQQGFFTIERTCGTCSGTGKVIKDVCHQCAGQGRYKKQVNLDVKIPAGVDDGSKVRVAGKGGDLYIFITLEPHELFTREGSDLYCTVPVSMVTAALSGEIEIPTLTSNLKIQIPRGTQNGDTIKVKGKGMKKLNYNAYGNLIVKIAVETPVDLNSNQERLLQEFADASSTSSSPKSTKFLKKVKNF............................... 364
307 0.000e+00UniRef50_A0A125RDQ0 Chaperone protein DnaJ n=4 Tax=Methanobacteriales TaxID=2158 RepID=A0A125RDQ0_9EURY  ali  32  4..........................................................................................KRDYYEVLGVDKSADEKTIKKAYRNLARKYHPDVC-DEPDAEEKFKEVSEAYAVLSDDEKRQRYDKFGHAGMD------GFTAEDFYQNVNFEDIFGNIFDGGGSRSRGRTGPQRGSDIYTEVPITLEEAFNGCEKEIKITRSELCPVCKGSKSKPGVEPETCRTCGGTGQIKTFLGQMVNVRACRECGGTGKIITDPCDNCHGRGSVRKTKTIKIEIPEGVNEGNHLRVSGEGGDLIVTVHIKKHKRFVREGDHLYLDQQISFPQAALGDLISIPTIEGKVEFKIAPGTQSETVYKLRGQGMNSVRHNGRGNMYVTVKVVVPKKLNTKQKDLLKQFAEISGDEIKHV----------------------------EKGLFDRVKDA... 378
308 0.000e+00UniRef50_A0A1V6AA01 Chaperone protein DnaJ n=1 Tax=Firmicutes bacterium ADurb.Bin153 TaxID=1852883 RepID=A0A1V6AA01_9FIRM  ali  30  1....................................................................................MFKTAEKRDYYEVLGVDKSAGEAEIKSAYRKLARQHHPDANPGDPGAEERFKEINEAYSILSDSEKRSRYDRYGHDAERGGFGTGDFTDF------NPFDIGGAFGGFSGFGQSPRRGPVEGADIELMADLSLDEVLAGTERSFDLNRVESCPSCSGTGAKAGTRPQKCPKCNGTGQVRTFLGTMQSIMPCAQCGGTGSYVAEPCADCDGQGRLRRSATIKVQVPPGVDNGMVVRAAGQPGDALIHIRVKTHDKFTRQGNDLAQEQEISFPQAALGAKLTVPTLKEPVEIKVPAGTQAGKVLTVKGKGLPSVRGGSVGDMKVLIRIKTPERLSAKEKELYRQIAELGGYSVSDEQGVMDKLLGRRKR............................. 379
309 0.000e+00UniRef50_A0A2M8D1Q9 Chaperone protein DnaJ n=1 Tax=Acidobacteria bacterium CG_4_9_14_3_um_filter_49_7 TaxID=1973888 RepID=A0A2M8D1Q9_9BACT  ali  32  1........................................................................................MSNKDYYAVLGLPKGASAAEVKKAYRKLARKYHPDVNPGDADAEKRFKEISEANSVLSDPKLKEQYDTYGFVGDRAGGDFNGFGGFGGSGGVDFSEIFDMFNRGAGGFQSRSHAPRRGQDIQYSMKLSFEDAVNGVTSRIRVSRSKPCTTCDGKGHVPIARPTVCSRCNGTGRETAGGGLFHVQRPCSMCGGSGQIQEAQCNSCGGSGRNPISETINVRIPAGVDNGSKIRIAGKGGDLFIITNIEPHPFFRRVGDNIYLTLPVTVSEAALGCKIKVPTVSGITTVRIPPGTQCGQKIRIRGKGIKSLRTGTPGNMFLEITLQTPDTRNTRVRELLRELSEFENPDIRK........................................... 365
310 0.000e+00UniRef50_A0A132AMC2 Tumorous imaginal discs protein, mitochondrial-like 2 n=1 Tax=Sarcoptes scabiei TaxID=52283 RepID=A0A132AMC2_SARSC  ali  44  24.........................................QSRSFLSGTGLKKQPLKSACWSKILNHPTRKNNLNCLSFRYISTANILFAKDYYKILGVDRNASAKEIKKAYYELAKKYHPDTNKNDPNANKKFQEVSEAYQVLSDEGKRQQYDKYGGSGRDFNADTGAGGFSGFQGFSS-EDIFRQVFEEMRNFTGGGRS--FTEDMQIEMSLSFDEAVRGINKEVAIEVIDTCQRCHGSKSANDEKPIKCPYCQGTGMETISNGPFIMRTTCRKCHGTRVLIKNPCRECHGEGVTQQRKKIIVPVPAGVSDGQSVRMKVGNKELYITFRVSRSNYFRRVDSDVHSDLEINLFQAILGGTLTIQGLYENLTVKIKPGTQSHEKIRFAEKGIAKIDGRGKGDHFVHIRINIPKNLSKKQKALWLVLAEMDD................................................ 420
311 0.000e+00UniRef50_A0A1W9S3E9 Chaperone protein DnaJ n=1 Tax=candidate division Zixibacteria bacterium 4484_95 TaxID=1970781 RepID=A0A1W9S3E9_9BACT  ali  35  1..........................................................................................MTDYYKILGVSEDATTDEIKKTYRKLAKRYHPDANPNDKQAETRFKEISEAYNVLSDPKKKQQYDTYGAGRAQKGAAGFSFDGSRFTGFGSFADIFSSIFSEKGFGGGMADAPRKGDDILADIEIPFEDAVNGGKKTIKINIEQPCDRCHGSGVTPGSKATVCPECKGRGTVTFSHGSFAVSRPCPRCLGRGQITGNPCRKCSGRGKIFGPKVVKINIPSGIESGKKIRLGGPPGDLYLKIIVSGHQYFWREGKDIYCRVPISLRQAILGGKIKVRTLTKQVELKIPPGTSSGQRFRLKGLGLSV--NGVRGDQYVEVKVEVPKNLTEQQKQLFEKFAD................................................... 375
312 0.000e+00UniRef50_S6BFB9 DnaJ C terminal region domain containing protein n=13 Tax=Alveolata TaxID=33630 RepID=S6BFB9_BABBO  ali  27  1...........MVLSYPARMFLSCCISSQKRLCYRTLLIASPCNNTTSNRNFCTGYYPKEHRIISRHTGCIKNDSNRCHIRQLHTSRTRKNKDPYSVLGVSRNATNDEIKRKFRELAKKYHPDLNPS-PDAKQKMAEISSAYELLSDPKKRQVYDQTGMNAGDGGYDPTAGFSGFGDSSFMFTD-FAEMFSRMAGGHGNNNGTSRGDDIQTEITISFMEAVKGCSKNINIPARVACGDCKGLGRQPGTNIEVCKVCNGTGVQRMERGPIIIGVPCRSCSGTGQVIAHPCRACGGSGDRAQTKSVNINIPAGVRQGMQMRVPGKSGHLFVNINIQPHQIFKWIDDDIHVHIPISLKQCLLGGNVVVPTLDGHTELTLTPNSQPFFIKTLINKGPPKIDSRNNGNLIVHLELKLPDQLTPKQRELVEEFDKESSSCTKGQKGVNNQSNGTDSN............................. 451
313 0.000e+00UniRef50_A0A150V790 Uncharacterized protein n=3 Tax=Eukaryota TaxID=2759 RepID=A0A150V790_9PEZI  ali  31  273.GATGATPLRLLALTRPRPHERRQTCLQHQQRYXXXXXXXXXXXXGPYCTRRPRCSPPSTHLPRRSYNLNNQKSN---HRRSFHTAPSHQAKDPYKVLNVPPTASASEIKKAYYGLAKKYHPDTNK-DAQAKEKFTEAQQAYELLSDEKKKAAWDQYGAAAFDQQGGFDPSGGGGGGGGFNFEDLFSAFGAGARRGRGGRPFQEEGENIEVQTNISFMDAAKGVRKDITVTPLSRCRTCDGTGMKKGISRTACGSCDGTGRVHFMQGGFQMASTCGSCGGTGSKVPKECGTCRGQGAVRERKTVTVDIPGGVEDGMRLRVVGEGGDLYVFIRVAPDAKFQRSGADVLYTATIPLTTAVLGGEIRVPTLDGEVKVKVATGTGTGDKITLSGMGMKKLSSSSYGDLHVQYKVQMPKYLSANQRMLVEMLADEMGDKSAK-----------RVMNLDQMKKTAAADAHKNEGFLKSMWH.... 784
314 0.000e+00UniRef50_R9YIB8 Chaperone protein DnaJ n=1 Tax=Candidatus Tremblaya phenacola PAVE TaxID=1266371 RepID=R9YIB8_9PROT  ali  33  1........................................................................................MRKRDYYEVLGVGRDASAEDIKRAYRKLAMKYHPDRNQESK-AEEQFKEVREAYETLSDVQRRNTYDQFGFQSVGRGSGVNESADQDVGSFSSFGNIFEDIFGQSTRSSKNQRARERGSSIHQKVELTLEEADSGKEVDVVISHSVSCQNCKGSGIKRGTKAKTCNACGGYGAVQMSQGFFRVRQTCSACNGTGTVTPHNCSNCRGTGRTKTKESVLVKIPEGVEEGSKIRIQGYGGDLIIEVTLKPHPIFERRGCNLHCNVPIRFGIAALGGSLSVPTLTSNVVFEIPEGTQSHRTFRLRGRGAKDTRLGGFGDLHVQVLVEVPSQLTENQKSLLLRLESTIGDN.............................................. 355
315 0.000e+00UniRef50_M1V8S0 Probable chaperone protein DnaJ n=1 Tax=Cyanidioschyzon merolae (strain 10D) TaxID=280699 RepID=M1V8S0_CYAM1  ali  33  27........................QCLRQVRTSPSSGVL-PLDAVPARPNAVWSAPVGTLQSLQRCACQGRTHTRSLSVVSTSAAGSTAVARDPYEVLGVPRNATLAEIKKAYYRLAKEHHPD-SGGDKS---KFAEINAAYELLSDEKKRKQYDRYG---FREDGEGASASGFEYAPGSGAEDIFREFFGGAGPMGSGFGFFARGADVEVPLVLSFMEAARGTEKTVQVSAAVECRACRGTGSSGGTEWSPCAQCGGTGQESYQRGFFAFQSTCRRCGGSGRRLRNPCSTCTGSGVTPGLRRVAVRVPAGVDSGYSLRVSGKPGDLYVRIQVEDDPYFHREGPHLHVVAPISFADAALGGAVRVRTLDGEAEVKIPPGTQPDDVRVMRAKGLPRIGTAERGNQYVHFRLRVPTSLTSRERELIEELRQIE-------------QQRRGNRPSEAAYDSDANEEAGSKNFFRRLKSLF.. 485
316 0.000e+00UniRef50_A0A140DYQ3 Chaperone protein DnaJ n=5 Tax=Erysipelotrichaceae TaxID=128827 RepID=A0A140DYQ3_9FIRM  ali  33  5..........................................................................................KRDYYEVLGVSRTATEEEIKKAYRKLAMKYHPDVNK-EPDAEDKFKEINEAYEVLGDEQKRANYDRFGFAGVDGGFAGGGAGFRQATGGYGFEDFFGSMFGG-GQTRRRANQPMQGEDHYRQMAIDFMDSVHGKTETVTLDVEEPCEHCHGSGAESPEDIETCSKCHGSGRVVQSFGTMQQQSVCDRCGGTGKVVKERCHECHGQGHVRKKVKLDIKIPQGIQSGQQIRIPGKGGDLYIEIMVRPDARFKRVGNDIFTEAELPVLDAILGTTLSVDTVNGPVDLKIPEGTQPGQRFRLKGKGVTS--RTGQGDQYVDVNVQIPRRVSKKEREAYEQIRK................................................... 359
317 0.000e+00UniRef50_Q01PM9 Chaperone protein DnaJ n=10 Tax=Acidobacteria TaxID=57723 RepID=Q01PM9_SOLUE  ali  31  5..........................................................................................KHEYYETLGVPRKADAEEIRKAYRKLARKYHPDLNPGDKSSEERFKNVQEAYDILSDPKKRQMYDQFGFYSENGGYPGAXXAHFDGFDFSDFRDIFSQFFGG--GAAAEQAEPERGADLEYVMNIDFWQAIKGTTARVNITRYDVCTTCNGTGS-TGSGEVTCPQCKGVGQVTQMAGAMKFNLTCPRCGGAGKL-RNACPTCGGDGRVPKTETVEIRIPPGARDGSRLRVAGKPGDLYITTKVEPHQFFHREGDNIEIKAPIAIWEASLGAKIEVPTIDGRTLLKIPQGTVNGQKFRLREKGVLNSRTNQRGDQIVEVQLTTPDPRDEKTRQLLRDLAELHPEDPR............................................ 389
318 0.000e+00UniRef50_A0A2G0V6T6 Chaperone protein DnaJ n=1 Tax=Candidatus Tremblaya phenacola TaxID=1010676 RepID=A0A2G0V6T6_9PROT  ali  32  1........................................................................................MSERDYYEVLGLDRKSSDEEIKKSYRKLAMKYHPDRN-ADSSSEACFKEVKRAYEVLSDRRKRALYDQYGHS-LGEQSAAGDMGHGFGGFTGTVEDIFADFFGGS-SSNRRKKRVNRGTDVFAKAELSLEEAIRGHEVKVHLSRHILCNACNGAGTKAGTKPKTCTSCAGLGVNHISQGFFSIQQPCTSCHGVGTVITNPCVSCKGSGRIKERKRLSVKIPSGIESGMKVRVSGHGGDLFVEVNVKQHQLYERNGSDLHCHVPIKFTVAALGGDISIPTLLGNVTFNIPEGTQNNRIFRVKDKGAKSIRSNMNGSLYVHVLIEVPIKLSEYQRSILMEF--------------------------ERATRDELKHSPMQKSWLEKLK..... 367
319 0.000e+00UniRef50_A0A1Q7YS68 Chaperone protein DnaJ n=34 Tax=Bacteria TaxID=2 RepID=A0A1Q7YS68_9CHLR  ali  31  5.........................................................................................AKQDYYELLGVPRKATAKDIRTSFRKLARKYHPDLNPGDKSSEEKFKQLQEAYDVLSDSKKRQIYDQYGFYSDNMPPGGPGAGPGQDGEAPDFRDLFSQFFSGSRGSTAMEPEHEPGGDLEYQIEIDFWDAVRGAVKKLSITRLDTCETCHGTGAV--GSPQTCPTCHGTGTIQQQAGKMKFNVPCTRCGGTGKL-RTVCKTCGGEGRVRRTETIDVRIPAGVANGARVRVPGPPGDLYLRVVAKPHEFVERRGNDLYTKIPVTVSEATLGAKIEVPTIDGRSLVRIPPGTNSGKTLRLKEKGVPSARNGARGDQYVEIQVVVPPPTDERVRNLMKELESVAPGDPRK........................................... 380
320 0.000e+00UniRef50_A0A2J6GXV0 Molecular chaperone DnaJ n=2 Tax=Candidatus Woesearchaeota TaxID=1801616 RepID=A0A2J6GXV0_9ARCH  ali  33  1........................................................................................MSKKDYYESLGISKDASKEEIKKAYKKLAKKYHPDLNKGDPKSADKFKEINEAASVLTDDKKRANYDRFGTADEQFQGFGGGSXXXXXXXXXXXEDIFESFFGGGGRRSRKRGGPIPGDDLRFSMTITLNDAYEGIEKEIRYNRLGTCTTCKGKGAENPDDIETCEMCGGAGQVRTPFGVFQTTKTCPTCRGEGRTIKNPCKTCQGDGRVDEKKTLKVDIPAGIDEGQSLRINNEGGDLYVQISIKTHKIFERHGRDLYMEMPISITQAAIGGTIEVPTMKGKSTLKIPSGTQSDTVFRMKDKGFPTIGGSARGSQMVKVIVEIPTTLNKKQKELLEEFEKASESPQKK--------------------------------FFDKIKNMF.. 377
321 0.000e+00UniRef50_A0A256XYS2 Molecular chaperone DnaJ n=1 Tax=Candidatus Woesearchaeota archaeon ex4484_78 TaxID=2012531 RepID=A0A256XYS2_9ARCH  ali  37  3...........................................................................................KDYYKILGVSKNATKEEIKRAYKKLAKKYHPDVNK-DSNAAEKFKEISEAAAVLTDDQKRAQYDQFGSTGPAGRGSGFDFREFASGFGFDFGDLFEDIFSGFGFGSRKRKRPRRGQDLITKIKISLEEAYKGTTITLPVQKSETCKACKGKGYE---HFETCKKCGGRGVIRTPFGIFSTTTTCNECQGTGEIGKNPCKKCHGEGVVFVKKDLEVKVPAGIYSGMKLRLEGRSGDLYVIVEVKKDKRFTREGNDLHTELPISFATACLGGEVMIDTFEGKEKLRIKPGTQDHAEIIIKGKGMPELNGRGKGNIIAHISIIIPKKLSKKQAELLREFE.................................................... 352
322 0.000e+00UniRef50_A0A0S7Z721 Chaperone protein DnaJ n=17 Tax=Bacteria TaxID=2 RepID=A0A0S7Z721_9BACT  ali  32  3............................................................................................DYYQLLGVPRDADAEQIKKAYRKLALQYHPDRNEGSKEAEERFKEVTEAYEVLRDSEKRALYDRYGKQGVRGGGA--HAPGGAGFDFDDAISIFEDLFG-TRGARGQRSSARRGKTVRIRLPLTLSEVATGVSKTVRVSLLDECDACEGSGAEAGTSPTTCRTCGGSGEERHVQGQFVSVQPCRTCGGEGRTIERLCPKCSGDGRVRSEREIEVEVPAGVTSENFLTLRGRGGDLVVLLEVQSDPRFVREGSDLVHELLVTFSQAALGAEVEVPTIDGMARVKVPAGIQGGESLRLRGLGLPELNETLRGDQIVRVLVWTPTDLTSDQRDAIERLAEVEHGAPATVRRGT------------------------HKGFWSRVKEAFT. 388
323 0.000e+00UniRef50_F4NXT4 Uncharacterized protein n=2 Tax=Batrachochytrium dendrobatidis TaxID=109871 RepID=F4NXT4_BATDJ  ali  30  2......RTLQIQLLQPLVRPGYKPAALSVVGSTVQLSNSSFHCSIKPIHNNLKLCSA-NTLNDRPCCSIILSHN-----RRLHATASSMAKRNPYDVIGVSKTSTANEIKKAYYQLAKQYHPDTNK-DPSAKEKFVEIQHAYEILSDEQKRAQFDQYGNVDDSSRQGFPYGFSGFGGESADFGDIFDQIF-QKFGGQSNARGASTGESVLAGTRLSFMEAIKGAKKSIVFVGIRGCAPCSGSGTKPGHKKTTCITCKGSGQMSLHRGGFQMFTNCPTCGGLGTSIEAKCTSCNGAGLVRERQSVTVDIPAGVEDGMKVRISGQGGDLIVTVQVAGHPIFKRDGADVHIQATVPLHIAILGGSIRIPTVDGDVDLTIPPGTQPNERKVLRQRGAPNVGSSSRGDQWVTLEVEIPKSLTSEQKRLMME---AFGAKSTTSTSDGSSNYNKSDTSPRATSSDDTSGSSKEGGFMQFFKDLAG. 495
324 0.000e+00UniRef50_A0A2E9U609 Chaperone protein DnaJ n=5 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E9U609_9BACT  ali  28  3.............................................................SARRTLARSWRLTLEYWQKR---TKPTMGDRDFYQILGVERTASKDEIKRAYRKAALRYHPDRNPDDAAAEESFKEAAEAYSVLGDQEKRSNYDRFGEAGLRGGQG------FNADIFADFSDIFGFGGAFGGMGRSQRSSPGQGTSLRIQLDIDLSEAISGVEKQISVRRHVACEACGQSGSESGTAPTVCGHCGGSGAVQQRHGFLAIAHPCAACSGTGRTVSDPCGICRGEGRVEDNSELSVRVPAGIDTGSRLLLRGEPGDLEVLIAVSEHPVFARRGKDLFTRVAVSFPMAALGGTVDVPTLDEEATLPIPAGVQGGEVFEIRGRGMPPVNGGRRGSLRVAVQVVTPSRLSSEQRALLEQLHKITEEPELKDEADSW..................................... 389
325 0.000e+00UniRef50_A0A1V5ZVE4 Chaperone protein DnaJ n=5 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V5ZVE4_9BACT  ali  32  2............................................................................................DYYETLGVPKDAKPEQIKEAFRRLAQKYHPDKPGGD---AAKFKEINEAYQVLSDAQKRAQYDQYGSAFTEAQQKGGFSGFEGFNDFFDLGDIFSDFFSFGSSRGARQRSAQTNRDIILPLTLEFEEAALGTEKEISFSRFEPCSECQASGLAKGSKMKTCSYCQGQGQIRQNFGTFSQVSTCPECQGTGQMPEKKCPKCQGEGRIKNTSHTKVKIPAGVNDGGVIKFVGQGGTLYLRIKVKPHPIFQREGDDIYLTQEIPLTTAVLGGKIEVPTLEGKVFLKVPEGTNFGQEFILRGKGVPHLKGRGRGNEIVRLTIKIPKHLTKKQKQLFENL..................................................... 368
326 0.000e+00UniRef50_A0A2E0B6R4 Chaperone protein DnaJ n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E0B6R4_9CHLR  ali  33  1.......................................................................................MVKKKDYYELLDVSRSASEEDIKKAFRKLALEYHPDRNKS-PDAADKFKEINEAYQVLSDSDKRSVYDQYGHAGLESNGSGQSGFSGFGDIGGFGDIF-DTFFGGFGS--RQRSRKRRGDDLELTKNISFEDAALGADIPVKLDRREFCQQCAGKKMEPGTNISTCGSCGGTGQXKRSFGQFMQVAECSXCSGSGELXETPCKXCKGRGYEXQIRDLNIKIPAGVDDGSRIRLTGEGGDLYXLLQVSNHKXXKRENXNLHYTLNLSFPEAALGTKVXIPTXEKTIDLKIDPGVQTGSLFRIRGEGVPMLNRKGRGDLLVEIVVSTPKKLNKDAKELFKQLAEHXXIPLDSKEG........................................ 362
327 0.000e+00UniRef50_A0A2I0NE05 Chaperone protein DnaJ n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A2I0NE05_9SPIR  ali  34  1.........................................................................................MKKDYYELLGVGRSANEQEIKKAYRTQAMKYHPDRNPGNKESEEKFKEVSEAYEVLSDAKKRKMYDQFGHAAFQQGGGAPGGGGGGRGYNFNFTDIFEDFEDIFSRRKSSGPRVQKGRDLLVELVISLEDAFAGITKTIKVNRNEECGTCHGKGTEKENDVVTCPKCNGRGETVVNQGLFTIRQTCSRCGGAGVVIQNPCKTCGGKGTVQKNREIKINIPAGVESGTRLKMTGEGGDLYVDTHVQPHSLFERRGADLYTKARIPFAVMTLGGEISVQNIDGTVKLKIPEGTDSGQIFKAKGLGMPSVGYFRKGELYVIVDVEVP................................................................... 347
328 0.000e+00UniRef50_A0A2G6KHB2 Chaperone protein DnaJ n=2 Tax=candidate division KSB3 bacterium TaxID=2044937 RepID=A0A2G6KHB2_9BACT  ali  30  12........................................................................................AKTTNYYKILGVSEQSDEASIKRAYRQLALKYHPDRNPGDQFAEDKFKQVTEAYRILSDAQKRADYNRI-RAGTAHESTFNTSYRSRNTNFEDVFDTFDNFSSGKSKASSRKQQPIRGADLKYEVTIPFEQAVLGTTTVIEVNRLDQCQRCRGTGIEPRTYPMLCPTCLGKGRVRQSHGFLGFTQVCPDCNGSGRVYQKECSQCRGDSRVLQKQKISVRIPANIHDGTSLKVAGEGGDLFIHVHVQEHEFFSREDHDIWCEVPLSMTQAALGGIIEVPTLEGKVRIKIPAGTQCDRVFRLSKKGAPSSKKDQRGDLFVKVKIEIPTNISQRQRQLLEEFARLNGETISRSPSK....................................... 374
329 0.000e+00UniRef50_A0A2M7TQ00 Chaperone protein DnaJ n=1 Tax=bacterium (Candidatus Torokbacteria) CG_4_10_14_0_2_um_filter_35_8 TaxID=2014297 RepID=A0A2M7TQ00_  ali  33  1.........................................................................................MAKDYYEILGVSRDVSQEEIKKAYHKLAHKYHPDRGGD----EAKMKEVNEAYATLRNPKKRGQYDQLGQT-FDGAGASGFPGGFDFSGFFDFSDLFSSVFDDFFGRDREGEREARGSDLEMEVEISLKDAVFGTEKEVEINKYVTCRKCSGSGTEPGSKVITCQKCGGSGRINTFFGTFSTITTCPNCEGEGKIPEKKCTECGGIGRVRSQESLKVKIPAGISDGQSVRLRGKGGDLYVTIRVKPNRFFIRRGFDLDCVVPISFVTATLGGVVSILTIDGKVDLRIPAGTEAGKNFRIRGKGVSLMNSSGRGDQIVEVQIETPKKLSQKAKRLLEEFNNEISNNRKQK.......................................... 370
330 0.000e+00UniRef50_A0A2H5WKA3 Chaperone protein DnaJ n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5WKA3_9BACT  ali  30  5...........................................................................................KDYYAILGVPRNATEKEIKAAYRKLARQYHPDVNPGDKEAEEKFKEINEAYQVLSDPEKRAAYDRYGEQWYGEGFQPEGGFGGMPFGFESFADFIEQLLRGGGGFRATGFHAPP-RDIEQTIEIDLQDAIHGATRTLQLNLEEVCPRCGGLG-ELRDHQQTCPACGGRGRKRFSL--LGVEMPCDECEGTGRV-SALCPTCGGSGVVRRTRTITVKIPPGVAEGQRLRLAGEGGDLYLRIKIKPDARFERKGNDLYVDVDVDYLTAILGGEVSVPTPNGTVTMKVPPGTQSGTRFRLAGKGIP-LGQGKRGDLYARARIVVPRSLTPRERELLEQLRQLRQQEVK............................................ 360
331 0.000e+00UniRef50_A0A2H0PM35 Chaperone protein DnaJ n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_45_16 TaxID=1973974 RepID=A0A2H0PM35_9  ali  29  1.......................................................................................MATKRDYYEVLGLERTADEVVIKKAYRKLALEYHPDRNQGE-EAAEKFREAQEAYDILSDNEKRSLYDQFGHAGLKGR-----FSTSGFGQGEDIFEGFQTIFEDFFGGGRRQRQSQRGRDLRYRMKIGFWEAVQGVKKTIEIERAQSCSICEGSGCEKGYKAETCPTCDGRGQVAVRQGFFSIAQTCPHCEGEGRIIKKPCKTCKGRGLEQKTSELEVNIPAGVDTGIRLRLQNEGGDLYVEIEVESDPNFERDGADLYTRVYIPFSTAVMGGTIDVPSLQGNKSIKISKHLKTPHVEILKNEGVQDLRSDRRGNLYVELQIHTPEELSERGQEILKELEQEL-----------ISEASDKTKNENSKKTSSKNKSKKKSGFFGGV...... 379
332 0.000e+00UniRef50_A0A0K9QPI7 Uncharacterized protein (Fragment) n=3 Tax=Spinacia oleracea TaxID=3562 RepID=A0A0K9QPI7_SPIOL  ali  30  2.................................................ASNGLLASSCSTIFSPDCSHTFLSSRQHKDSYDFKRSHPHAGKNYYSVLGVAEDARKPEIKTAYKRLARTYHPDVNK-DPGAEQRFKEISNAYEVLSDEEKRSIYDRYGEDGLKGGPSMGGG----------FSSIFDELFDGMGMGGNFRNGYSEGEDLAYSLRLDFREAVFGVDKDIEISRLEDCPTCEASGTKPGSKSYICKTCNGNGQIRTPFGIVQQALSCPDCDGMGER-STPCNKCRGDGRMKKPKKITVNVPAGVDTGNKIRFGGPPGDLFVVFEVREDPVLRRDGNNILYTCKVSYLDAIMGTVKKIPTVDGMSDLNIPPGTQPNVTLLMTKKGVPFVNKSKRGDQLVKVQVEIPKKLNDEERKLIEELINLNKAKVPS........................................... 398
333 0.000e+00UniRef50_A0A2U8BSJ8 Chaperone protein DnaJ n=1 Tax=Candidatus Fokinia solitaria TaxID=1802984 RepID=A0A2U8BSJ8_9RICK  ali  30  1........................................................................................MSDKDYYKVLGVSRSADTDEIKKAYRKLAMQYHPDRNNGDKKAEQKFKEINEAYETLSDSTKRASYDKFGSAGAGHGFSSANSSHDFSDFSDFFSGIFNEF--SGGRRQKKRPMESPGADLKYDLSITLEDAYNGKKHPIEFRSYVRCGDCTGTGGKNGDKFIECSHCKGSGTMQYQQGFFAVQNTCKYCNGCGYDLKNPCPTCKGTGRVQKDRSISVSIPKGIRSGDKIKIQNEGGSLFVFIEVMGHEFYKRNGNDLECEVPVKFHVAALGGEVEFYNIDKNIKIQIPEGTQSSAVFRLKQKGMPVVNYSNYGDLYVRIKVEVPTKLTESQKDILKHFAESTQDN----------------------------SYPSVTGFFSRIRDMF.. 371
334 0.000e+00UniRef50_A0A1W9SSM2 Chaperone protein DnaJ n=27 Tax=root TaxID=1 RepID=A0A1W9SSM2_9GAMM  ali  31  1........................................................................................MAKKDYYQILGIPKSAEEREIKKAYKKLAMKYHPDRNQGDKTAEGKFKEIKEAYEILINEEKRSAYDQYGHAAFENGQSN--STYSTFTNSADFSDIFGDVFGDIFGGNRT-QRAKKGADLCYNMEITLEEAVKGIKKEIQIPTLQKCKTCYGSGTRTGTKPRSCSTCHGKGQIHIRKGFFTVQQSCPTCHG--------------------------------NTNDRIRLNNEGGDLYVQITVKKHPIFEREGNNLYCEVPINFTMAALGGEIEVPTLDGRVKLKIPYETQSGKLFRIRGRGVKSVQNRNQGDLLCRVVVETPVNLNEQQKNLLHEL------------------------GNSFHGFRGEKNSPRSKRFFDGVKRFF.. 340