current user: public

If you have questions about the server, please let us know.

Query: IDP92795 gene: csy2; Csy2 [Vibrio phage ICP1_2011_A] AGG09392 [Vibrio phage ICP1_2011_A], from CSGID

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# E-value Template Links and tools%idFirst MRKFIIVKNVKVDGINAKSSDITVGMPPATTFCGLGETMSIKTGIVVKAVSYGSVKFEVRGSRFNTSVTKFAWQDRGNGGKANNNSPIQPKPLADGVFTLCFEVEWEDCAEVLVDKVTNFINTARIAGGTIASFNKPFVKVAKDAEELASVKNAMMPCYVVVDCGVEVNIFEDAVNRKLQPMVNGYKKLEKIVDNKHMRDKFTPAYLATPTYTMIGYKMVSNVDNFDQALWQYGENTKVKTIGGIYNDLast
1 4.000e-79UniRef50_A0A2M8H1A2 Type I-F CRISPR-associated protein Csy2 n=25 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2M8H1A2_9VIBR  ali  20  2..RLLILPHIRIHNANALSSPFTIGFPAMTAWLGFTHALERKLNQAFDSVAVVSHQFDLQTHKGEGDFVHSIIGTGNPLDKDGSRSAFIEEARCHLDVSLVIEYRGNDDEDDFAQRLQDMVVTMKIAGGDILSLQRPVLVDEEDEQETAKLLRQLMPGYVLVERRELMERSQRKASGWIVPIATGFQGISPLGQAKNQRDPTVPHRFAESIVTLGEFVMVHKIKHLDEILWCYDLDNDLYLCQQ.... 289
2 1.000e-77UniRef50_A0A2E0A0F0 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Oceanospirillaceae bacterium TaxID=1899355 RepID=A0A2E0A0F0_9GAMM  ali  18  1MSQYLLLKGIEVQNANAISG-MTWGFPSPSHFLGFVHALSRKLKVQLGGVAIICHSHEVQA-QKPGGYESVFSLTRNPLTKDGKTAPFNEEGRMHMTVSLIIEVKGEVGDINADQTIKDLAPRHRLAGGVIIKHISWVDALGMDDKKLRRMMLRLLPGFVLQDRTDRLIGHYEPEKGWFVPVAVGYKAISEPGEVKNARDNETPFCFVESVYGLGQWISPHRVEDLKDIIWSYSVEDDLYLCRAGRKD 314
3 6.000e-77UniRef50_A0A2A9FQN5 CRISPR-associated Csy2 family protein n=1 Tax=Marinobacter sp. LV10R520-4 TaxID=1761796 RepID=A0A2A9FQN5_9ALTE  ali  18  1MKSLLILKHVQVQNANAIAG-LTWGFPGITNFLGFTHALSRKIGVRFDGCAVVCHSHQVQAHQPTPYGEYVFALTRNPLTKEGKTAPFNEEARMHMDVSLVIECDDSENTARFENELARKIPMMRLAGGTIQAIQGVEFKYDERSKEFRKSMLRLLPGFMLVDRSPLLHEHLSPGEGWLVPITTGFKAISPPGEVANARDPSVPFRFVESAYGVGQWISPHRLRDISHIFWRYQQDGDWYLCKNDYQ. 318
4 2.000e-76UniRef50_J1Q1G3 CRISPR type I-F/YPEST-associated protein Csy2 n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=J1Q1G3_9ALTE  ali  18  1MSNYILLEHIKVQNANCIAG-FTYGFPAITHFLGYTHALSRKLGIELTGCAVVCHQHQVQAYQPGGWGDYVFALTRNPLTKEGNTAPIVEEGRMHLTVSLILESSSGAQQQQLVETLTVLAQRQKLAGGQVSCLKGVSLYSDDDEQALRKLLRKVLPGFVLTDRSELLKQHYQPDKGYLVPITTGYKAISPAGAVANSRDPQYPFCFVESAYGVGQWLSPHRVPDLRDVIWRYRQQGPWYLCT..... 300
5 2.000e-75UniRef50_A0A2A5EY45 Type I-F CRISPR-associated protein Csy2 n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2A5EY45_9PROT  ali  21  1MKDILLIPNIKVHHANALSSPYTIGFPAMTGWLGFMHALERKLKVKFTGIIISCLEFYLHTYKGRGDYVHSIVASSNPLDKAGKRPSFIEEARCDMEVTLAIECEGVLDYDKLTSFIDNTLHTMKIVSGDILSF-KPSKHLEVDNDEPRGLTKYLMPGFCLVSRQSLMEEVMNKESGWIVPIAVGYQGISELGLLKNTRDATTPHRFAESVVTLGEFKMPYHFENIDDMIWRYQAYQGDYLCKNNY.. 288
6 3.000e-74UniRef50_A0A0S2TF84 Type I-F CRISPR-associated protein Csy2 n=9 Tax=root TaxID=1 RepID=A0A0S2TF84_9GAMM  ali  19  5.KALIVLPRLQVQNANAVSGPLTWGFPSPTAFSGFVHALERRLEEGFGGVGIVCHKFEPQVSQPAGKYTRVFNLARHPVGKDGKTAAIVEEGRAHMEVSLVIGLNDEEDREAFLSELNRTLYLQRLAGGTLLPPQYWSLPIDRQSQDFMKLRRRLLPGFALVQREDRLQQRLAKNPGWLVPIPVGYASISPPGEVRNARDNETPFCFVENLYSLGEWVSPHRITTLQQLLWHQQADVE-KGIYRCSN. 309
7 3.000e-74UniRef50_A0A0X8LIL0 Type I-F CRISPR-associated protein Csy2 n=99 Tax=Bacteria TaxID=2 RepID=A0A0X8LIL0_VIBFL  ali  20  4....LILPHLKIHNANALSSPFTIGFPAMTAWLGFVHALERKLDLMLHSAAVVSHRCDVQTHKGEGDFVHSIIGTGNPLDKDGSRSAFIEEARCHLDVSLVIEWSGNEEQVEFTEQLQAVIATMKVAGGDVLSIGKPSIKSVITEQDTAQVLRQLMPGYVLIERRDLMLESQRKTSGWIVPIATGFQGISPLGTAKNQRDPSVPHRFAESVVTLGEFVMAHKIKHLDDILWQYNPD----LENGLY.. 283
8 5.000e-74UniRef50_A0A1Y1QCP2 Type I-F CRISPR-associated protein Csy2 n=2 Tax=Bacteria TaxID=2 RepID=A0A1Y1QCP2_9GAMM  ali  18  1MKQYLLIKRLQVQNANALSSPFTYGFPAVTAFLGFAHALQRHLNLHITGIGIVNHAFTMQDHQE--GYSRTLRLTANPLDKDGSRPSFVEEGRCHFTVSLVLEVDENGLDDELKERVAELILRMKLAGGDILPLENAEKKIYLIPNDSKGL-RSLMPGYALIERRDLMIAAMQQGQGWLVPIATGFHALTAAGVAEQQRDSDTPHRFAESLVTLGEFVMPYRLDNLAALVWRYRYDGDFYTCTQ.... 284
9 5.000e-74UniRef50_L0MDI2 CRISPR-associated protein, Csy2 family n=2 Tax=Enterobacterales TaxID=91347 RepID=L0MDI2_9GAMM  ali  20  1MSSLIVLRHVRVENANAIAG-LTYGFPAISHFLGFTHALSRKLGLTLDNCGVVCHQQQLQAYS--SGYDKVFALTRNPLTKEAKTAAFNEEGRMHLTVSLVMECNGEAGAQALADELQRLSLTQRLAGGTIVDIGSVVLAYPSTPAALRRITRRLLPGFTLLDRSELLYSHYQTLRGYLVPLQTGYRAISPPGEVKNTRDAATPFRFAEALYGVGEWRSLHRISDLPQMLWQYQHEDDCYLCRG.... 295
10 9.000e-74UniRef50_A0A1I3GFU5 CRISPR-associated protein Csy2 n=2 Tax=Nitrosomonas sp. Nm34 TaxID=1881055 RepID=A0A1I3GFU5_9PROT  ali  19  2IRRFLLIPRLQIHNANAMSSPYTIGFPAMTAWLGGVHALQRYLNIELISVAVSCHRFDLQSYKGRGDFVQSIVGTANPLDKDGSRPAFVEEARCHLEVSLLVELEGTDEQDRFEVLVNQKLRQMKWAGGDVLAVTDVKVYDENDEQSVKKLLNRLMLGYVLIERRELMVQALHEEPGWLVPIAVGFHGISELAQAANQRDNQTPHRFAESVVTLGEFKMPYRISNLDDVLWQYHADTNLYLCQTL... 293
11 3.000e-72UniRef50_A0A0W0WLP8 CRISPR-associated protein Csy2 n=25 Tax=Bacteria TaxID=2 RepID=A0A0W0WLP8_9GAMM  ali  16  1MKRILLLPYLRIQNANALSSPYTIGFPAMTSWLGAVHALQRQLNQQFKGVSVVSHEFKLNTFKGHSDYVYSIIGTGNPLDKNGERSAFIEEARCHLTVSIVIEYSGKDDEDKFINILYAQMHRMKFSGGDFLPFEKPEILKIGEDKDYRKLVRKLMPGFVLVERRDLMWTSGRKTSGWIVPIATGFHGISPLGQAQNQRAPDIPHRFAESVVTLGEFKMLYRIKNIDDMLWHFDIENNLYLCQ..... 291
12 5.000e-72UniRef50_A0A0W0WE72 CRISPR-associated protein Csy2 n=5 Tax=Bacteria TaxID=2 RepID=A0A0W0WE72_9GAMM  ali  17  1MKSVLLIPYIKIQNANALSSPYTIGFPAMTAWLGAVHALQRQLDTFFKSSAVICHDFVLHIHKDEGDFVYSIIGTGNPLNKLGERSSFIEEGRCHLIASLVIECEGVKEEVTFIKTIENELQTNKISGGDILELKTPEILKIAEEKDLKKLVRRLMPGYVIIERRDLMVEAMANSQGWIVPIATGFYGVSALGKAENQRDPTILHRFAESILTLGEFKMVYQIRHLDEMLWHYHVEKDLYLCQQN... 289
13 7.000e-72UniRef50_A0A2A5H9H5 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Alteromonadaceae bacterium TaxID=1916082 RepID=A0A2A5H9H5_9ALTE  ali  20  1MSHYLILRRIRVQNANAISG-LTYGFPGITNFLGFAHALSRKLEVSLGGVGVICHQHEVHARPPKGWGDVVFALTRPPLTKEGNTAPIIEEGRMSMEVSLIIECHGITCGDEYEQALAEIWPRLRLAGGQIIDIRSAQIKDFSEPQDSLRMLRSLLPGFVLVDRSEYLQEHYQPKSGYLVPMTCGYRAISPPGKVDKVRDTEVPVAFAEAAYSVGEWLSPHRITNLEDILWQYRFQAPWYVAKS.... 305
14 9.000e-72UniRef50_A0A1J5U4J5 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Bathymodiolus thermophilus thioautotrophic gill symbiont TaxID=2360 RepID=A0A1J5U  ali  19  1MKRILLIPRVKIHNANALSSPYTIGFPAMSGWLGFMHNLQRILNIKFNGVAVSVHEISLHTNKGENDFNYSIISKRNPMGKDGKPTAFIEEARCDLEVSIAIEYENIDPREDFYQKLTSTLHQVKIVSGDVMGFNEIKVLTIKEEKDFKNFIRYLMPGFCLVSRQDLMQQEMQKKNGWIVPIAVGFQGISDLSEIKNSRDNQTPHRFSESVVALGEFIMPYRFDNIEQLFWRYKLDAENNL....... 281
15 1.000e-71UniRef50_A0A1W1HHP2 CRISPR-associated protein, Csy2 family n=1 Tax=Desulfamplus magnetovallimortis TaxID=1246637 RepID=A0A1W1HHP2_9DELT  ali  18  6....LILRHIKVENANAVSG-ITWGFPAITNFMGFVHSISRELNLKLTGCGIVSHSHQIQSHQPKGWGDHVFALTRNPLNKNGTSPSFVEEGRMHMDISLIIPVVGDGDVTEICSRIRDIVLTKRLAGGSIWDVASIDLEEPPDDIKIRKQMKQLIPGFVLVQRSQLLTEHSEPGKGWLVPIMMGYRAISDLGEVARTRDTTTPFRFVEAVYSIGEWLSPHRLQNFEQMLWRYDAQPDWYLCKNNYN. 310
16 1.000e-71UniRef50_A0A2D6QMC8 Type I-F CRISPR-associated protein Csy2 n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2D6QMC8_9GAMM  ali  17  4INSLLVLPRLQVQAANAVSGPLTWGFPAPTAFTGFAHALERRLIAEFAGVGIICHRFEPQVYRAAGNYTYAFCLTRNPVDKDGATASLVEEGKAHLEVTLVIALADEDDRSSVLARINRAVLSMRLAGGSLLPLEEWPSAETDRHELFRRLRRYWLPGFALALREDRLTQALHRREGWLVPLPIGYAGLSEPGKVLNSRDTKTPVRFVESLYSMGEWVSPHRLTCLEQLLWHHDADPQS-GIYRCTN. 309
17 2.000e-71UniRef50_A0A2R3QNH8 Type I-F CRISPR-associated protein Csy2 n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2R3QNH8_PSEME  ali  16  8....LLLPRLRVQNANAISGPLTWGFPAVTAFTGFVHALQRKLDIALDGVAIICHRHQTQTSQPAGKRTQVFHLTRNPVGKDGSTSAIVEEGRMHLEVSLLIGVDGMQDEKTIAQRAWDTALGMRLAGGSLLPPEIWPGNAEEASRLSRKLARRLLPGFALIPRNDLLTRHTAALRGWLVPIPLGYRSLSEPGSVRNARDREVPFHFVESLYGLGEWRSPLRFGDIRELLWYHQAEPDVGL....... 310
18 2.000e-71UniRef50_A0A0E1NRF1 CRISPR type I-F/YPEST-associated protein Csy2 n=39 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0E1NRF1_YERPA  ali  19  1MSSLIVLHQVRVENANAIAG-LTYGFPAITHFLGYSHALSRKLGLTLRGCAVICHYQQVHAY--LSGWDYVFSLTRNPLTKEAKTAAFNEEGRMHMTVSLVIECDGDDGANALEKHLASLCLTQRLAGGTITNIRRVKVINYPETEATRRLLCRLLPGFALLDRSELLAEHLNRLRGYLVPIVTGYRAISPPGEVDKTRDPHTPFRFVESLYGIGEWRGLHRITDLRQLLWGYHQEGDNYLCR..... 300
19 2.000e-71UniRef50_C9KPV5 CRISPR-associated protein, Csy2 family n=15 Tax=Bacteria TaxID=2 RepID=C9KPV5_9FIRM  ali  21  4IKTYLLLRQVKIHNANAFSSPLTIGFPAMTAWLGAMHALERKLSIRLKKLAVSCHDFNLQTYKGPGDYVNSVIITSNPLRKKGERPPFIEEARIHLTVSLLIEVDGSSNYSIFNEKTTKVLNGMKIAGGDILAFSRILLVDEDSEKDVRRAIRSLMPGYVLIERRQLLKQRQEKEQGWLVPIVTGFKGLTPLGHVANQRDASTLHRFAEPVLTLGEFKMPHHFQDIDQMMWQYQYDENKDL-YVCVNE 309
20 5.000e-71UniRef50_Q02MM0 CRISPR-associated protein Csy2 n=44 Tax=Gammaproteobacteria TaxID=1236 RepID=CSY2_PSEAB  ali  17  10....LLLPRLSIQNANAISSPLTWGFPSPGAFTGFVHALQRRLDIELDGVGIVCHRFEAQISQPAGKRTKVFNLTRNPLNRDGSTAAIVEEGRAHLEVSLLLGVHGDGLDDHPAQEIARQVQAMRLAGGSILPWCNERFSDEQRRKNQRRLTRRLLPGFALVSREALLQQHLETKPGWLVPIPAGYNALSPPGEVRNARDRETPLRFVENLFGLGEWLSPHRVAALSDLLW-YHHAEPDKGLYRW... 316
21 1.000e-70UniRef50_U7UQG8 CRISPR type I-F/YPEST-associated protein Csy2 n=2 Tax=Megasphaera TaxID=906 RepID=U7UQG8_9FIRM  ali  19  1MKQYLLISRLKIHNANAMSSQYTIGFPAMTGWLGAVHALQRQLHIRLPRVAVSCHNCDVQLYRGPHDYKNSVIGTANPLKKSKKRPPFIEEARCHLSVTLLIEIEGPDTEDELLEVIHRQLPGLKICGGDIENHIQIEVIDENDKCDQRALRRKLMPGYVVIERKDLMEARRDGSEGWIVPLAVGFNDITGAIKAAYQRDERYEHHFVEPIVTLGEFIMPYRFDSVEAMMWQYRYDRENGL....... 293
22 2.000e-70UniRef50_A0A2T3IP12 Type I-F CRISPR-associated protein Csy2 n=17 Tax=Photobacterium TaxID=657 RepID=A0A2T3IP12_9GAMM  ali  20  1MSLFL-IKNMHIEGANAIAG-FTYGFPAITQFLGFVHALSRKIGISFDGCAVMCHQHQVHAYRGSDWDDYGFSLTRNPLAKDGKTAPIVEEGKMNLCVSLLIECKGSDQEQLISNAIKTQVLSQRCAGGRITNIEAQFKPMPNEAGDCRRLLRPLLPGFILCDRSDYLQQHAEPQSGYLVPLMIGYKQISDVEEVANVRDNTTPFAFTEAVYSVGEWISPSRVESINQILWRYQYSSPYYLCR..... 298
23 3.000e-70UniRef50_A0A0H5LUF8 CRISPR-associated protein, Csy2 family n=7 Tax=Yersiniaceae TaxID=1903411 RepID=A0A0H5LUF8_YERIN  ali  19  1MSTLITLRHLQVSNVNTIAG-LTYGFPAITQLLGYTHALSRKLGIELKGCAVVCHHHQIHTYQPSGWGDYVFALTRNPLTRKGETAPIVEEGRMQMEISLVLECQGEAGIAALREHLFPLCQSQRLAGGTINSLQDIDIVFPTTAQERSRFTRRLLPGFVLLDRSSQWAYQPKPESGWLVPIMTGFRAISPPGIVNNSRDWSTPFRFAEAVYGIGEWKSPHNIGDLRQMFWQYSRDQDWYLCQS.... 304
24 8.000e-70UniRef50_A0A0H3H8V0 Uncharacterized protein n=6 Tax=Enterobacterales TaxID=91347 RepID=A0A0H3H8V0_KLEOK  ali  18  1MSYLLLLPYIRIENANAVAG-LTWGFPAITHFLGYVHALSRRVGISFTGCAVISHEHHIQAYS--SGRDYQFALTRNPLTKEGKTAPFNEEGRMHLTVSLLVECQGEIGKAALCSSLLTLCQSHKLAGGSIVSMGEPQIFNAPDDEKLRQLLWRLMPGFALCDRSEWLMEHYRPKPGYLVPLMCGYQRISEPGEVANVRDSTTPFAFTEAVYGVGEWRGLHRIADLQPLIWRYRTSDTGYYC...... 292
25 8.000e-70UniRef50_UPI00036F6657 type I-F CRISPR-associated protein Csy2 n=2 Tax=Teredinibacter turnerae TaxID=2426 RepID=UPI00036F6657  ali  17  1MKSLILLKGVQVENANAIAG-HTYGFPALTHFLGYTHALSRRLGLTLGGCAIVCHDHQVQSYQPGGWGDHVFALTRNPLTKEGNTAAFIEEGRMQLNVSLVIACDFNEYDLDFCDSVRELALIRKLAGGTITGLQSVQFHVLPEQFDMKKFMRRLLPGFLLQDATEQLREHFSTLKGWCVPLALGYRAISEPGEVARTRDQTTPFRFAELAYGLGRWVSPHRFESIEPFIWRYHYENEWYLCQQFQN. 317
26 9.000e-70UniRef50_Q6D0W7 CRISPR-associated protein Csy2 n=246 Tax=Proteobacteria TaxID=1224 RepID=CSY2_PECAS  ali  19  1MSTLIILRRIQVENANAIAG-LTYGFPAITHFLGFTHALSRKLGLTLEGCGVVSHQHQLHAYG--SSWERSFALTRNPLTKEAKTAAFNEEGRMHMTVSLLIRCDGQIPADALCEHLKQQAQCQRLAGGTVIDIERVTVQSLPDEAETRGVMRRLLPGFVLRDRTSLLHRHFQTLQGFLTPLMIGYRAISPPGEVDKTRDPHTPFCFAEAAYGIGEWQGAHRISDISQILWEYDYQNGDYHCRQ.... 293
27 1.000e-69UniRef50_UPI000B9EE4D4 type I-F CRISPR-associated protein Csy2 n=1 Tax=Zooshikella ganghwensis TaxID=202772 RepID=UPI000B9EE4D4  ali  20  12....LVVPRLYVQNANAVSSPLTWGFPAPSAFLGFVHALQRKLALNFLGVGIICHHFEPQTDQTDNRRTQLFKLTRNPLNKDGSSPAFVEEGRTHIEVSLVIEYLDEDEGAELASDIYSLVQQQRLAGGTVWVSDKPRDHAEGRISQFNKIKYTLLPGYALIGRDGLLQNHYKSKPGWLVPIPVGYQGISELGSVQHSRDDQTPFRFVESVYSIGEWLSPHKVKDPLQLLWSYQYLPEYE-QYRCIND 318
28 2.000e-69UniRef50_A9KCH4 Uncharacterized protein n=1 Tax=Coxiella burnetii (strain Dugway 5J108-111) TaxID=434922 RepID=A9KCH4_COXBN  ali  19  20IDAYVILPNLRVKNVNTISSPLTWGFPSLTAIFGFVHALERKLHLKFKDIAVTCHYFEAEAYRPLPYSDYSFSLTRNPPREKGQPPSFVEEGRAHMEITLVIQAAGEEQKELLETEIMEVASTLRLAGGSILSYSMPLVNDEEDQEIMRKILKKLLPGSILIDRKDLLKARTQKKSGWLVPIPVGYQAISEPGYVRGARDAVSPCCFVESIYSLGQWVSPHRFKQISDIFWSYDEKSEAGL-YRLVN. 329
29 3.000e-69UniRef50_A0A2D5RHS8 Type I-F CRISPR-associated protein Csy2 n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2D5RHS8_9GAMM  ali  19  1MSELLVLPHLRIQNANAISSPMTWGFPAMSAFVGAMHALERKLNLVFTGVGVVCHGFDAQTTQ--GGFTKSFLLTRNPVGKDGGTAAIVEEGRVHLDVTLVLAVEGPQDREAAAEEVMRIVSGMRIAGGSVMPALPGQKHDEERATQFLRLRRGWLPGFALVGRDDLLAQRFAKSPGWVVPIPVGYGALSEPGSVTNARDATTPFRFVESLYSLGQWISPHRLDRPGDLLW-YPTSDPDAGLYRLCND 327
30 5.000e-69UniRef50_UPI00069EBFFA type I-F CRISPR-associated protein Csy2 n=1 Tax=Oblitimonas alkaliphila TaxID=1697053 RepID=UPI00069EBFFA  ali  19  6.NAYLVLPRLRVQNFNALSSPMTWGSPSITAAVGFMHALQRKIQIDLLSIGMVIHEFQPQV---NGSFVKKFNLTRNPLGKDGKTPGIIEEGRAHATISLVIGVDGNLADTEVLTQIYEQAQTMRFAGGSLIPWHQPNLFVIGDNNDEKAIKRSLLPGFTLISRDDVLIQHTQRLQGWLVPIPIGYSALSEPGEVDNARDPNVPFRFVESLYSIGEWRSPHRLSSLDELLW-YATTDHQAGIYRCYN. 315
31 7.000e-69UniRef50_A0A1W1X1G3 CRISPR-associated protein, Csy2 family n=1 Tax=Andreprevotia lacus DSM 23236 TaxID=1121001 RepID=A0A1W1X1G3_9NEIS  ali  16  1MKAILQLSRLRIENANAITG-CTWGFPGISHFLGFVHALSRKLGVQLGGCAVICHDHQVQAHQ-PGGWEWVFALTRNPLTKDGNTAPFNEEGRMHLTVSLLIECEFDENTQRFEQLIASLIPLQRLAGGTLTSHGQIRFTELGADDAVRRMLWRLLPGFALIERRDLLSEHHQPEAGYLVPISVGYQAISPPGEVSNSRDPAVPFRFVESAYTLGEWRSPHRFDDLTPLLWRYLHVDDLYVCRN.... 306
32 8.000e-69UniRef50_A0A291E1B4 Type I-F CRISPR-associated protein Csy2 n=44 Tax=Enterobacterales TaxID=91347 RepID=A0A291E1B4_9ENTR  ali  18  1MSKLIVLHRLKVENANAIAG-LTWGFPAITHFLGYTHALSRKLGLTLSGCGVVCHSHQVHAH--TSGRDYQFALTRNPLTREGKTAAFNEEGRMHMTVSLLLECHGDAGFRALEEHIETLCQTQKLAGGSITGMRNVRVHALTAAKDWREVRYSLMPGFALLDRSSLLEAHADKLDAWLVPLMTGWQRISPLGTVANVRDAESPFCFAEAVYGVGEWRGMHRIATPEDAFWRYRTTETGYYC...... 289
33 1.000e-68UniRef50_A0A1H9GIX5 CRISPR-associated protein, Csy2 family n=14 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1H9GIX5_9GAMM  ali  18  5.SHYLLLDRIEIENANAISSPLTYGFPAISGFLGAVHALNRKLGITLDGVLIACHDIQVQRYRPHAYADYSFNQSRNPIKKDGKTASIVEEGKVHLTVSLVVEVSASRKEDNIEERCRQIIFQQRMAGGSVRAIKQVRFFNTSDGEQ---IKRSLLPAFVLMDASGWKTRSPKTGRGWLVPMPVGYQALNPPGQLQNCRTVDYPSHYVEALYSLGKWLFPNRLNDLSSCFWRYSQSDNLYLMTQTSN. 305
34 2.000e-68UniRef50_A0A1F7FLF2 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Candidatus Riflebacteria bacterium GWC2_50_8 TaxID=1817874 RepID=A0A1F7FLF2_9BACT  ali  19  4.DSYIILRNLKIQNANALSSAFTIGFPAMTAWLGAVHAMQRKLNIEFNQTAIACHDFKLHTHKGRGDYDWSIVGTGNPLTKEGARPSFIEEGRCNLCVSLIIGCNSRFTFDEFKTAFESILHKIKIAGGDILDFGAIEFKKPDSEIEKRKLLNSLMPGYILIERRDLVKESKRKNQGWIIPIATGFQGISELAESYNQRDNTVPHRFAEAIVTLGEFKMPHRL-DFDTAFWRYDYQEKEN-IYLCINN 294
35 2.000e-68UniRef50_A0A2E9ZTS1 Type I-F CRISPR-associated protein Csy2 n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2E9ZTS1_9GAMM  ali  20  9...YLVLPHLRVQNANAVSSPLTHGFPSMTAFLGLMWALERRLDLAFRAVGVVCHDHQEQVS--DDWFVKSFRLTRNPIDKHGKTAAIVEEGRIHLELSLVFAVESPDARQAETGTVAELVSQMRVAGGTIMPPENPPIHGEKRWDSFRKLRMRWLPGFTLVSRDELIDTHDRDGLGWIVPIPVGYGALGPAGAVANARDASTPFRFVESLYSVGQWISPHRLHDPQQMLW-YADSQPDNGLYRCRND 319
36 3.000e-68UniRef50_UPI0003715A8F type I-F CRISPR-associated protein Csy2 n=1 Tax=Succinimonas amylolytica TaxID=83769 RepID=UPI0003715A8F  ali  20  3IKTFLILPHIKVNNANAWSSPYTAGFPSVCAFGGAVHALQRKFNEEINGLGIINHKFSMRTYREGQYSDLSIIAGANPLDKDGNRPSFVPEIKCILEVSLLCELAGNDDEDEDIEHTANDLLNSRIASGDVQPTETPYITTNEEDENFRKIIHRLMPGYALIERRELMIERYRKNRGWLVPISTGYAAINELGRATNQRDPETPHCFAEAIVTLGEFKMLHRFHNINSLLWRRYYDANTIYCYSQYEE 298
37 7.000e-68UniRef50_A0A1T0CH07 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Moraxella lincolnii TaxID=90241 RepID=A0A1T0CH07_9GAMM  ali  17  1MADYILLERLQVENANAIAG-FTYGFPAVTAFLGFEHALSRKLDIELNGCAIFCHDYVANHYQKFIQNRNPPSTLKGRSNDAKKPAPIIEEGKMDMTVSVLLRCQGTERVASYHQTIKNLVYQSRLAGGSIKKLTNIHLLSDSD-KLLNHLKHILLPSFVLIDATRLLQEHFDNKQGWIVPLMIGYKGISPPEQVENLRDTRYPFRFVEAVHGLGEWQSVHRIHSLDSLFWQYQVENEWYLCQQN... 304
38 1.000e-67UniRef50_F4GL28 CRISPR-associated protein, Csy2 family n=1 Tax=Sphaerochaeta coccoides (strain ATCC BAA-1237 / DSM 17374 / SPN1) TaxID=760011 RepID=F  ali  19  1MSIVMVLPHICVLNANAHSSPYTVGFPAMTAWLGAAHFLQREIVVKCEGVGIVCHDFTMHSYRDREKYVASLIGTSNPLDKKGDRPSFIEEAKCSLEVSLIIQISGLDLRNDFINLVNGILIRMKIASGDVMKAGKPRL-ENADTESLPRLMGSLMPGYVLVERRKLMWSQNRKGMGWIVPISVGYQAITGFVDSPGQRDTSVPHRFVESVVTLGEFKMVYRIRKLDDMLWHYHVTADNEL-YVCRNE 290
39 1.000e-67UniRef50_A0A2T5CB51 Type I-F CRISPR-associated protein Csy2 n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2T5CB51_9DELT  ali  19  1MDSYLVIQKMDVTEASMDSCPIVNGFPGVPAIMGFVHALQRKLGILLPLAGISCHYFDPGVHK--TGRETRLSLSKNPPDKNGKGVPFIEEGKADMRVSLIIKILGEDLSFKDLQKVQAILPLLRFAGGTIWGAENIVCRNCGDEEDERHLLRLLMPGFVLVERRDLIEQSMEEEPGWLVPIAVGYRAISETGQVKNQRDPEYPHCFAENVVTLGEFVMPIRLDRLGKVLWQSNVDEASGL....... 287
40 2.000e-67UniRef50_UPI0008E51923 type I-F CRISPR-associated protein Csy2 n=1 Tax=Pseudomonas yangmingensis TaxID=1720063 RepID=UPI0008E51923  ali  19  4INTLLILPRLRVQAANAVSGPLTWGFPSPTAFTGFAHALERRLTADFQGVGIICHRFEPQVFRPAGSFTRVFCLTRNPVGKDGGTAALVEEGKAHLEVTLVIGLADEDDRSAMLAVISNAVMSMRLAGGSLLPLETWPSAEADRRDAFRRLRRHWLPGFALALREDRLAEHIRRRDGWLVPLPVGYAGLTEPGQVLNCRDAQTPVRFVESIYSLGEWVSPHRLDCLEQLLWHHEADPET-GIYRCIN. 309
41 2.000e-67UniRef50_A0A2D2E9J2 Type I-F CRISPR-associated protein Csy2 n=39 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2D2E9J2_9GAMM  ali  20  13...YLCLNRIQISNANAISSPLTYGFPAVTGFTGAIHALSRKVDIRLDGVLIACHECQPQTYRESSYKDFTFIQTRNPLKKDGKTASIIEEGRCHLTVSLIVGVEDDDQIDLLQQTVKNLIQQQRIAGGSVIGLNKFAPVSFRVKEKISEFTDKLLPAFVLTDAHDDLQESVKKGRGWLVPIPVGFQGISPAWQMQHSRNPEYPSQYVEAIYSLGKWVFPYSIAELSTALWYQQYDAEQDL....... 307
42 2.000e-67UniRef50_A0A2H9U0N7 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Aeromonas cavernicola TaxID=1006623 RepID=A0A2H9U0N7_9GAMM  ali  19  3MKSTLLLHHLKVENANAISG-LTYGFPAISHFLGFTHALSRRLGLTLGGCAVIAHQVDVHSHPVGGRGEQVFALTRNPLTHEGNTAPFNEEGRMHLDISLLIECHFNADDLTLHQWFARTIPTLRVAGGTLLAIGKVQWREAYDEAALFRLRMSLLPGFALVCRHDLLSKHHQPESGYLVPLAVGYQEISPPGSVPSSRDQETPFRFVESIYTLGQWVSPHRIDDLDALLWRYRYQEPYYLCENRYQ. 311
43 4.000e-67UniRef50_A0A2G6DL99 Type I-F CRISPR-associated protein Csy2 n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A2G6DL99_9PROT  ali  17  1MSQYLLLKKLRVQNANALSSPFTFGFPAVTAFMGFTHRIQRELNFLCTGLGIISHRFAMQDYQE--GYKRCLKITANPLGKDGERPSFIEEGRCHLTVSLLLEIENPSSKDKFLWKIRNLLTGLKLAGGDILYRPDLEERNVNLIQDIAANFRQLIPGYALVERKDLMWQSQREHQGWIVPIATGFHALTPPALAEQQRDAATLHRFAESVVTLGEFKMPLPARFFKDLMWRYQQQGDLYLCTQ.... 287
44 4.000e-67UniRef50_B2PYF4 CRISPR-associated protein, Csy2 family n=55 Tax=Bacteria TaxID=2 RepID=B2PYF4_PROST  ali  19  6..NLIKLSHLKVHNANALSSPFTIGFPAMTAWLGFMHALERKIGLQLESIAVISHECNLQTYKGPSDFVSSIVGTGNPLDKEGNRSAFIEEARCHLDVSLLIEFSDRNDEKSIVDRIYELIPMMKLAGGDILSVDLPQMHYLPANDDMRSLFNSLMPGYALIERRDLMVSAMEDGQGWIVPIATGYQGISPLGQAKNQRDPNVPHRFAESLVTLGQFVMVNKIGHPNEILWKYNLENSLYLCQQ.... 305
45 9.000e-67UniRef50_A0A1M5LX50 CRISPR-associated protein Csy2 n=33 Tax=Proteobacteria TaxID=1224 RepID=A0A1M5LX50_9GAMM  ali  19  8.SGLLILPRLRIQNANAISSPLTHGFPAMSAFVGLMWALQRKLGLRLHSVGVICHDHDEQV--TEDGYTRAFRLTRNPVDKDGTTAAIVEEGRIHLDITLVFGVEGDAERAALAKQIADVVAQLRVAGGSVLPPQPQLLPVPEDPSDFRALRRRWLPGYALVCRDDLLEWQPDRKPGWIVPIPVGYGVLAPAGAVANARDPSVPFRFVESLYSIGQWIGPHRLQSFRELLW-YADHDPSSGLYRVRND 314
46 9.000e-67UniRef50_A0A2G4RBS6 Type I-F CRISPR-associated protein Csy2 n=3 Tax=Acetobacter TaxID=434 RepID=A0A2G4RBS6_9PROT  ali  18  11....LVLPRLRVQNANAISSPMTHGFPSITAFMGFMWALGRKLDVFFESVGVVCHDFQELVGG--GGFRKVFGLTRNPLTKNGSTAPIIEEGRIHLDISLVFGVTNTETFKKDLETIRDIVAQMRCAGGSIMAPHMPWIFVDEDDHAYQRLRYRLMPGFALIDRQDVLTSRLERSPGWLVPITVGYAGLSPAGTVEGARQSDVPFLFAEALYSIGEWIGPHRLSSPSSLLWHVENDPE-IGLYRCRNN 319
47 1.000e-66UniRef50_G0CL58 Crispr-associated protein, Csy2 family n=38 Tax=Proteobacteria TaxID=1224 RepID=G0CL58_XANCA  ali  17  8.SHLLVLPHLHIHNANAISSPLTHGFPSMTALLGLMWALQRKLELTFDAIGAVCHAHQEQV--TEGGFVKAFHLTRNPVGKDGKTAAIVEEGRIHLELSLVLGVHSPQAQQADTDTVAELLAGMRIAGGSVRPPSQSGRHRYDRAKKFRKARMRLLPGFALVERADLLWSNDRSGRGWTVPIPVGYGALGELGSVANARDPSTRCRFVESLYSLGQWISPHRLDAPQQLLW-YPSSDPDLGLYRCRND 317
48 2.000e-66UniRef50_A0A2S5KIC8 Type I-F CRISPR-associated protein Csy2 n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2S5KIC8_9PROT  ali  21  7....LIIPRLRVQNANCISSPMTWGFPAMTAFTGLMVALERKVGLEFLSVGVICHHFAAQV--TTGGYTRTFCLTRNPVDKDGSTAAIVEEGRAHLEITLVFGVAGSGMAASDEQLQQAALATLRIAGGSVLPYQQPTLKSLSDDSEFRSLRRQWLPGFALVCRDDLLTERLHEPPGWLVPIPVGFGALSPPGEVAHARDMTVPFRFVESLYSIGQWLSPHRLQSPEQLMW-YSTHDDSSGLYRCQND 321
49 4.000e-66UniRef50_R5T898 CRISPR-associated protein Csy2 family n=4 Tax=Veillonellaceae TaxID=31977 RepID=R5T898_9FIRM  ali  23  1MKNYLLLSRVSVHNANAMSSIFTIGVPAMTAWLGAMHALERKLGIRFTQMAVSYHKTSLQTIRKNGIGYNPLVVDKKKSSKDNKRAPLLEEPRIHLLVSLLIEVEGADNMELLEQAVKEILPRMKMAGGDILDTGRIKVMRIDEDNPIRKVISTLMPGYIPIERRDLMEAKELEGKGWIVPLAVGFKGLSPLGKVKNQRDPDTPHRFAESIVTLGEFKMAHRFRDIDGMMWHYAYENQLYLCKN.... 301
50 4.000e-66UniRef50_L0RCH7 Uncharacterized protein n=2 Tax=Desulfovibrio TaxID=872 RepID=L0RCH7_9DELT  ali  18  12....LSLHHLRIINCNSISSPLTWGFPAISAFAGFTEALNRKIDVELKGVGVICHEFDPQVNKADGQFEWTFKQTRNPLEKKGGSASLQEEGRCHIDITLVIGVYGDLEDDKDEDNVLETMQTMRIAGGSVLPFMTVPPNKAEREKLFRRFRRSLMPGFALVDRSDYLEAHVEQMQGWFVPIPIGYVGISEPGEIARCRDMHVPAQFVESVYSIGEWVSPHRISELNNILWFHDYDDDLYLLVNNYQE 332
51 5.000e-66UniRef50_A0A1I3AJS3 CRISPR-associated protein, Csy2 family n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1I3AJS3_9PROT  ali  21  12....VLLPNLCVQNANAISSPLSWGFPSPTAFTGFAHALQRKFQEGFGGVGIICHDFQPQVSWSSGDRAHVFHLTRNPGEKDGRAPAMVEEGRAHMEVSLVIAVKSAGEGERFAEELFHIAQGMRLAGGSLLPPPAPKKMPMRRWEPLRGLRRHLLPGFALVQRNDLLIEHLAEMRGWLVPLPIGYSVLSPITEVQNTRDGITPFGFAESLYSLGEWISPNRVENLDQLLW-HTESQPENGIYCCVN. 324
52 8.000e-66UniRef50_A0A1V2DST3 Type I-F CRISPR-associated protein Csy2 n=63 Tax=Proteobacteria TaxID=1224 RepID=A0A1V2DST3_9ALTE  ali  20  5.STLLILPRLRVQNANAISGVLTWGFPAMTAFVGLMHALERKLEVAFPGIGVVCHQHEAQV--TTGGYTRAFHLTRNPVDKTGKTAAIVEEGRIHLEISLILEVDSDQDKAEFAERVAELLTTLRVAGGTIQPPHRPSLLAVDSSPEVRRLRQQLLPGFALVLRDDLLQQHRRDYPGWLVPIPIGFTALSELGEVEAARDPTTPFRFVEGIYSLGQWVSPHRFNAFNDFLW-YVDNDPDTGIYRLNND 312
53 8.000e-66UniRef50_I0GPG2 Putative CRISPR-associated Csy2 family protein n=6 Tax=Selenomonas ruminantium TaxID=971 RepID=I0GPG2_SELRL  ali  17  2IKQYLMIPHLQIQNANAASSPYTVGFPAMTAWLGMTHALQRRIRQRLPRVAVICHAFDLQVFNEKGNFYGSLIGTANPLKKSRKRPPFVEEARCHLEISLLVELTGGSLKERFEETVRRELPRLKAAGGDIHGEQQDWQVVSVDDDDERRVKARLMPGYAIIERQDLLQHESGKDDGWLVPIAVGFHDLSGNLQVKEQRSYEYEHHFVEPLVTVGEFVMPYRCEAIQEMMWEYEYN-EAEGLYLCRN. 300
54 2.000e-65UniRef50_A0A2T5K1P1 CRISPR-associated Csy2 family protein n=1 Tax=Nitrosospira sp. Nsp2 TaxID=136548 RepID=A0A2T5K1P1_9PROT  ali  20  12....VLLPNLCVQNANAISGPLSWGFPSPTAFTGFVHGLQRKFQNGFGGVGIVCHDFQPQVSWSSGDRAHVFHLTRNPGEKDGRAPAMVEEGRAHMEVSLVIAVKSSSEGERFAEDIFGMAQGMRIAGGSLLPPQRWWPLGEGPEEVMRDLRRKLIPGFALVQRNDLLIDHLHRKPGWLVPLPIGYSVLSSLGEVQNTRDRTTPFGFAESLYSLGEWISPNRVENLDQLLW-YTESQPENGIYCCIN. 324
55 2.000e-65UniRef50_UPI0003B39820 type I-F CRISPR-associated protein Csy2 n=1 Tax=Geovibrio sp. L21-Ace-BES TaxID=1304888 RepID=UPI0003B39820  ali  19  6.NTLVTLPHVRIQNANMISGPYSWGFPAVSNFLGFVHALHRKLGTSFDGVGIVCHDYEAQVYQPVPYVPHQLKITRNPYDSNGDPSSTLEEGRIHLDVTLVIGVWTADTTEELAEKVLEASQSMRIAGGSVLPPYASPLSDIDDEEQIARLKRRLIPGFVLVERGDILSEFRRERPGWLVPIPVGFLPISEPGVVKNARDNEVPFRFVEAAYSMGEWLNPLKLRNAEDLMWYYESDPETYLCKQ.... 321
56 3.000e-65UniRef50_A0A2T3LR46 Type I-F CRISPR-associated protein Csy2 n=15 Tax=Vibrionaceae TaxID=641 RepID=A0A2T3LR46_9GAMM  ali  19  1MEQYLILKHIEVTNANAISG-FTYGFPAITHFLGYVHALSRKLSITLSDVAVVCHHHQTHAYRESIYEPYSFALTRNPLTKEGKTAPINEEGRMSMTVSLIIKTNGENEKLAACELIKQLAEQQKLAGGRITNIRS--CSLAKEDITVKRLLRGLLPGFVLIDRSDLMAVNEQKPSGYVVPIHIGYKAIAPTGMVANVRDTTTPVTFVEAVHSIGEWVGPSRISSMSQILWRYNYHTPFYVAHS.... 290
57 6.000e-65UniRef50_Q0YSQ9 Uncharacterized protein n=2 Tax=Chlorobium TaxID=1091 RepID=Q0YSQ9_9CHLB  ali  15  9....LVLPWLRVQNANCISSPLTWGFPAMSAILGFVHSLERKLDLGFSGVAVICHRFEPQIYS-PDRGDKVFRLTRNPLNEKGESPSFAEEGRAHITISLLIQVKSENQKEEMAEEILKTAQGLRLAGGSILSPSKVRLSDWDVGDALKAELRRLLPGFLLTSREDLLSERTRKKPGWIVPIPVGYRSISTCGEVLNARDTETPFSFVECIFSLGQWISPHRLTDAGKIFWKHEAD----VEKGLY.. 306
58 6.000e-65UniRef50_A0A2E0VGD7 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Porticoccaceae bacterium TaxID=2026782 RepID=A0A2E0VGD7_9GAMM  ali  16  1MDALLILRNIEVTAANAIAG-LTWGFPAITHFLGFVHALERKLDVQFDGVGVVCHEHQIQAYQANSFADHAFALTRNPLGKDGGSASFNEEGRINMRISLLIGVLSGHDRDDLLKNIEQNLQTQHLAGGLITNQPRWQFIGNRLEERHRAIMYSLLPGFTLVSRHPLLQQEQAPDTGWLKPITVGYRPIAPLGAVGKTRDTTSPAAFVENIYSIGEWMSPHRIKALGDMIWRYTQTPTDYLCQNPYQ. 298
59 9.000e-65UniRef50_A0A1I4NQY2 CRISPR-associated protein Csy2 n=2 Tax=Nitrosomonas TaxID=914 RepID=A0A1I4NQY2_9PROT  ali  18  3.NAYIIFERISVQDANCIAG-FTYGFPAVTHFLGFGHALSRKLRLSLQGCAVICHQHQIHVYQHKRYSDYFFAQTKNPPREKGKSPPIIEEGKMSMTVSLIMACPDTAEINTLKETLLNLAYQHRLAGGSIQKIAAIHVLNQDEEKLLKKIKCLLLPGFVLMDRTDLLTEHYEPAKGWLVPITNGYKAISPPGEVANTRDAITPVCFVEAAHSIGEWRSLHRIQGLADMLWHYHYEQYWYLCRQ.... 315
60 1.000e-64UniRef50_A0A0Q9YBI1 CRISPR-associated protein Csy2 n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0Q9YBI1_9COXI  ali  18  1MSQYLVLSHIDIQNANSIAG-FTWGFPAITHFLGFTHALNRKFSSELTGCAVVSHTFKNKVYQPKKHENFEFLQSKNPPKHKSASPPIIEEGKMNLTISLVIELSTTQQIDELQERILSMCYRMRLAGGTILNIKQVKLLSASTKEQLRKIKKLTMPGFVLLDRSDYLQAHENTPANWLVPLMTGYKAISELGVVLNTRDEVTPSCFVEAIHSIGEWKGMHSLNNVDEIIWRYEHDEQWYLCKQNR.. 324
61 1.000e-64UniRef50_UPI00048E22F4 type I-F CRISPR-associated protein Csy2 n=1 Tax=Desulfonatronovibrio hydrogenovorans TaxID=53245 RepID=UPI00048E22F4  ali  18  1MDSYLVIQKMDVTEASMDSSPIVNGFPGIPAIMGFVHALQRKLGILLPLAGVSCHFFEPRVRKTGWQARLSLSKNPPYLKKHVKGVPFIEEGKADMRVSLIIKIQGEGNFSELKRDVQDLLPSMRFAGGTIWGAENIVCRNCGDEADEKRLLRLLMPGFALVERRDLIEELMEEEPGWLVPIAVGYRAISETGQVKNQRDPECLHCFAENVITLGEFVMPIRLGRLREVLWQPSVDEAH......... 285
62 1.000e-64UniRef50_A0A2N6VB94 Type I-F CRISPR-associated protein Csy2 (Fragment) n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A2N6VB94_9GAMM  ali  20  1.......SHLKIHNANAMSSPFTIGFPAMTAWLGVIHALQRKLGLILDKVAVSCHEFNLQTYKGENDFENSIIINKTPLIFDKKYTGFIEEARCHLDISLLIEYSNIDAEQNLLQSIETIIPTMKFASGDIISFRNSFNENKDEDQELRKISNKLMLGHVLIERRDLVWSSHRKTNGWLVPIAVGFQGISELGIAKNQRDADTPHRFAEAVLTLGEFVMPYRIESIDQLLWQYHVDNNLYLCQNLRTN 307
63 2.000e-64UniRef50_N8U135 CRISPR type I-f/ypest-associated protein csy2 n=8 Tax=Proteobacteria TaxID=1224 RepID=N8U135_ACILW  ali  18  1MTSYILLEKVSVEDANCIAG-FTYGFPAITGFLGFTHAISRKFNAEFGGCAIFSHDFTLHTNEQYSKRPPVTLQGQKYRAEANKTPPIIEEGKMDLTISLLLQCSGVDEQKKLYQKLKKWVYQARLVGGSITNIKNI--SFWTEESDLNKLKRKLLPSFVLLDATSTLEKHVENPRGWFVPLMIGFKGISPLQEVEHHRDPRYPFRFVESVHSIGEWRSTHRIQNLSDLIWTYHIEDEWYLCQQKQN. 304
64 2.000e-64UniRef50_UPI00048967A4 type I-F CRISPR-associated protein Csy2 n=1 Tax=Marinospirillum insulare TaxID=217169 RepID=UPI00048967A4  ali  20  6.NAYLVLPRLQVQNLNTLSSPMTWGAPSITAAMGFMLALQRKIEIDLLSIGMVIHDFEPQV---NGNYVKKFNLTRNPLGKDGKTPGITEEGRAHATVSLVFGIDGNTADNHLLQEIYKLASSMRFAGGSIINWHSPQLQILGDDEELAKLKRSLLPGFALISRDDALLAHREKGSGWLVPIPVGYSALSELGEVQNTRDPNVPFRFVESMYSIGEWCSPHRLASLDELLW-YSSADHDAGVYRCLN. 317
65 3.000e-64UniRef50_A0A2C6DJ16 Type I-F CRISPR-associated protein Csy2 n=3 Tax=Budviciaceae TaxID=1903416 RepID=A0A2C6DJ16_9GAMM  ali  20  1MKYYLVIPHIKVQNANCISSPLTYGFPAITAFTGAVHALSRKLNMTLDGVAIAAHDCDIQRSRPNSYSDWSFIQSRHPIKKDGNSPSIIEEGYIHLKLSLVVEVTSEEEKQAFCDAVYQQMMQQRLAGGSILSIGNTRRQISGDPDKIKAIQIQLSPSFLLINRQDVLIDHTAPKKGWLVPIPVGYKGIAPIDRVADIRAPQYPTHFVESVYSIGEWRFVNSLPDFNHIFWRHHTDIDNQL....... 307
66 3.000e-64UniRef50_A0A2V4EAT7 Type I-F CRISPR-associated protein Csy2 n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2V4EAT7_9GAMM  ali  22  5.KYYLLFDHVKIHNANAISSPLTYGFPAISGFLGAIHALNRKIEIYLDGVLIACHECDVQVYRPNNYTDYTFRLTRNPLAKNGDTRSIIEEGRVDLDVSLIVEVKSKELQQQFVKQIEQKIYQQRIAGGYITEIASIELYSSSSAEDRDILIKALLPAFVLVEAQQELQEITAELQGWLVPIPLGYQAISPLGTVEHARSNQHPTQFVECIYGLGKWVFPLRLENLSQAFWRYKCSE........... 293
67 5.000e-64UniRef50_A0A1Y4CD89 Type I-F CRISPR-associated protein Csy2 n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1Y4CD89_9FIRM  ali  20  1MKTYIVLPDVQIHNANAMSSTYTIGFPAMTAWLGAVHALQRNLDIVFSKTAVVYHSCHLQVQK---GYRNSIIGTANPLKKKGERPPFIAEARVHVTVTLVIETSRPEYKERCEHAITMLLPTMKIASGDVLKAGKAEIVYIDEEKEYKPLIAKMMPGYVLIERRDILETYERAIPGWVIPISVGFKAISPLMQVSHQRDMTKPHRFAENIVTLGEFKMPYQFDDIDDMMWHYEYDEEQGL-YICRN. 292
68 6.000e-64UniRef50_A0A286EF39 CRISPR-associated protein Csy2 n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A286EF39_9NEIS  ali  18  1MASYILLERLKVENANALAG-MTYGFPALTSFLGFTHALSRKFGNAFTGCAIFCHDYELNAYQKFIQNRCPPSTLKGKSADAKSPAPIIEEAKMDMTISVLLQCDKSDNIKNYILRLKQWIYSSRLAGGSIHHINDIKLL----GDDIKKLKKYILPSFVLLDASHYLQEHEQNKKGWIVPLMLGFKGISPPEQVENLRDHRYPFRFVEAIHGLGEWKSSHRIDDIQSLIWRYDCRDEWYLCRQ.... 302
69 9.000e-64UniRef50_A0A142FYE1 Type I-F CRISPR-associated protein Csy2 n=62 Tax=Pasteurellaceae TaxID=712 RepID=A0A142FYE1_AGGAC  ali  19  6...YLLFKHIKIQSANAISGPLSYGFPAVSGFVGAIHALSRKLNEKLDGVTIACHNYDLQAYQSTPFSDRTFIQTRNPLKKNGETAPIIEEGKVHLDISLVIELHISDEAKIFLSECKNLLLKQRIAGGSVLSIEDVQLHYLEDEW---KIKRQLLPGFVLMNAQAELIKITEELQGWLVPIPVGYQAISPLGQLQHCRTQDYPSQYVETLYSLGKWVSPLNLEDLSRCFWRY............... 304
70 1.000e-63UniRef50_A0A1N6M510 CRISPR-associated protein Csy2 n=38 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1N6M510_9VIBR  ali  20  1MKHYLLLKKIAVQNANAIAG-LTYGFPAITNFLGFAHALSRQLSVNLGGVAVISHKNTVHARQPSGWGDYVFALTRNPLTQQGNTAPINEEGRMSMQISLLIEIEGRQTEQTLIDALKTRVPSMRLAGGQITHIEDYQLLTSAHQQQ--HALRRLMPGFVLIDRHDYLARHPKPEPGYLVPIATGYCAISEPGKVAHVRDSSVPVAFAETAYSVGEWLSVHRLQEIQQGIWRYHHDDSWYLARG.... 303
71 2.000e-63UniRef50_UPI00094E68DE type I-F CRISPR-associated protein Csy2 n=2 Tax=Negativicutes TaxID=909932 RepID=UPI00094E68DE  ali  18  1MSQYLLLSHLKIHNANAMSSTFTVGVPAMTAWLGGVHALERTIRVTFHKLAVSFHHTELQVYHKPFESNHYISGTGNPLVKKGAGASFIEEPRIHLDVSLLIEMSKTDQTEQLSEDIRHCLQKLKFAGGDIEQVLKVQVVYAEEAESAKRILKQLMPGYVLIERRDLLQEMENGADGWLVPVAVGFHGISPSGKVKNQRDPSVPHCFTESVVTLGEFRLPIRFDDIDEIMWNYHYDKQYYLCEN.... 297
72 3.000e-63UniRef50_UPI00036BCEF4 type I-F CRISPR-associated protein Csy2 n=2 Tax=Selenomonas bovis TaxID=416586 RepID=UPI00036BCEF4  ali  20  1MSQYILLPHIVVHNANAMSSTYTVGFPAMTAWLGAFHRMERELRLRITGVAVACEHFHLQQYQKNKFAPINLAMTANPLKKSKKRPPFIAEARCDIRVSFILRTEGIEAEDDLKERMLSLLARQKLAGGDIVSLKQIQMKHLEGSAEERKFMRRLMPGFVLVERKDLFEALENLAQGWVVPIAVGYRDLSKALHVANQRDPQTEHHFVEPLVTLGEFKMPYRFERIEEILWTYHY-GQSRGLYECVND 299
73 3.000e-63UniRef50_UPI00040FC34E type I-F CRISPR-associated protein Csy2 n=1 Tax=Veillonella montpellierensis TaxID=187328 RepID=UPI00040FC34E  ali  19  1MSWYLIIPHIHIENANAMNSLYTIGFPSMTSWLGGVHALQRRINIEFVQTAVICHHHRLHTYKNHSLYST-IISTSNPLRKDGGRPSFIEEGRIHLDVSLVVEVSGNDSKEELEEAVAYMMPTITLAGGNIIRFGIQSLLLYGKEDVWQQIKRLLMPGYVILDRHDVLMDAKKALPGWLIPIMVGFKGVTSLEHVKNQRDPTTLHRFVEPAITLAEFKMLHHIYDMDAIFWHYAYDDSNSF-YVCRN. 309
74 5.000e-63UniRef50_A0A101LHX2 Type I-F CRISPR-associated protein Csy2 n=2 Tax=Pseudomonas TaxID=286 RepID=A0A101LHX2_9PSED  ali  16  8....LLLPRLRVQNANALSGPLTWGFPAVTAFTGFVQALELKLDIQLAGVAIVCHHHQAQTSVPAGKRTRVFHLTRNPVGKDGTTAAIVEEGRIHLDVSLLIGVSGTALYDGLLERAWDLALGMRLAGGSLLPPEFWPGTAEEEVRLSRRLTRRLLPGFALIPRADLLAQHLRPRAGWLVPIPLGYRSLHPPGSVRNARDRSLPFHFVESLYGLGEWHSPHRFADIRQLLW-YHQAEPDAGLYRC... 313
75 5.000e-63UniRef50_A0A139SI35 Uncharacterized protein n=1 Tax=Cephaloticoccus primus TaxID=1548207 RepID=A0A139SI35_9BACT  ali  16  12....LVLPRLRIQNANAISSPLTHGFPSITAFAGFMWALERRLNLGFDAFGVICHSHQEQV---ADGYVKTFHLTRNPVDRAGDTAAIIEEGRVHLELTLIFSAFGQEARDKLTKSIAQQICTMRVAGGSIVLPEPIPISESTRTSDFQRWRRRWLPGFALVSRDDLLKTHWEKHSGWIVPIPIGYGSLSEPSEVHNARDTETPFRFVESLHSIGQWLGPHQLSDIDQLLWKPDNAPE-RGLYRLRN. 315
76 7.000e-63UniRef50_A0A0K8P4X6 CRISPR-associated protein, Csy2 family n=1 Tax=Ideonella sakaiensis (strain 201-F6) TaxID=1547922 RepID=A0A0K8P4X6_IDESA  ali  19  8.DHLVVLPRLRIQNANAISSPSIHGFPSMTAFLGLSWALQRKLDASFVAVGVVCHDYQEQVYR---EGRLRFCLTRNPLDKDGGTAAIVEEGRIHLCISLVFAVRSPSSAEADLKLLADMLAGMRVAGGSCLPSDSWTGTSDDRADGFRRVRQLLLPGFALVLRDELVDAHDRKSLGWVVPIPVGYGALGEPGAVAKARDATTPFRFVETVYSIGQWLAPHQLDSAEQLLW-YSDHDRTTGLYRCRND 321
77 7.000e-63UniRef50_A0A0W1SEF0 Type I-F CRISPR-associated protein Csy2 n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0W1SEF0_9GAMM  ali  17  2INHLLVLPRLRIQNANTISSPMTWGFPSMSAFVGVQQVLERNLKLVFNEIGVVCHHIDPQV--TEGGFIKAFHLTRNPVDKSGGTAAIVEEGRAHLEISLLIGVESDGDDLVIAQTLFDQVQGMRIAGGSVIPALNAQVNESERAKQWQRLKRRLLPGFALVLRDDLLTKHRRPYPGWLVPIPVGYGAISDPGDVANARNAEVPFRFVESLYSMGEWVSPHRFQKPDDLMW-FVENDLDRGIYRLQND 319
78 1.000e-62UniRef50_L0E0D1 CRISPR-associated protein, Csy2 family n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=L0E0D1_THIND  ali  21  6..NYLLIPRLRVQNANAISSPLTWGFPAMTAFVGLMHTLERKLDERFDSVGVICHRHEPQIS--TATFPRTFRLTRNPIVQSNRPAAIVEEGRTHLEITLVFSVRGDSCKEQVARQIEELVHTLRIAGGTVQPIIPVTEDAEARPKEYRKLLRQWLPGFALVARDDLLQSHWKTSSGWIVPIPVGYGALGPPGTVAAVRDAETPFRFVESLYSIGQWIGPHQLTSPKQLLW-YPESEPDNGRYRLRND 324
79 1.000e-62UniRef50_A0A2G2DMY8 Type I-F CRISPR-associated protein Csy2 n=19 Tax=Bacteria TaxID=2 RepID=A0A2G2DMY8_9DELT  ali  15  6....LVLRHLQVENANAISG-MTWGFPAISNFLGFVHAVTRQLKVELVGCGVVCHGREVQAYQPRGWGDYVFALTRNPLTKKAELPSFVEEGRMHMTVSLLIPFKGPIEVEDAEEYIKKMILHKRLAGGTITHVDEVKLHAFPKDSEGRKIIRTLLPGRALVQRSAILAEHLRPGQGCLVPINIGYRGISQPGVVDRTRDGVTPFRFVESVYSVGEWISPHRAKSIDQLIWRYCVEQDWYLCKN.... 310
80 2.000e-62UniRef50_A0A1C3JSR4 CRISPR-associated protein Csy2 n=4 Tax=Marinomonas TaxID=28253 RepID=A0A1C3JSR4_9GAMM  ali  20  1MDKLLVIKHLEVEGANAIAG-LTWGFPAITNFLGFTHALQRKVQILLEGCAVICHSSQVQTYNNNMSREHYFALTRNPLVLKGKTAPFNEEGKMRMDVSLLIDVKSPDDLEDLQELIPILIPTMRLAGGSISKFETAELVLDRDDHTRKRFLRQFLPGFALVSRHDVLEKHIEEFSGWLKPIMIGYQGISEAGQVGHVRDRSVPVQFVESIYSLGQWISPHRITNIEHLLWSYEAERSLYLCNN.... 307
81 3.000e-62UniRef50_UPI0004837BD9 type I-F CRISPR-associated protein Csy2 n=1 Tax=Zymobacter palmae TaxID=33074 RepID=UPI0004837BD9  ali  16  1MSHILILPHLHIQNANAISSPLTWGFPAMTAFIGLMHALERQIALCFHGIGVVCHEAKPQTSRS-SFGQHSFLLTRNPLKNDGKTAAIVEEGRMHVELSLVLMLSGNEERMALAKQLDDYVHRMRIAGGSVLPRENIRSENLRRPKQLNRLKRRLLPGFALILREDALAQHKNRPSGWLVPIPIGYCALSPANAIANARDPYTPLRFVEPLLSIGEWRSPHRLQCIEEMLWRIKPNSDERL....... 314
82 4.000e-62UniRef50_A0A2S7C5C8 Type I-F CRISPR-associated protein Csy2 n=78 Tax=Proteobacteria TaxID=1224 RepID=A0A2S7C5C8_9XANT  ali  19  20.............NANAVSSPLTHGFPSMTAFLGLMWALQRKLELRFQAIGAVCHAHQEQV--TDSGFVKAFHLTRNPVGKDGKTAAIVEEGRIHLELSLVLGVSSPQAQQADTATVADLLAGMRIAGGSVRPPAQPWRHRYDRATQFRKARLRLLPGFALVERADLLDARDRTGRGWTVPIPVGYGALGDPGSVVNARDTSTPFRFVESLYSLGQWISPHRLDAPRQLLW-YASGVTEQEMYRCRND 318
83 6.000e-62UniRef50_A0A1W9Q9E1 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Sorangiineae bacterium NIC37A_2 TaxID=1970199 RepID=A0A1W9Q9E1_9DELT  ali  17  8....LVLSHLNIQNANAISSPMLWGFPSPSAFLGFVHALHRELGLSLEGVGIVCHKFEAQASQPAGKRTHVFHLSRNPFGSDGKPPALVEEGRVHLDVSLIVGVSGPHHPEELAHRIGEIAASMRIAGGSVIPPHLWPGSEDEESKMMRRLRRRLLPGFALVSRERLLEERHREKPGWIVPISTGFHAISPAGTVKNARDRVTPFRFVEGIYTVGEWKSPHRIQDLRQILWTYSVEPEEGL....... 304
84 1.000e-61UniRef50_A0A1H6GIV8 CRISPR-associated protein Csy2 n=1 Tax=Selenomonas ruminantium TaxID=971 RepID=A0A1H6GIV8_SELRU  ali  18  13.KTYLLVSKMKIHNANAASSAYTIGVPAMTAWTGFMYALERKLGVRFTGIAVSYHECELQTYRLDAYRTHIVGYAKPPKDGGIKSASFIEEARCHMCVSLLIEVEGVNNEKMLLRATKERIPRMKAAGGDIFDEKNLTVHYVRDEKSMYKVRARLMCGTILKERTDLIQPTEEHDKGWLVPIAVGYCDLSGPTDKEGQRSYDYEHHFVEPIVTVGEFRMPHRFNTLDEMMWRYDYDEGLYLCKQ.... 310
85 1.000e-61UniRef50_Q7NX75 Uncharacterized protein n=11 Tax=Proteobacteria TaxID=1224 RepID=Q7NX75_CHRVO  ali  19  13....LILPRLRVQNANALSSPHTWGFPALSAFTGLMTALERKLGLAFHGVGVICHGYQAHT---NGDYIQRFNLSRNPVDKDGGTAAIVEEGRIHLDLTLVFGVSGNALAQNDAAAISRALETMRVAGGTLIPPPKPQLITLPEGEDFRALRRRWLPGFALVARDDLLSGHHQQGEGWIVPIPVGYGALSPAGSVANARDAAAPFRFVESLYSLGEWISPHRLQDAADLLWYPAYDAE-LGVYRCRND 316
86 4.000e-61UniRef50_Q5NPQ3 CRISPR-associated protein Csy2 family n=6 Tax=Zymomonas mobilis TaxID=542 RepID=Q5NPQ3_ZYMMO  ali  19  9.SHMLILPHIRVQNANAISSPLTHGFPSITAFMGFMWALERKADIMFNAVGVVCHDFQEQV--TDSGFTYAFNLTRNPIEKDGKTAPIIEEGRIHLDVSLLLAIAFKNEDDEYVEKIAIFVQNMRIAGGSIIPPSPIECNTFSDNDDFRKNCYRLLPGYALVERSDLIPERNDRDNGWIVPMPVGYGAMQPSGSVSSARDNTIPFQPVESLFSIGEWIAPFRLKHPNDLLW---YPSSSLGEKNL... 321
87 6.000e-61UniRef50_C4XPX2 Uncharacterized protein n=2 Tax=Desulfovibrio TaxID=872 RepID=C4XPX2_DESMR  ali  18  11....LVLPRMMIQNVNCISSSFTWGFPSVTALMGFMWAMQRNCDVLFKGVGVVCHDLSPQVHKNN--FIHTFNLTRNPLDHQGKTAPIVEEGRAHLNISLLLAYEGEAHDDAMLRIVRDALVAMRVAGGTILPPQEPRFIGLAEAENLRTQRRRFLPGFALVSRDDLLAEHREKREGWIVPIPVGYASISELGEVLNARDASTPFRFVESVYSMGQWIGPHRLQEVGELLW-FAHVDDQKGLYRCYN. 322
88 7.000e-61UniRef50_A0A224W0S2 CRISPR-associated protein, Csy2 family n=3 Tax=Aquitalea TaxID=407217 RepID=A0A224W0S2_9NEIS  ali  17  9INALLHIPHLRIQNANAISGPHSWGHPGPTAFTGLMTALRRKLGPELDGVGIINHHYQAQT---NGDYVQRFNLSRNPLNKDGSTAAIVEEGHIHLELSLVFGLASQAELDQLATRIQQTLHTLRVAGGSILPLKHLPESTEEQQGQFRQLRRWLMPGYALLARDDLLPASRQQGQGWIVPLPVGYGALTPPGSVAHCRDETTPVRFVESLYSLGEWLSPHRLTDYRQLLW-YPSHDASSGVYRCHND 313
89 9.000e-61UniRef50_A0A2A5BN89 Type I-F CRISPR-associated protein Csy2 n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A5BN89_9GAMM  ali  17  1MSQYLVLSHITIQNANSIAG-LTWGFPAITHFLGFTHALNRKIDVELTGCGVVSHSIYNKVYQSKQSADFEFLQSKKPPKHKSASPPIIEEGTMNLTVSLXXXXXXXXXXXXXXXXIQNLCYRMRIAGGTILNIKNIKFLAASTEDLLRKVKKLTMPGFVLFDRNEYLQQHYQTLDAWLVPLMTGYKAISEPKQVQNTRDETTPSRFVEAIHSVGEWKSIHSIKIVKNIIWRYVHDEQWYLCKQ.... 322
90 2.000e-60UniRef50_A0A1Y6C3Z3 CRISPR-associated protein, Csy2 family n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6C3Z3_9PROT  ali  18  1MKRFLIIPRLTVSDANALSSSLTIGFPAITAWLGFVHKMERELRISFPNLGIVIHDFDLAVFKGVGDYNNSIVGKAYPLSKEGERSSFIEEARCNLNVSLAIECQGSRPFSEIGEIVQHILHKMKLAGGDIQKSQSPYLVGIEDNEEYMSIIGKIPFGFIPIERRDLLKNVAAEDNGWIVPLVTGYQGLGQLGETLNTRDSSTPHRFVESIVTLGEFVSPYSLSSIDDMLWSYDYDSEQYLCRN.... 294
91 3.000e-60UniRef50_A0A0J8VNK8 CRISPR-associated protein n=2 Tax=Enterobacteriaceae TaxID=543 RepID=A0A0J8VNK8_9ENTR  ali  17  1MSTLILLPHLRIENANTVAG-LTWGFPAITHFLGYMHALSRKLGLTLTGCGVICHQHQVHAYS--SGRDYQFALTRNPLTREGKTASFNEEGRMHLTVSLLLECHGDQGKSALEAHLQSLCQTQRLAGGTVTGLGGVKVIPRPQTDERRRLLFRLLPGYALIDRSPWLEEHHQPQRGYLVPLMIGYQRISEPGDVANARDTRTPFAYVEPVYGVGEWRGLHRIHSLDEMFWRYRTTDTGYYC...... 296
92 7.000e-60UniRef50_A0A2V4E4B7 Type I-F CRISPR-associated protein Csy2 n=13 Tax=Orbaceae TaxID=1240483 RepID=A0A2V4E4B7_9GAMM  ali  20  7...YLFFDHVKIHNANAISSPLTYGFPAISGFLGAIHALNRKIEIYLDGVLIACHDCDVQVYRPNNYADYTFRLTRNPLAKNGDTRSIIEEGRVHLDVSLLVEVKIDDQQQSFIKQMKQKLYQQRIAGGQVISIENVSLLSSDESDESL--SKLLLPAFVLVEAQQELQEITAELQGWLVPIPLGYQAISPLGMVEHARSNEHPTQFVECIYGLGKWVFPLRLENLSQAFWRYKCSE........... 291
93 8.000e-60UniRef50_UPI00068B34A2 hypothetical protein n=1 Tax=Selenomonas ruminantium TaxID=971 RepID=UPI00068B34A2  ali  16  13.KTYLLFSKMRVHNANAASSAYTIGVPAMTAWTGFMYALQRKLEVEFTGIAVSYHECELQTYRLDVDRTYAKPPKLKGKKGEIQAASFIEEARCHMCVSLLIELEGVNNEKMLLNAVRERMPRMKAAGGDIFDEKNLTVHYVRDEKSMYKVRARLMCGTILRERTDLIQPTEEHDKGWLVPITVGFCDLSGPTDKEGQRDYDYEHHFVEPIVTVGEFRMPHRFNTLDEMMWRYDYDEGLYLCKQ.... 311
94 2.000e-58UniRef50_A0A2H9T5X6 CRISPR-associated protein Csy2 n=1 Tax=invertebrate metagenome TaxID=1711999 RepID=A0A2H9T5X6_9ZZZZ  ali  17  5.DAYLYIRQVEIHNANGISSPITYGFPAVTGFLGACHALERKINLDFCGVLIACHECRIKRYRPHRYSDYTLNQSRNPIKKDGKTASIIEEGKTDLTVSFVIPLHLTDNTDTFTDWVKKTLYCQPMAGGSVFSVGSVDII---QPENLDYLKASLAPAFVLMEAETLQKTHADQGRGWLVPMPVGYQSISPPGTMEECRTGDYPSQFVETLYGLGKWVFPYSLTSLSHAFWSMNTDDEGYLIQQTEQ. 315
95 4.000e-58UniRef50_UPI00071D9508 type I-F CRISPR-associated protein Csy2 n=1 Tax=Vitreoscilla massiliensis TaxID=1689272 RepID=UPI00071D9508  ali  20  1MSAYVLLERIKVQTANAIAG-VTYGYPAITHFLGFTHALSRKLKINFTGCAIISHQHTLKTHSNFIQSKCPPSTLMGKGSDANKTPPIIEEGKMDLTVSLLLECEVDEQQAQLKSLLQALIPTLRLAGGNIVDVGGIYL-LGEHPQLIPFLKQKLLPAYFLIDQSESVLTHQDKPSTWLVPLALGYKGITPVGSVANSRDVESPFVFTEMVYGVGAWVGIHKLQEVSAMIWRYHHHNEWYLAQQ.... 303
96 3.000e-57UniRef50_UPI0004289996 type I-F CRISPR-associated protein Csy2 n=1 Tax=Taylorella equigenitalis TaxID=29575 RepID=UPI0004289996  ali  21  3.RTFLIIPRVRVINANAMSAPFIIGLPSITSFMGFTHKLQLDIDIRFLRTGISIHSFNLRAYKE--GSRNLLSITRNPLKKDGTSPSFVEEAKCNFEVSIVIEVSGVSDNDKLVSRINNSLLGYKVSSGDLLSFKKPFIYSIDLDEEVKGLLKKLMLGYVLTERKDLVFVHEDKDNGWLVPITVGYHGLTTPEENINCREPKFNHVFCESLVTLGEFKLPTTINNIDDFLWKYAYESE.......... 279
97 4.000e-57UniRef50_UPI000A077608 hypothetical protein n=2 Tax=Ruminobacter TaxID=866 RepID=UPI000A077608  ali  22  6.TSLLILPHIIINNANAWSSPYTVGFPSLTSIGGAVHCLQRKISIAFKNFGVVSHKFNLRESR--SGYDSSIVLTGNPLVKDKKRPPFIAEIKCQMDISLIIEFEGDVNESSFIELIISTLHSMRISSGDVISFDRPRLIFANEPKVFRKIVGLLMPGYALIERKDLVKNSLDNQNGWLVPICTGYMGVTSIVPHANQRDDCTPHRFVESMVTLGEFRMLHKFKEIRELLWRSNYIEKD......... 287
98 6.000e-57UniRef50_A0A167P586 Uncharacterized protein n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A167P586_9GAMM  ali  19  1MSQYLVLSKIEVQNANAIAG-FTWGFPAITQFLGFTHALSRKINTEFVGCMVVANKVSNKVYQPKHYADFEFLQSKNPPKHKAASPPIIEEGKLNATVSLVLELSNTDQVAEFESKVKAMFSNMRIAGGSVLSIGKVKLFVADESKQLSHIKRLCMPGFVLKDQSEYLKKHTEPFNGYLVPIMAGYKAIAQPEEVLGLRVKPDPVAFVEAVHSVAEWISMHKVVQLSDYVWRYHQDGEWYLCQQ.... 322
99 1.000e-56UniRef50_A0A1M5VIR8 CRISPR-associated protein Csy1 n=2 Tax=Vibrio TaxID=662 RepID=A0A1M5VIR8_9VIBR  ali  20  482..TYLVLKRIQVTQANAV-GGLTYGFPAITHFLGYVHALSRKLGITLSATSVVCHHHQIHAYRAAGYEPYIFAQTRNPLTHEGKTAPINEEGKMNMTVSLVIRAQGDEQRRDQCKAIQQLAERHRLAGGKITSIDG--CYVTTHHEPV-KVFRPLMPGAILVDRATLLATEADKNKGWLVPFMVGYKQISPLGEVANMRDLNTPVSFVEPIHSIAEWIRPSRIETLSSVMWRYHDDAPFYACRS.... 771
100 2.000e-56UniRef50_F1D5V7 Uncharacterized protein n=10 Tax=Viruses TaxID=10239 RepID=F1D5V7_9CAUD  ali  100  1MRKFIIVKNVKVDGINAKSSDITVGMPPATTFCGLGETMSIKTGIVVKAVSYGSVKFEVRGSRFNTSVTKFAWQDRGNGGKANNNSPIQPKPLADGVFTLCFEVEWEDCAEVLVDKVTNFINTARIAGGTIASFNKPFVKVAKDAEELASVKNAMMPCYVVVDCGVEVNIFEDAVNRKLQPMVNGYKKLEKIVDNKHMRDKFTPAYLATPTYTMIGYKMVSNVDNFDQALWQYGENTKVKTIGGIYND 248
101 2.000e-56UniRef50_A0A1T0A1G9 Type I-F CRISPR-associated protein Csy2 n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1T0A1G9_MORBO  ali  20  13...YVRLDRLKIINANAVSAPLTYGFPALTGFVAATHSLSRKVNIRLDGVLVACFDCQVQTYQE-GYKDKTFAQTRNPILKSGKTAPIIEEGRCHLTISLLIGVYKDDEANQLTQNVQEFALSQRWAGGSLTGMSGVHFV---KKDDIDEQKSRLCPAFIITSAHDELDEITQKQRGWLVPMPVGFVGISDKGQMSHARSDEYPAQFVEAVYSLGKWRFANRIDDLDSALWYGDYDNTCDL....... 302
102 3.000e-56UniRef50_M5RW78 CRISPR-associated protein Csy2 n=1 Tax=Rhodopirellula maiorica SM1 TaxID=1265738 RepID=M5RW78_9PLAN  ali  19  1MGTMILIERLEVQNANAISSPLTMGVPSITAFMGFAHQLQRLVDLLVRQVGVVIHDIDLQTRQFPRSRSLLKLTANTRGSKKSDRASFIEEGRCHLTVSLLLDCETEGGTSETIERMQHLVMRMRLAGGTIINTDLPRIQTVSND---RRTLARLIPGWVLIERRDLMWSSGRHQPGYIVPIATGYQALTPVVPSNNARDRDTPHRLAESVLTLGEFVLPLRLEKPSEMLWQYQRDGDLYVCQQ.... 299
103 3.000e-55UniRef50_I7IKW4 CRISPR associated Cys2 family protein n=2 Tax=Taylorella TaxID=29574 RepID=I7IKW4_9BURK  ali  19  3.RTFLIIPRVRVINANAMSAPFIIGLPSITSFMGFTHKLQLDIDIRFLRTGISIHSFNLRAYKE--GSRNLLSITRNPLKKDGTSPSFVEEAKCNFEVSIVIEVSGINCEENITDIISYLLMKYKISSGDLLSFSNPLSDSINVESEVKGFLKKLMIGYVLTERKDLIKEFFKIESGWFVPISVGYHGITPLISNKNQRDPRFKHVFCESLITLGEFKLPTTLNNIDDFLWKYAYESE.......... 285
104 2.000e-54UniRef50_A0A2G4RDU0 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Acetobacter pomorum TaxID=65959 RepID=A0A2G4RDU0_9PROT  ali  18  10.SHFLVIPRVTVTGANAISSPITYGFPSITNFLGMMWALQRKVDVTFHGVGVVCHASRLHAARFWGGSVNTFSQTRNPLNSRGQVAPIIEEGRINLNVSFVFSVNCPSTVKSDLSIILHTLMTLRAASGTLDQDPSISPNTPNIESEFMETRFSLLPGFSLVGRHDALIERLRHSDGWLVPMPVGYVGISDPGDIPESRDNSVPHHFVESIYSVGEWVSPHRISSPVDLIW--HADRGQSGIYRCLN. 320
105 5.000e-54UniRef50_UPI0007507A03 hypothetical protein n=1 Tax=Pseudoalteromonas TaxID=53246 RepID=UPI0007507A03  ali  15  31...YLYFSDLRVFDANALANPYIKGIPSLSALGGWSHNFQRKVNLTVMGSAWFIQNYNLVAGKNLPE---PSVLTSKRNPSTVKSSGIIDTKKCDLTMGLVLRVYIDNPVD-LQSALIKAAFPSKFAGGCMHPPNKEWCHIYNDSELFSKLSRLPRNGCWVYPSDLEQLADTLKLNPRLKPASLGFFALEPMKYRENAIAD--LHCYVEPAIGIINCISPITVRFLNKALWQFNIEKDAMLMK..... 286
106 3.000e-53UniRef50_A0A090SRC3 Uncharacterized protein n=1 Tax=Vibrio variabilis TaxID=990271 RepID=A0A090SRC3_9VIBR  ali  15  94..QYIYLSFMRVQDALAMSCPYLCGIPSLTAIWGFMHHYQREFNQLIESFEFTSFSFFIRSERSTAKLTEPNSVVQKRTISNAKRPTIRSEILADLEIDIVIRVKGRERLSNYISELKASLPRA-FAGGDLFQPTNWLKIFSSQSELFQNIKGAPAHGRWLYPSDFDELELQISGGNANIPVSLGYHLLEAPTQRENALTEC--HAYAENVLGIAKRVNPIDVRFFEQAFWSLESSNETILIKNYRN. 356
107 2.000e-52UniRef50_A0A0J1K4A7 Uncharacterized protein n=6 Tax=Vibrionaceae TaxID=641 RepID=A0A0J1K4A7_9GAMM  ali  15  432.QQYIYLSSLRVQDAVAMSSPYLCGAPSLTAIWGFMHHYQREFNKLVNSFSRFAFYVRTENIQSTAKLTEPNSLAKSRTLSNAKRPTIRSERLADLEIDLVIRVDSDSRISDFLSELRAALPAA-FAGGAILSQIDWLRTFSSKSELFHVLKGIPAYGSWLYPTNFNELEHLITEDADNLPVSIGYHLLEHPTERENSITDC--HAYAENALGIAKRLNPIRDHFFDNAFWALESTSATILIKNDRN. 695
108 3.000e-52UniRef50_A0A269PLT8 Uncharacterized protein n=1 Tax=Pseudoalteromonas sp. NBT06-2 TaxID=2025950 RepID=A0A269PLT8_9GAMM  ali  14  432...YLYFSDLRVFDANALANPYIKGIPSLSALGGWSHNFQRKVNLTVIGTAWFIQNYNLVAGKNLPE---PSILTSKRKPSTVKSSGIIDTKKCDMTMGLVLRVYIDNPE-RLQSALIKAAFPSKFAGGCMHPPNKEWCHIYHDSELFSKLSRLPRNGCWVYPSDLEQLADTLKLNPRLKPASLGFVALEPMKYRENAIAD--LHCYAEPAIGLVNCISPITVRFLNKAFWQLNIEKDAMLMK..... 687
109 8.000e-52UniRef50_A0A1U9LJT4 Uncharacterized protein n=4 Tax=Acetobacter TaxID=434 RepID=A0A1U9LJT4_9PROT  ali  20  8.THFIVLPHVSVIGANAISSPITHGFPSITAFAGLMWAMQRKLGISLLGVGVVCHRHSEQALPYWAGNVRSFTQSRNPLNAKGEISPIIEEGRTNLELSLVFEVSCPISIVQELRTMRALLMTMRAAGGVMFSRSEPWAVRESNEETFSDLRFALSPGFALVSRHQWFQSGADVREGWIEPIPVGFASLSEPGRLEGVRDPSLRHFFVESVYSLGEWIPPYKISSIEDLIWRPRSEGGRLFCKNSY.. 323
110 6.000e-51UniRef50_A0A1I0W8X4 CRISPR type I-F/YPEST-associated protein Csy2 n=5 Tax=Selenomonas ruminantium TaxID=971 RepID=A0A1I0W8X4_SELRU  ali  20  1MTRYILLEKVNIENANAFNN-ITVGIPAITAFMGFGRALERKLNIKISGVGLEFHEYELKGYKNKQYVTTFPLPGSIPGLNEKKDAHIMNQAYIDLNMSFILEVEGRHIDKSTCKSIKAAVETLRIAGG--------IIRSYKDVHLIDTLADIP-YGYFLTLRQEALMIHALQQDSTLIPLAVGFKALSELGRVEGQRDPEKEHCFVESVFSLGGFECSKSVEDIDAYLWRYKTEEGLYLCT..... 252
111 8.000e-51UniRef50_A0A2T4I1M4 CRISPR-associated protein Csy2 n=6 Tax=Morganella morganii TaxID=582 RepID=A0A2T4I1M4_MORMO  ali  13  4..NYLLLKNIMIQNANXXXXXXXXXXXXXXXXXXXXHALERKVSVRFNGAGIICHHCHLRLYAGSGELVYSVLNNRKPPDKKGRNLSLIEEVYCHLNVSLFIRSENTEEENKFIPVVSEAVRILKIAGGDITDAGIPETGIIPDNKQWCELRQRIAPGYALLERRDVMIRAMNSPGSALIPVATGYQGLSPPGAAENVRAEDIPHRFAESVITLGEFRRTDKLRNTSAMLWCYHYDDNLYLCQQ.... 269
112 1.000e-49UniRef50_M1SIC6 CRISPR-associated protein, Csy2 family n=20 Tax=Bacteria TaxID=2 RepID=M1SIC6_MORMO  ali  15  1MSNYLLLKNILIRNANXXXXXXXXXXXXXXXXXXXXHALERKVSVRFNHAGIICHYCHLQLYAEPGGVMYSALNRRKSPDKKGKTPSLVEDVYCHLNVSLLI-CGGNDKNKEFLTVVSETIKMLKIAGGDITDSGKQETGSFPDSKPWCELRQCIASGYALLERRDALLKYTTAPGSVLIPVVTGYQGLSPPGIVKNARAEGIPHRFAESIITLGEFRPVDKLRDPSDMLWRYHYDENLYLCQQGKHD 273
113 6.000e-49UniRef50_A0A1I2TT02 CRISPR-associated protein Csy2 n=1 Tax=Neptunomonas qingdaonensis TaxID=1045558 RepID=A0A1I2TT02_9GAMM  ali  16  434.SQYLYLQGSRVFDANSLANPYLTGVPSLTALWGFAHNFQRRMNLRVKGVGWF-----IRGYSAKPTSKLPEFSVLKRDDQSIKRPGVITSRYCDLVMDVVLELERNDEEVLLTSQFLQAALPSAFAGGCLQPPSKDWCKVYSDRQLFSTLVRLPRNGCWVCPSKTKLKGFDDSRDSFEKPAMVGYALLEEPGERYGSIEQ--PHAFAEPLIGMVNCKSAIEVRFFNDSFWNIYTEKRCILIKK.... 694
114 2.000e-48UniRef50_A0A109X1Q4 Uncharacterized protein n=1 Tax=Vibrio fluvialis TaxID=676 RepID=A0A109X1Q4_VIBFL  ali  14  194..QYLYLPSMRVFDAAALSCPYLSGAPSLTAVFGFVHRYQRELRLKFKDFAIFIRDESVQTSAKLTE---PSVIAKARSISPVKRTTIIREDRSDLVFDIVITIESDQRLSDYLNQLRAALPTN-FAGGTLFQPEDWLRVFVSKSDLFQAVKGLPGYGTWLQPQNLMELQERLSNDGSLIPVANGFHFLELPQEREGALTN--LHCYAENNIALAKRVSPIRDHFFEQVFWSLEVTEQTILIKKGSN. 457
115 2.000e-48UniRef50_A0A1F4DET0 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_63_13 TaxID=1797498 RepID=A0A1F4DET0_9PROT  ali  17  1MSHYIVIPRVEVRNANAQPVWWIIGPPPVTAYVGFAQALALHLNTRHDGIAVVHHDIQFLGETLPHQFRAASFIDKADYTSKNPVLSSQPTARCHLTVSVVIRFDGDASFSE--EAIAPFLRGGRLAGGTIIEHGKPVVLANED--DIDKVVKAVGAGFSLIERQDLMVKQDDEDRIWLLPTTLGYAEITPRQQRKNVR-GKFPHAYCEPLVGLAQYRS---IRDAGLQFWRF............... 255
116 5.000e-48UniRef50_D0C9W7 CRISPR-associated protein, Csy2 family n=37 Tax=Acinetobacter TaxID=469 RepID=D0C9W7_ACIB2  ali  15  1MSRYVVIPRMRVQNANMQTNGFLLGGVPLFAANMFAHHLARQLGTQEEGIIYIHHDQQRLGGQTPAQRRGAVFIGKKDYSSKNKYASLQPTASCHLEFSLVIKFSSS---RISPEKLTNILKCSRFAGGQIIEFLEITTHSENELE---TALKKIKTGFAILDRQDLLIEYQQRKQSWISATNLGYALLEPLTQRAGIRQENTAHAYAEPLTGIIQYFSLGEIHNLQKLLWTYHWPQDDILKQNCIN. 293
117 1.000e-47UniRef50_UPI0003FC966A hypothetical protein n=1 Tax=Ferrimonas senticii TaxID=394566 RepID=UPI0003FC966A  ali  15  431..SYLHLSGLRVFDAQALSNPYLVGIPSLSALWGLAHQYQRKLTIQIAGTAWYIAQYNLNESKKLPEPRTPRKVSAP---SEVKRPGILDNKLCDMSIELVFKLVSVDGEAPLSPELAQAAFPSRFAGGCLQPPHTHWCQLTSPQELFDELKRLPRGGAWVYPTATGVTALDELPNPSYRPASIGFVALEEPQERAGSLERT--HCYAEPAIGVVNCVGPIEVRFLEKAFWQMDVDGRAMLLHK.... 692
118 2.000e-47UniRef50_A0A0P9HYQ8 CRISPR-associated protein (Cas_Csy2) n=14 Tax=Alteromonadales TaxID=135622 RepID=A0A0P9HYQ8_9GAMM  ali  15  435..RYLHLSGIRVFDAQALSNPYCSGIPSLTAVWGMIHSYQRKLNEALTNVRFTSFSWFIRNYSAVVGKKLPELSLQGAQQSRLKRPGIIDGKYCDLVFDLIIHIDGYEDDLQAVDDILKAHFPSNFAGGVMHQPENWCCLYSNENQLFEKLRRLPLSGCWVMPTEHKIQLLLLNSDSKLSPSMMGYMLLTEPKARVGSLER--LHCYAEPAIGVVKYETAISVRYFNSAFWMLDAQEKFMLMKKF... 695
119 2.000e-47UniRef50_A0A2D5V6K8 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2D5V6K8_9DELT  ali  19  2..RYLIIPHLRVQRANALATPWIISTAPVFACTLLAHAIGRDVGVQPEAVGIVHHDAQLLGDHFPHQYRGASYIDKDDYSSKNKHASLQPAASMHLELSLVLAYEEVCPA---VESIRNSLRQRRVAGGLIAEHGNPVVTSRFEGK--GGVWSVIRSGHWLIDRSSELTGDQKPKRLWLTPAVMGYAAITPFAKRKGAR-GGFPHTFAEPLVGLVEYQGHHQTDEADPLLWRGQWLHDD......... 264
120 2.000e-47UniRef50_A0A2R4TN41 Type I-F CRISPR-associated protein Csy2 n=16 Tax=Bacteria TaxID=2 RepID=A0A2R4TN41_9GAMM  ali  15  9....LYVVRLNVENASIISSHLTWGFPAPSAFTGFMHHLQRQLNIECCGVGIISHQFNPQITKTNSFRYSPYNLARHPLKADGSTPAMIEEGKGHFEVSLVIGLAGDGLDQSLLDRLNHLVYNMRLAGGSVFPHKRVKLINWSEHDAVDKLRRSVLPGFALQHRHELLMAHQNKNSPDLLDTPIGYAALTPQGVIKGLRHDDYPATFVETLISLGEWQSPHRIKNIVDTLWNYNTEPKNGL....... 331
121 3.000e-47UniRef50_Q1ZP96 Uncharacterized protein n=4 Tax=Photobacterium TaxID=657 RepID=Q1ZP96_PHOAS  ali  14  382.SVYLHLRRLKVSDASALSNPYISGIPSLTALWGFVNNYQSRIKVEVQSVAWFINDYSEVKSKKLPE---PSIPESKRKVGNIKRSGIIDGKYCDMTIDLVIKLKIGDNFPEI--QLLQAALPSRFAGGTLLPPSDWLEVFDDKSELFSVISRKSRFGCWIYPSDEKLESFEQLEQPDLKPVNMGFIPLDVPCNRENSISNF--HCYAESCIGVVQCKNPIEVRFFESAFWHLDNENGAILMRKY... 640
122 3.000e-47UniRef50_Q6F9L5 Uncharacterized protein n=14 Tax=Proteobacteria TaxID=1224 RepID=Q6F9L5_ACIAD  ali  15  1MSRYAVIPRIRVQNANMQSNGLLLGGVPLFAANMFAHHLARQLGTTDEGIIYIHHNQQRLGGQTPAQRRGAVFIGKKDYSSKNKYASLQPTASCHLEFSLVIKFSSS---RISPEKLTHILKRSRFAGGQIIEFLEITTHAENELE---AALKKIKTGFAILDRQDLLIEYQQRQQSWISATNLGYALLEPLTQRAGIRQETTAHAYAEPLTGIVQYFSLGEIHNLQKLLWTYHWSQDDILKQNC... 291
123 4.000e-47UniRef50_A0A165X9F1 Uncharacterized protein n=109 Tax=Vibrionales TaxID=135623 RepID=A0A165X9F1_9VIBR  ali  13  433..QYIYLSSMRVQDAVAMSSQYLCGAPSLTAIWGFMHRYQREFNKLVNCFSSFSFYVRSENIQPTAKLTEPNSVAKARTVSNAKRPTIRSERLADLEIDLVIRVHSESRISDFKTALKTALPVV-FAGGALYQPQEWLRTFTSRSELFHVIKGLPAYGRWLYPSDNQDLEHLITKDADNLPVSIGCHLLERPTKRCNSITDC--HAYAENAIGLAKKVNPIRDHFFNHAFWSIECSSETILIKNYRD. 695
124 5.000e-47UniRef50_A0A2U2ATJ2 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Ignatzschineria sp. UAE-HKU57 TaxID=2182793 RepID=A0A2U2ATJ2_9GAMM  ali  14  9ITYYLVLNHLTVRDANAISGNLIYGFPALTAIEGFVHALNRALIKEVENRDIVAHEYEAKVYREHSGRDYTFLQRKAPLTRSGANPPIIEEGRIDLKLSLVIEISNEAKLQQGKSIIKHWLSQSRFAGGVVHEDIHWLESEVDDEQMKRKIIKQVGFGYLLCSREDLMGKLLDENNGWIVPLMVGYQSVSEPHALKAIRMPEYPTEFVEPLYSLGQWILTYRIVSLSHYFWFNEREAGQYLL...... 321
125 5.000e-47UniRef50_UPI000DA685E5 hypothetical protein n=1 Tax=Vibrio casei TaxID=673372 RepID=UPI000DA685E5  ali  18  67..SFLLLPNTKVSGATALSSSVTIGIPSLTAFYGYVHAFERKLRELHAATKIESFAICIH--QFHLDKRGLTKEFVEKTNGTISPPSIHDDWQCDFTFSLILKF--THQPTMPIDSIIKALPK-RLARGAAKISIIDFHNIQSFDNLTSAVKGKWLSLYKHPLNNFDDMVTNVKNRQWLTPSCVGYHLLEQPVEKKDTLRN-YRHAFAESIIGLINPIVFGNTTDPNKILWCYQYHHDHIVLQ..... 307
126 5.000e-47UniRef50_R1IRY4 Uncharacterized protein n=6 Tax=Vibrionaceae TaxID=641 RepID=R1IRY4_9GAMM  ali  17  430....IHLENLRVFDALSLANPYLVGIPSLTALWGFIHAFDRKLKTLLGCFTFESVAWHVRESSSVSGLKLPSPTLERKRSDHLKRPGIVESIHCDLVMDLAIRVHSTESRDELIDLIKAALP-SRFAGGVIHPPSKDWCSLRTTRSLHEHVSQLPATGRWIVPAKTAPKSFENELNMDLKPVMVGYQLLEEPTERPNSVSPV--HAYAEPLIGLCDCKSPIDIRFNATCFWKMDVVGGSILMRR.... 686
127 6.000e-47UniRef50_A0A2A2CSM0 Uncharacterized protein n=2 Tax=Vibrio TaxID=662 RepID=A0A2A2CSM0_9VIBR  ali  14  433..QYIYLSSMRVQDAVAMSSPYLCGAPSLTAIWGFMHRYQREFNKLANEFSSFSFYVRSEKIQSTAKLTEPNSVAKARTVSNAKRPTIRSERLADLEIDLVIRVHSESRISDFRSALKTALPVA-FAGGALYQPQEWLRTFTSRSELFHVLKGLPAYGRWLYPSEDQPYDFDELERADNLPVSVGYHLLEHPTKRDNSITGS--HAYAENAIGVAQRVNPIRDHFLNHAFWSIECTSETILIKNYRD. 695
128 6.000e-47UniRef50_UPI0003F6B091 hypothetical protein n=1 Tax=Neptunomonas japonica TaxID=417574 RepID=UPI0003F6B091  ali  14  88.SQYLYLQGLRVFDARSLANPYLNGVPSLTALWGFAHNFQRRMNLRVKGVAWF-----IRGYSAKPTSKLPEFSVLKRDDQSIKRPGVITSRYCDVVMDVVLELERSDEEVLLTSQFLQAALPSAFAGGCLQPPSKDWCKVYSDRQLFSTLVRLPRNGCWVCPSKTKLKGFDDSQDSFEKPAMVGYALLEEPLERYGSIEQ--HHAVAESLIGMVSCKSAIEMRFLNDSFWNIYSEKRCILIKK.... 348
129 8.000e-47UniRef50_UPI0006EBEC35 hypothetical protein n=1 Tax=Agarivorans gilvus TaxID=680279 RepID=UPI0006EBEC35  ali  13  432..QYIYFSNLRVFDADAMANPYLCGIPSLTAVWGMCHRFQLQLNVSVDGFTWFVHQYSLSAGRKLPEPSRYIR-------NELKRPGFIAGQHCDLTIDLILKISAREDFRLSDDDIIQASLPAKLAGGSVHPPSREWCSLYSQHELFDRLARLPTGGRWVFPTHQEVHSLEETSDYSIKPAMLGYLLLEEPTLREGAL--TSMHAYAEPLLGLVQTLSAIDVRFWAAAFWQLKVSERAMLMKSL... 689
130 1.000e-46UniRef50_UPI000DEBD905 UPI000DEBD905 related cluster n=5 Tax=Vibrio TaxID=662 RepID=UPI000DEBD905  ali  15  433..QYIYLSSMRVQDAVAMSCPYLCGTPSLTAIWGFMHHYQREFNHLVEDFSSFSFFIRSENIRSTAKLTEPNSVAAKRTISNAKRPTIRSEHLSDLEIDMVIRVNGNGRLSDYLTELKAALPTA-FSGGYLFQPPNWLTTFRSQSELFHTIKGAPAYGRWLYPSEQQPINFDETSDSDIIPVSIGYHLLEIPKQRDNTITG--LHAYSENAIGIAKRVNPIEVRFFDRAFWSLECNSETILIKNYRN. 695
131 1.000e-46UniRef50_A0A0J1JSL5 Uncharacterized protein n=6 Tax=Photobacterium TaxID=657 RepID=A0A0J1JSL5_9GAMM  ali  13  428...YLHLQQLVVHDASLLSNPYVSGIPALTALGGLMHNYQRRLSALMECECLIQRGAWFIAHYHQQKIKKLPEPDKVRYLKDVQRPGITDGKYGDLTMNLVLELQLPESVSIPELSLLQAAFPSRFAGGTLHPPSDWLSVYSNQSELFSVLARLPRSGCWVYPDDKGVSSFDEDNDPDLKPVGLGFIPLEEPHCRVGSIAPY--HCYVEPCIGVVRCMNPINVRFYQSAFWHFDIANDAMLMKK.... 685
132 4.000e-46UniRef50_A0A1Y6MEP9 CRISPR-associated protein Csy2 n=8 Tax=Photobacterium TaxID=657 RepID=A0A1Y6MEP9_9GAMM  ali  17  389.NQYLLLPQISVCGASAISSPITIGIPSLTAFYGFIHAFERNAQKVFSNLKVDSFAICIHT--FHLQKRGMTRESVIKLTNNISPPATHDEWHCDLKFSLVLKI--NNLANLNQSKILYSLPK-RLAGGSIDDIKTIQVSFKDLVKQIPTFQGQWLSLYKTKIDSFENIIQQIKASQNITPTCVGYHYLEKPTERPFALRD-YNHVFAEPIIGLIKPITIKEDTNLHDLFWNQINKPHYTTIE..... 630
133 1.000e-45UniRef50_E5Y9T9 CRISPR type I-f/ypest-associated protein csy2 n=2 Tax=Bilophila wadsworthia TaxID=35833 RepID=E5Y9T9_BILWA  ali  20  205..RYLILPNLRVQCANILTNQILVNGPPISAAWGMGHALEREMGRRIEGVCLVMHYVEPLGEREYGAFEPSFEKSRNDYTKGTINLSLQPGVCAHMRVSVVYELSRD--LTSLPRAVEAFLATGRFAGGLITSYGKPDLHDDRDT-----LLECLPVGRVIVDRRDLMASGYRHKQEWLSATNIGYSAITDFGLRGGARDGH-LHAFAEPLIGIVEYV--NTLDRAQSYFWHDRWLDDSFLLEG.... 457
134 2.000e-45UniRef50_UPI00056D59AF hypothetical protein n=1 Tax=Methylobacter whittenburyi TaxID=39770 RepID=UPI00056D59AF  ali  20  1MSRYVIIPRIEVKGANAQSAWWLVSGPSPLAWVGLVRKLAIDLGIPDHHVAILHHDLEMRGEMFYGQMRGAALTTTNKGASSSMSMGLQPVALCNLTATLVIE----GMENVDVDALRERLLCSRLAGGTIQTCGRINKNKYARQD----ILKSVSNGFFLKERSDLLAQGGAEGDAWLVPMNLGFLALTPAVLKPNTR-ARFPHAYAEPLVGLVQYISKRTLNDLDNLFWGYQQQGSAFVVKNI... 266
135 4.000e-45UniRef50_A0A1G9LHQ9 CRISPR-associated protein Csy2 n=1 Tax=Halomonas muralis TaxID=119000 RepID=A0A1G9LHQ9_9GAMM  ali  15  437..SYLYLKGMRVYDASAMANPYLCGIPSLTALWGLIKEYEIKLDVEFDGVAWFLREYQERGDTKIPAPKLSEEPGR------LMRSGLLPSRYCDMTMDVVVRVHDPDLELAAIDQLLQAACPGRFAGGALHPPSLQWCQVDDGDNLFKKLRRLPHSGRWVTPSTIQSDSLLETLDSDLRPVSAGYALLEDPVERVGSLM--VLHAYAESLISMARLVSPIEYRFAQQAFWGMQPEKCAMLMAR.... 692
136 5.000e-45UniRef50_UPI0007EEEBE8 hypothetical protein n=2 Tax=Alteromonadales TaxID=135622 RepID=UPI0007EEEBE8  ali  13  439.QRYLYLKGIRVFDAQALSNPYCVGIPSLTAMWGMMHNYQRRLNELLTHLRMTSFSWFIRQYSPVAGKKLPEYGMQGVNENQFRRAGILDNRHCDVEFDVVIHIDGHEEDLEHSERAIKASFPASFAGGVMHAPEDWCELFSNEVLLYSKLRRLPASGKWIMPTKHQLDSHLLKLNASLCPVMSGYLLLDSPIARKNALER--LHCYAESTIGLVECNTAIDIRFFRRAFWMLEIKETSMIMKRI... 700
137 5.000e-45UniRef50_A0A0U3IAX9 Uncharacterized protein n=6 Tax=Pseudoalteromonas TaxID=53246 RepID=A0A0U3IAX9_9GAMM  ali  18  417..QYVHCQNLRVYNAEAMPNPYIMGMPSITALEGLGHQFQCKLGVHVIGVAVYVRSYQLHNNKQLPE---PNKLKKDGQKRVPLRSAIMQIPKCDICFDLVFRVQTNNQANDLSENLLKAAFPSRYAGGTLHPPQIDWCQVYTKPALFERIRSLPKGGSWLYPTSVEVSSFEETLRPTMRPAALGYLALEEPKPRQGSITQ--LHCYVEPVIGLLECVDAVTVHFFNHGFWAMHCKKASMLMKK.... 677
138 9.000e-45UniRef50_UPI000920B437 hypothetical protein n=1 Tax=Moritella viscosa TaxID=80854 RepID=UPI000920B437  ali  14  431..YYLHFKSLRIEHALALSNPYLVGIPSLTAFGGMMHKFQLRAQKILDAIKVVSGAWFIHQYNQYNHKILPELRIANKSATKITRNETVDSHFCDLTVDFILKIETDINIIDEIDKIKGA-FPSVFAGGDIFPPMTDWLQIYPDRDLFSALGRLPRSGCWISPSDIAFECLDDKAERELKPIHIGYQFLEEPRARFYSISKY--HCYAEPLIGLCRCDSPINIRFFNDLFWRHDVNDNAMLM...... 686
139 1.000e-44UniRef50_UPI000380EC17 hypothetical protein n=2 Tax=Ectothiorhodospiraceae TaxID=72276 RepID=UPI000380EC17  ali  15  3...YLALPHLQVQQANALSTQWMISLCPVMAAVLMSHALGRALKVQPSGVAIIHHDAYLRAERHPHQFRASTYIDGDDYSSHSKDPSLQPTATMDLEWSLVLRFDEDLPERAL-RKVHTFLQRGRLAGGLIVDYRDPVLGYSGDRSNWGVIDRVVGGGHILADRSSLLASGAQPFSGWLTPAVLGYALTSSVESRANVR-NDLPHAYCEPMVGLVEYIGLRTLQNPEDLFWRYSWPHEAAFM...... 280
140 2.000e-44UniRef50_A6FFX9 Uncharacterized protein n=1 Tax=Moritella sp. PE36 TaxID=58051 RepID=A6FFX9_9GAMM  ali  15  437...YIYLNSIRVESAQALSCPYLIGTPSLTALGGFSHKLQRNLQERLSAVEVECSAWFIRQYELSKYKPSPQINRFDRKKEVLIRDGIIDDYLCNMTMDIVIKLNKDIHGPNFINKLKGIIPK-RFAGGSIYQPINWLQVYSSESALFSVLSRLPKSGCWVAPSSEPLTSFNDKINSKLKPVLIGYQAVEEPSSRLYSLEKY--HCYAESLIGVAQFLNPITVRLFEDIFWQHYFESKTMLM...... 695
141 3.000e-44UniRef50_A0A0U2WNT9 Uncharacterized protein n=22 Tax=root TaxID=1 RepID=A0A0U2WNT9_9GAMM  ali  17  418...YVHCQDMRVFDAEAMANPYIQGMPSLTALNGLAHNFERKLSIKCIGSAIYIENYQLHTGKPLPE---PSKLKQVAGRSHVIRSGIIDKPKCDITLDLVFRVPNTELLDKLNSQLIKPALPSSFAGGTMHPPSIDWCHVHTKPELFKKLKAKSSNGSWLYPSKKVVKSFEQNSNFNLRPAAIGLAALEEPVKRDAALHEY--HCYAEPVIGLLECVSNTSVKFFHDAFWVMDVQKESMLMKK.... 677
142 6.000e-44UniRef50_A0A1Y1QQ53 Uncharacterized protein n=1 Tax=Thiothrix lacustris TaxID=525917 RepID=A0A1Y1QQ53_9GAMM  ali  20  6...YVVLPGLQVKDFNAESNQYVVGIPAMTGFTGFGHGIERELNLQVEGVAVMLHDLRLHEGH-------PKCPAAMLGAKDFINPPIIEEIKGDMRVTLVLRLVGNYDDEALSQKLANWIHANPCCGGSCHDLKALRLTETEDDDLLLKALRRLQKGFWVVPRDDLLSERQAEGQRWLVPLAIGYQAIEAPQPRQGVR-KAAPHIYAEPLTGLGELVYASRPDFMDSVFWVHRHDAQQQT....... 294
143 8.000e-44UniRef50_A0A2T3PUV0 Uncharacterized protein n=5 Tax=Photobacterium TaxID=657 RepID=A0A2T3PUV0_PHOPO  ali  13  432..QYIYLSDLQVFQALALSSPYLCGVPSMTAIWGFIHQYQRSFDIEFSSFAIFFKQEFIYTGSVLPE---ASKLSAKRTISSVKRTTLKDEYHSDLVIDMIIKVKSSVNINNHISLLQAALPT-RFAGGSILQPEDWVNVINDHEQLFHQVKGLPNYGEWLIPESQQELSSFMEADQSLIPVSAGYHFLEYPNERDGSL--CSHHVYAENALMLAKKVKPIDIHFHKNAFWSLDVNSSTILIKK.... 691
144 8.000e-44UniRef50_A0A231P0G3 Uncharacterized protein n=2 Tax=Desulfovibrio TaxID=872 RepID=A0A231P0G3_9DELT  ali  17  1MTAYLVLPHMRVQGANMYNAAFLVGGPPVLAAWLMAHALGRKIDMAVLAMAFILHSYTPLGDSFYGIFNGSSLNGSDYSSKNKQALSLQPVARAHMEVSLVIGI----RDLATTEGIDSHIATSRLAGGAITRMGKVRL-----CSDASEALEHIGVGYAVMDRRDLLEKEGAGNRGWLSATCLGYAATTPFEKRSGVREG-YEHAFAEPLVGLVQYVPIRRCDRAEQTLWRSEWATPD--VYRIYQE 270
145 1.000e-43UniRef50_G9YI71 CRISPR-associated protein, Csy2 family n=1 Tax=Anaeroglobus geminatus F0357 TaxID=861450 RepID=G9YI71_9FIRM  ali  18  1MKKYILISELAIHNANAMSSTITIGVPAMTAWLGAVHALERKINKKFEGVQFPCTTVDLQVYKGHGDYANSIIGTANPLDDKGKRASFIEEPRIHLKVSLLIETEGGDCEDKFIEIFSKELYKSKFAGGDVMDFERVRLVYSNDVHDTRKIVSMLMPGFVVVERKF.................................................................................. 176
146 1.000e-43UniRef50_A0A2S3XKM9 Uncharacterized protein n=1 Tax=Aeromonas veronii TaxID=654 RepID=A0A2S3XKM9_9GAMM  ali  12  435.SYYLHLSGLTVYDAAALANPYLCGIPSLSALAGFCHDYERRLIVCFTGIAWYLSRYSRVTGKHLSEPDRPEH---ARAVSAIRRPGMIDGRYCDLGMDLVIQVDGTQSLTHCLDLLRAALP-ARFAGGCLHPPERNWCNLYQDQDLFTALSRLPRYGCWVYPSNRELSSVEEALDRRLCPVSTGFVFLEEPTERAGSLEN--LHVYAESAISTALCINPVEMRFYKSAFWRMRDENGTILMKGPEN. 700
147 3.000e-43UniRef50_S5IX03 CRISPR-associated protein Cys2 n=45 Tax=Vibrionaceae TaxID=641 RepID=S5IX03_VIBPH  ali  13  389.DKYLLLPNLRISGASAMNTSVSIGIPSMMAFYGFVHAFQRNVQTANPNFKIESFAVCIHNI--HVENRGLTREWVPNTKGQITAPATRDDWQCDVAVSLILRCS--HYSQLIPRDFIRLLPG-RIARGKVTVSISDIKHLGRCLSLADAIKAIPVTGRWLTLNSIQDVIDELKNNRLQTVSCIGYQLLEPPCEKRGSLHG-YKHAFVETILGIIKLLAISKNTNPDQYFWQYHYSKQ.......... 626
148 3.000e-43UniRef50_A0A0X8LJC8 CRISPR-associated protein Csy2 n=9 Tax=Vibrio TaxID=662 RepID=A0A0X8LJC8_VIBFL  ali  14  403.SQYLLIPELRICGGSAMSSSVSVGLFSMMSLYGFIHAFERNVHRVLTSFTIDSFAICIHNYHLEKRGLTKEAIKKTKANKDEKPPAIYDDWQFDSCISLIIKT--PESKTISTDKIVALLPK-RFARGSIWLPIDDIQNIATFPEPFTAIQAIKNPGTWLSFEADLSLTSTDSLVGNLWLTGMGYQYLEPPTVKPDSLRD-YPHAFVENILGYVKSQPVSRATNLDDLFWCYQVKP........... 645
149 3.000e-43UniRef50_A0A1H4FLG2 CRISPR type I-F/YPEST-associated protein Csy2 n=1 Tax=Thiothrix caldifontis TaxID=525918 RepID=A0A1H4FLG2_9GAMM  ali  19  10...YVVIPGLQVKDFNAESNQYVVGIPAMTGFTGFGHGIERHLQLQVEGVAVMLHDLRLHEGH-------PKCPAAMLGAKDFINPPIIEEIKGDMRVTLVLRLVGDLDDAALYEKVRDWIHANPCCGGSCHDLKALRLMVVETAEDHSRLVAALKKGFWVVPRDDLLRERQAEGQRWLVPLAVGYQAIEAPQPRQGVR-KNARHIYAEPLTGLGELVYASHWFSLDSVFWVHRHDAQQQT....... 298
150 5.000e-43UniRef50_UPI000D558698 type I-F CRISPR-associated protein Csy2 n=1 Tax=Xanthomonas fragariae TaxID=48664 RepID=UPI000D558698  ali  17  8.SHLLVLPHLHVHNANAVSSPLTHGFPSMTALLGLMWALQRKLELTFHAIGAVCHAHQEQV--TEGGFVKAFHLTRNPIGKDGKTAPIVEEGRIHLELSLVLGVHSPPAQQADTDAVAELLAGMRIAGGSLRAPAQPWRHRYDRTTQFRKARMRLLPGFALVERADLLDARLAELQA....................................................................... 204
151 6.000e-43UniRef50_H8Z7X3 CRISPR-associated protein (Cas_Csy2) n=1 Tax=Thiorhodovibrio sp. 970 TaxID=631362 RepID=H8Z7X3_9GAMM  ali  17  2..TYLLLPNLDVLHANASACFGLISPAPVFAATQLAHALGRRIDCKITGTGIIHHSAQMLGEFKPQQRRGATFINKSDYSSSNKTASSQPTASLHLRVSLLLEVQG----QVDLPEVERFLQRGRLAGGTIIRHGRISQKAPGDDP----LSGLPAPRYWLIERRDLMEREPDPPVSWLTPAVLGYAALTEFQERQGVRDACTLHAFVEPMIGLTQYVSVRQYQNGLIPLWRPKWIQSDIL....... 277
152 6.000e-43UniRef50_UPI00046EE4EC CRISPR-associated protein Cys2 n=1 Tax=Vibrio parahaemolyticus TaxID=670 RepID=UPI00046EE4EC  ali  13  245.DKYLLLPNLRISGASAMNTSVSIGIPSMMAFYGFVHAFQRNVQTANPNFKIESFAVCIHNI--HVENRGLTREWVPNTKGNISAPATRDDWQCDLAVSLILRCS--HYSQLIPRDFIRLLPR-RIARGKVTVAISDIKHLGRCLSLADAVKTIPVTGRWLTLNSIQDVIDELKNNRLQTVNCIGYHRLETPCEKRGSLHG-YKHAFVETILGIIKFLTISENTNPSQYFWQYHYSKQ.......... 482
153 7.000e-43UniRef50_UPI000D75358A hypothetical protein n=1 Tax=Klebsiella oxytoca TaxID=571 RepID=UPI000D75358A  ali  13  433...YLHLSGLNIYDASAMSNPYLCGIPSLTALAGFCHDYERRVSVCFTEVAWYIGHYNLISGRQLPA---AMIPERKNTISSLRRPGITDEKCCDMGIELVIKLQFPEECKLPESGLLYAASPSRFAGGVLHPPEKSWCQLYSDQDALYSVLSRLPSGCWIYPTTLEEMFTELSSDYRLRPVSSGFILLEEMQYRAGSLASQ--HVYAESALGLARCHNPIEIRFYNQGFWPLDYEDRTII....... 687
154 8.000e-43UniRef50_H0IXJ7 Uncharacterized protein n=5 Tax=Halomonas TaxID=2745 RepID=H0IXJ7_9GAMM  ali  16  424..YYLHLKNLHVFDAQALSCPYLVGLPSLLAVWGTVYNYQLRLNIAFEGVAWFLRQYESSSGAKIP----APYLAPTKPGEAPKRPGLIDMRFCDLRMDLVIRYRLEDGHDNDELPMLQSALPGRFAGGTMQPPPLQWCQLHGDANSLLAAISLLPDGRWVVDSEKQVQSI-DSLVAWLLPAMSGYQLFEEPCYRSGSHRE--LHAYAEPLVGLTETLSPASVRFLKNAFWRLKSQNLTMLMKK.... 685
155 8.000e-43UniRef50_A0A2N7I2U5 Uncharacterized protein n=5 Tax=Vibrionaceae TaxID=641 RepID=A0A2N7I2U5_9VIBR  ali  17  390..SFLLLPNITVSGATALSSSITIGIPSLTAFYGYVHAFERKLRELHAATNIESFAICIH--QLHLDKRGLTKEFVKKANNTISPPSTHDDWQCNFTFSLVLKFS--HQPNIPADSIIKVLPK-RLARGTAKISIADFHRIQPFDSLTSAVKGKWLSLYKGHLGSFDDLIGSVREKRWFTPSCVGFHLLERPVEKKDALRG-YKHAFSEPIIGLINPIIFGNTTDPNKILWRYKYHQNHIVLQ..... 630
156 1.000e-42UniRef50_UPI0009DB0F91 hypothetical protein n=1 Tax=Thioalkalivibrio TaxID=106633 RepID=UPI0009DB0F91  ali  15  46...YLPISHMRVQAANALVTPSMISPCPIMAAVMFGHALGDTIGCETTGVAIIHHDAQLRGERMNPHKRKEFQPHQMRSKSNGPTLSLQPVALADLEWSIILELSCDGEAGLQIKKLRKRLRGGRLAGGQIVGYSAADEAFPALLGKEGAIAKKIGGGHALIDRSDRLIHPEAEESGFFVPAPMGYAMVTEFEERKGSREG-LPHAFGEIMVGLAEYAGIRRGFEAQSLLWRHHWDVD.......... 315
157 1.000e-42UniRef50_UPI0009F428DD hypothetical protein n=1 Tax=Halomonas lionensis TaxID=1144478 RepID=UPI0009F428DD  ali  15  68..HYLHLKNLHVFDAQALSCPYLVGLPSLLAVWGTVYNYQLRLNIVFEGVAWFLRQYESSSGAKIP----APYLPPMKPDEAPKRPGLIDMRFCDLRMDLVIRYRLEDGGDNDELTMLQSAFPGRFAGGARQPPELQWCQVYADANSLLAAISLLPDGRWIIDSEKQVQSIESSKHPNHLPATSGYQLLEGPCYRSGSHRE--LHAYAEPLVGLTETLSPASLRFIKNACWRLKIQNLTMLMKK.... 329
158 2.000e-42UniRef50_C3X846 Putative CRISPR-associated protein, Csy2 family n=2 Tax=Proteobacteria TaxID=1224 RepID=C3X846_OXAFO  ali  17  1MS-YLLIPDMRVQTANIHHSSFLLGGPPVMAAFFFAHAMGRQLGVRVNGTAYIHHHMDVLGQSFLQQRRGAAFTFSNKPKKDYSSLSLQPVANAHLRLSLIIDIDNLES----MAGVNRFLHKARFSGGHIISHGEP-----GQYDDLDEAIDDLPAGFFVMDRSDLMKTESETGNTWLSAACLGYAMLTPYASREGAREG-YEHAFAEPLVGLVQYRSSRQFKDYETVLWKPEWVKDD--VYRLHQD 266
159 2.000e-42UniRef50_B5FD59 Uncharacterized protein n=5 Tax=Aliivibrio TaxID=511678 RepID=B5FD59_ALIFM  ali  17  431.TQFIHLKNLRLYNGNALSSPYVCGLPSLTGFWGFMHDFERRLNIHFEAFSLFVHQYELQSSPPLCE---ASDIYKKRELSPAKRLLTQPSYSCDMRFDLIIKVHTEVNLSDISQRMLSA-MPARCVGGTLHQSSEWLTSYASSEHLYEELACLPNSGRWIYPPSETFNTPDELGNSTHLAICNGYSFLEDPTNRENVSLNQ--HVFCEPLIGLAEQVIPIDMRYFSNAFWSINSDFNSILIQK.... 688
160 2.000e-41UniRef50_A7N6M6 Uncharacterized protein n=17 Tax=Vibrionaceae TaxID=641 RepID=A7N6M6_VIBCB  ali  14  386..SYLVLPNIRVCGATALSSPVTVGVPSLTAFFGYVHAFERKLNSIYTAFRIESFAICIH--QLHVEKRGLTAEFVAKGNGTISAPATHDDWQCDAVFSLIL--NTNFAQRIDQKTLITALPK-RLARGSAKIAIDDFKYLNSFTTIETAIQGRWISLHTQPNNNLGDLLAAIKEDSQLMASCVGYHLLEEPKDKPNSLRG-YKHAFAESIVGLIKSITFGSTTDANTILWSLNSHKNYLVVQ..... 626
161 3.000e-41UniRef50_UPI0009DBFB49 hypothetical protein n=1 Tax=Thermithiobacillus tepidarius TaxID=929 RepID=UPI0009DBFB49  ali  17  3.SKYLVLPHLNVQHANALQAWWLVAPPSPMALHGFSRALGLRVGVNFGGMAIIHHGVQWLGTFTPQQVQGATYINQDDHIAGSFSKGLQPTARCHVALSLVLRVDATVAID--LDAVEDFLWSGRIAGGAITDYGIPRVVESAD-----KARARIHGGFFVADRADLIQLAEPKAPHWLSANVVGYCALESPKPRLGVR-GNLSHAYAEAIVGLIQYQSVRQQESMP--FWRYRVDDGVFLLSSL... 287
162 4.000e-41UniRef50_A0A2T3KU58 Uncharacterized protein n=3 Tax=Photobacterium leiognathi TaxID=553611 RepID=A0A2T3KU58_PHOLD  ali  16  431..QYIYLSDLRTFQCLATSSPYLCGVPSMTAIWGFVHQYQRSFDITFSSFAI-CFKKEL--IYKSSILSEASNLAAKKTVSSVKRTSFNDEYHADLEFDLIIKVKANIDLNVCVDLLKAVLPTQ-FAGGSLFPAEDWIYISENKKAIFYRVKGLLMPQYQQQPNNLPSLISLIIGDDSLIPISAGYHLLETPSYREGALCKK--HAYAENVLMLAKKVKPIDLRFYKNAFWSLGVTSSTILIEKNRD. 694
163 4.000e-41UniRef50_UPI000B58A439 hypothetical protein n=2 Tax=Aeromonas TaxID=642 RepID=UPI000B58A439  ali  13  438..YYLHLSGLTVYDASALANPYLCGIPSLSALAGFCHDYERRLQVYFRGLAWYLGRYSLVTGKHLPEPSKSADP---KSVSAIRRPGLLDGRYCDLGMDLIIEVHGGSLPFTTCLDLLRVALPARFAGGCLHPPSNWCTVYQDKSTLFTVLSRLPRYGCWIYPSDADLRSFEELSDRRLRPVATGFVFLEEPVERAGSIEGQ--HVYAESAIGTALCINPVEMRFFGAGFWQLNDAKGAILMNGSAN. 702
164 5.000e-40UniRef50_UPI00041351E4 hypothetical protein n=1 Tax=Azovibrio restrictus TaxID=146938 RepID=UPI00041351E4  ali  15  1MS-YLLLPRLRIRAANALVGNLAISPAQVLACVLFGHNLGLKTGCKPLRVAILHHDAQLLGEFHPQQRRGATFIDGVDYSSKNPHASLQPTASCHLTLSLLIQVQGGINEK----RVERFLRSARIAGGNIDGHAKI-----ETGNELDEL--HLPKGFWLIERSDLLQGEGSPPESWLAASVLGYAMTTPFETRAGVRQDTPPHAFCEPLLGLVQYVSTRDYGQRPIPWWEHGWLQDD......... 269
165 9.000e-40UniRef50_A0A1J5RFE9 CRISPR-associated protein (Cas_Csy2) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5RFE9_9ZZZZ  ali  20  6..KYIVVPRIQVEHANALQTWWIIAPPSPMAIQGLVRAMGLRLGHHFEAFAVVHHSVQWLASEGDPQPQGASYIDRDDHIAGGISKGLQPTARCHVTLSLILK-AAPDCALADFE-VARFLRTARLAGGSIIAHGAVRF-----ADTPAEALSRLRQGFFLVDRADLVATRDAAPESWLSANVVGYTALEAPRQRAGVRLG-VPHAYAEALVGLVQYQPTRDAGVLP--LWRYAVDDQH......... 283
166 2.000e-39UniRef50_UPI000C853B03 CRISPR-associated protein Csy2 n=1 Tax=Shewanella sp. 10N.286.48.A6 TaxID=1880833 RepID=UPI000C853B03  ali  15  390..KFLLLPCLRIRAASALNTPYSLGLPSLMAFFGFIHALERKLLEINSEYSVDSFAICIHSISLN--KRGLTKESILKSNKQISPPATQDEWQCDIEVSVLIQCQS---ALNISSTALFKIMPKTLARGSIKIPIDKIQTLQSYSSATSAIKAIQTGGKWLSLHNINDIIEELKKDRRLFLNTIGYHLLEVPKEKQLAL-KGYNHAFAENILALIRVVSVSEKSNLDDIFWLYKYEQ........... 625
167 2.000e-39UniRef50_UPI000A03B3E1 hypothetical protein n=1 Tax=Hydrogenovibrio halophilus TaxID=373391 RepID=UPI000A03B3E1  ali  17  1MS-YLYIPNIRAQRVNMQTSYLTINSAFVMPAVLLGQALAHHCDLNVESVSYIHHDIQPLGEFMPHQRKGAAFINKGDYAANAKGPSMQPTASGHLRASLIIDI---GDSLADFDEIEYFFRQGRFAGGEIISHGEIQ-----SAETLKEIRFR--SGFCLIDKSDMLPFDENKDNGWLTPFVAGYALISEPNHKPGARDAC-LHAFCEPMISLAQYKSVNSIKEKGLSFWALENHQSHFSLTN.... 256
168 5.000e-39UniRef50_UPI0007AF1D47 hypothetical protein n=1 Tax=Marinomonas TaxID=28253 RepID=UPI0007AF1D47  ali  15  394..KYIVLPDLNISHVNGYASDYVVGFPSLIGCFGFVHHFLRKLGTGQDIVSKTSFAICLHEYGLH--RRGVIKELTMNSMDSLAVPGINDSAHCDFKMTMIIRV---PKELTIAQEMIPLSIPQKLCGGAVHS-NISTLNMNRVYDDISEAITQLPSGRWLTSDNLKDEETEDTLENWLVITNVGYHFLEKP-YIKLASLQEYKHAFVEPVLGAVKL-CIFNPEKVEDYFWQYTVRNNSILI...... 637
169 7.000e-39UniRef50_UPI000914B925 hypothetical protein n=1 Tax=Moritella viscosa TaxID=80854 RepID=UPI000914B925  ali  15  388.NRYLLIPNIHVSNANAESSAYTVGIPSLMGFYGFIHAFERNLSKHALETNVNSFAICMHTYHL--QKRGQTKEFVQYANGDIKSPGIVDGWQCDFTFSLVLKLE--PMIDIDINAIISSLPK-RLCRGSDIDAITFQSSFSNTAQAIPSVQGQWLTPDVNIDLDSAVTLLEYNKKKNNVLLCSGYHLLETPQNRENALDNNQ-HAFCEPIISTAQLVSVNNFRR....................... 613
170 1.000e-38UniRef50_A0A2H0DEN8 Type I-F CRISPR-associated protein Csy2 (Fragment) n=1 Tax=Gammaproteobacteria bacterium CG22_combo_CG10-13_8_21_14_all_40_8 TaxI  ali  22  6.KKLLIIPHIKVHNANALSSPFTIGFPAMTAWLGAVHALQRKINVAFLAAGVVSHNMDLQTYKGNNDFVHSIVGTGNPLDKTGARSSFIEEARCHLDVSLVIEFDTIDKRDQLLAPIHHLLHNMKIAGGDIEGFKPPFCINSKE........................................................................................................ 156
171 2.000e-38UniRef50_A0A0J8GVD7 Uncharacterized protein n=1 Tax=Catenovulum maritimum TaxID=1513271 RepID=A0A0J8GVD7_9ALTE  ali  13  387.QNFLLLPNLQINDANALNSGYAVGFPSLTGISGFIHKLQLNIN-NLHNLKVQLSDFAICIHKYCLANRSYTKELELTSNNKLVSPGLVDSVECDLSISVVIKM--NNSENLPSDILINSLPTH-FCGGSVHSLLQQINNFEKIVEAIPDKNGQWLSPYQIEKTTIEDLLNAANFSRNLILINSGYLFLEVPTNKLGVIDN-LKHAFAENVLSIANLTSFNYGTNYSRLFWSLHVSEYEILLHKLEN. 634
172 2.000e-38UniRef50_A0A1B9BXP3 Uncharacterized protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1B9BXP3_9PROT  ali  16  1MKTYLTI-DLKVHKASMLQSLSVISPAPVFAAVMAMHALDKKLGLSVQGVGIIHKDAKPWIEQMPTMKGYVQKRGAYPFSSKANPTSMQPMALADLEWALLLECDHPPRDRA---QVENMLSSMRFAGGEITSAHVHI------HEKMDDAIRSLRSGFWVDDVTNTLMQDDFVQEPWTIPVNLGYVLFAAPEARRGARDGCD-HAFAEHLMGLVRYISIQRAHITRGNLWRYGWDRDHFLVTN.... 259
173 2.000e-38UniRef50_A0A0T5PNE8 Uncharacterized protein n=1 Tax=Alishewanella sp. WH16-1 TaxID=1651088 RepID=A0A0T5PNE8_9ALTE  ali  12  224..RYLLLPALSVSNANAINSAYSVGLPSIIGIWGFLHAFERNVQQKLDGFAICLHQFSLHN----------RGLTREEDLKNGKTPAILPTRQCDLELSIVIKCRV---VKPLSEQQILACLPNTLCQGAIYPAIKNIEHFKMFENLFEAAQAVPRNGCWLTEMNSEVDLNGWLEQKSLLIGNVGYHFLEQPINKANSI-NELSHCFAEPVLAQLLEQRLHATSNEADFLWVLRQLDNAVILDSWSNN 466
174 3.000e-38UniRef50_E5Y239 CRISPR type I-f/ypest-associated protein csy2 n=3 Tax=Bilophila TaxID=35832 RepID=E5Y239_BILWA  ali  18  1MS-YLVFPRVRVQAANMLSASFLMGGPPVFAAYGLGEALCFHLGAKVTGMALIHHNREALGQSFYGVFSPTFGKSANGSDYSSKNPSLQPVACAHLRVSIIWELE----QVAGVKEAREFLHRARLSGGLVTGHGEIVL-----EDSLEAAFDRVGNGYVVTDRRDMLEDSAGEDNTWLSAACLGYAAITPFEHRGGARCGYT-HAFAEPLVGMVQYRSLRQWRDAEEALWRPVWLDDRRGAFVLRQE 270
175 3.000e-38UniRef50_D0SV82 CRISPR-associated protein, Csy2 family n=3 Tax=Acinetobacter TaxID=469 RepID=D0SV82_ACILW  ali  16  1MSCFVTIPYIKVQAANFQSNGLMMGGAPLMAAAMFSHHLARQIETEDLGFYYIHHDMQALGGFTPSQRRGATFIGKTDYSSKNKYASLQPTASCHLLFSLVIEF---DARRPDLDTLIQTLKRSKFAGGHILEFGQIQ-----DAKNVDDALAHISSGFLIRDRHDLLSAYQREYQAWISATTLGYALLEQPTERAGIRHADTAHAYAEPLTGLIQYHSLNQIDYLEQIKWSHQWIQDDVFL...... 291
176 4.000e-38UniRef50_A0A258L4X9 Uncharacterized protein n=1 Tax=Hyphomicrobium sp. 32-62-53 TaxID=1970390 RepID=A0A258L4X9_9RHIZ  ali  15  30.....LAKDLEASRVNLLMNDFAAGLPSPLAFLGLGEAVGRSLGAENWSVAVVLHRVDASEGRTRPEYST-------RRDKAKFQP---DEIAEDLNGMVKASLLLDIPDVTDDQRVREALIGRRIAGGPIHNQDISVVRPTADGSCFNDISR----GYAMLPAAELYPAEREPGTGWIVPVAVGHRLLEDPAKRSNTRNPSIPHVFSEPVVGMAELVSVRRLRDLQDLFWRWRAEGDWIVGHQNY.. 288
177 5.000e-38UniRef50_D6SNR6 CRISPR-associated protein Csy2 n=1 Tax=Desulfonatronospira thiodismutans ASO3-1 TaxID=555779 RepID=D6SNR6_9DELT  ali  16  1MSIYLIFNNLMVRRANMMQSPYLYAPVPVFPSVCTGHKLGCMLDCEVDGVGVVHHRAEPLIEQMAQMNQGSNRVGKQVNTKDPIGLPMQPTMTAHLEISLIFRVNGRVPT---VEAAREAMQGLRIAGGSLNYISSRRVKL---KDDLIGALAEVSNGFWISDAMHLVQQRLDEDKGWYVPANLGYCAVTDFKQRQGGRTDEPEIALADNMIGLVRYDPLYGVKQELNSMWHFDFTDDTFFV...... 275
178 2.000e-37UniRef50_A0A0F4QXW7 Uncharacterized protein n=1 Tax=Marinomonas sp. S3726 TaxID=579484 RepID=A0A0F4QXW7_9GAMM  ali  14  394..NYIVLPDLKISHANGYASDYVVGFPSLIGCFGFVHHFLRKLGTGQDIVSNTSFAICLHEYGLH--RRGVIKELTINSMGGLAAPGVNDSAHSDFKMTMIIRM---PKELTIAQEMIPLSIPQKLCGGAVHS-SISTLSLNRVYGDIKEALTQLPSGHWLTPDNLKDEATEDTLENWLVITNVGYHFLEKP-YIKLASLQEYKHAFVEPVLGAVKL-CIFNPEKVEDYFWQYTVRDNSIFVDN.... 639
179 2.000e-37UniRef50_UPI000B3CBE2B hypothetical protein n=1 Tax=Neiella marina TaxID=508461 RepID=UPI000B3CBE2B  ali  15  416..QYIYLTEMRAEDCNAQSSPSVVGLPSLTAFWGFMHQFERGMRASLEELSFISFALVVRSERLFNAANLAEPQSKKRVVSAVKRPTTRCNWRSDLEFDLVIKVHTNIDLAARYQSLHANLP-LTLAGGSVFPPESWLRSFSCRSELFFLLKGIDCSARWVYATSFYELLNELERDESFIATASGYQHMHMPCERRGS--VSSMHSYADNLLGIAKALNPIEVHFFSSAFWRMRSSHESILIEK.... 675
180 5.000e-37UniRef50_A0A1C2FYR4 Uncharacterized protein n=1 Tax=Acidiferrobacter thiooxydans TaxID=163359 RepID=A0A1C2FYR4_9GAMM  ali  17  1MS-YLVI-DLTAHKTNMLHTLGIVSPAPVLPTILAMHALDKKLGLDVRGVGLIHRHSAPWIEHLDDKGYLKPALVQRRGTYNLYGIPMQPMALADIEWTLVLHCENDVSD---VSAVIGMLHTMRLAGGRIQGIKARTF------DQWDKAVSALRTGRWIDDVTPMLQSGPNPIQGWVVPANLGYALLEDPIARQGARDGR-PHAFVEDMVGLVRYTSLFRTKGLKPALWRYGWDGDQFLVTN-RQD 260
181 2.000e-36UniRef50_UPI000695F04A hypothetical protein n=1 Tax=Vibrio parahaemolyticus TaxID=670 RepID=UPI000695F04A  ali  15  223.SQYLLIPELRISGGSAMSSSASVGLFSMMSLYGFIHAFERNMRHVLTNFTINSFAICIHDYHLEKRGLTKEPIKKAKVSRDEKPPAIYDDYQFDSCISLIIKTS--ESKTIPAEKIVALLPK-RFARGSIRLFIDGIKNIAPFPEPLPAIQAINNPGSWLSFEPDLSLTSTDSNRSNLLLTVMGYQYLEPPTTKPGSLRD-YPHALVENILGFVKPRTVTQSTNLDDLFWRYQVTH........... 465
182 9.000e-36UniRef50_UPI00067B1163 hypothetical protein n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=UPI00067B1163  ali  19  10......VKDIRASRVNLIMNDFAAGLPSPLAFLGLADLLVRQLNLTPWSAGVVLHRVHVSEGRTKPEME----------NKSGEFTPIIEDMTGTVDLSLLLHLPGFDSAEELSEQFQY----RRIAGGLIQNEDLKVETVTPDGSAFRSLRR----GYAMLIAGTLFPPERAPGSGWIVPAAVGYRLLEDPEQRRRTRSKFVPHVFAEPVLGIAELVSVRNSRELSSLLWRWHAQGDLVLGHSAY.. 265
183 9.000e-36UniRef50_A0A2N2US92 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium HGW-Betaproteobacteria-13 TaxID=2013704 RepID=A0A2N2US92_9PROT  ali  16  1MS-YLLVPRVRIRAANALASNLAISPAQVMPCVLFSHNLGLKTGCRPERVAILHHDAQLLGEFHPQQRRGATFIDGVDYSSANRHASMQPTASCHLTLSLLFEVDGRIN----TEKIKRFLRTARIAGGNIDGHGEI-----SAADDIDAL--HLPKGFWLVERSDLLQTDARPPESWLAASVLGYAMTTPFETRVGVRQETPLHAFCEPLLGLVQYVSTGDYGQHPLPYWEHCWLQDD......... 267
184 3.000e-35UniRef50_A0A1I7YQT6 Uncharacterized protein n=1 Tax=Steinernema glaseri TaxID=37863 RepID=A0A1I7YQT6_9BILA  ali  17  183IEALLLIPRLRIQNANAISSPLTHGFPAMSAFLGLMWALNRKLEIVLEKVGVVCHSHQEQV---NTGFVSTFNLTRNPVDKKGGTVAIVEEGRMHMELSLIFQARGQADSQDWAKQVDECLATMRVAGGSVLGHQLWPSDEREQKEVFRMLRRRCLPGFALL...................................................................................... 369
185 5.000e-35UniRef50_A0A2S5LBR8 Uncharacterized protein n=1 Tax=Methylotenera sp. TaxID=2051956 RepID=A0A2S5LBR8_9PROT  ali  16  3.SQYLILKRMKVSHANANPAWWIVGPPAMSAYAGLVGSIEYNASVSSIAFAVVHHDIDLKGEFSPNQFRGANLIDNTDYSSGSSGPAMQPTASCHLTASLIIKFEEDVGISKKAVEQLIQASKLRLAGGRINSVSVHI------AKSLEEALSHFKTGFTVTDRKDLVEDYLASPKPWLSASTLGFARISETQQRLGSRDDH-PHAFVEPVVGLIQYK-PVREEGLSFWKWSHPHPNVSVL....... 279
186 2.000e-33UniRef50_UPI0008372116 hypothetical protein n=1 Tax=Endozoicomonas ascidiicola TaxID=1698521 RepID=UPI0008372116  ali  16  423..QFLHFKRLLAYDVNARSNPYVIGLPALTAWAGLVHAFLCNLGYESRQTDFR-FAIVLRKYSLNKGHPLPVQEIKN---GRISNAPIIDRKSCDLEFDLIVQLPESAKEIDLSEDNLFGCMPSRFAGGTLTNPIEGTCDFYRCCEIYLSSSLIQLPSYAVCESPGKHELVGLLSEGKVLPIGSGFRFLGAPTVREGI--EGYLHAFAYSDMSVIRLSSVHILNPLDRGFWSMNYSDSGIAI...... 669
187 1.000e-32UniRef50_UPI000408B39A hypothetical protein n=1 Tax=Leisingera caerulea TaxID=506591 RepID=UPI000408B39A  ali  17  3....ILISNMSASRVNLIQNDYAAGLPSPTAFLGLA-------GVIFNDLGFD----RWQARVLPVLHEVSPSLGRTRPEYAKKGRRFAPETAEDLHGHVVFSLVLDLPEIRNTDDIRVAAEGRRLAGGSIFPACRSKPVSVSLMAPDGAGLRKCPRGRAVIPCLLKRATDEDPAPGYRVPLAIGYRMITRPGAPKNARDAHTPHVFAEPGVGVGELVSVHYEAEFSNLFWRWSAAGNHITAHPSYN. 268
188 3.000e-32UniRef50_A0A1C2HE73 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=A0A1C2HE73_9RHOB  ali  17  1MNEYFLIKDLRAVRVNLMMNDFAAGLPSPLSFLGLADLLARKLGLAAWSARVILHRVDVSQGRSKPEME----------NKSGVFEPIMEDLTGSVHVSLLLHLPGCDSE----SALRAQMQGRRIAGGLIQNEQISVQAVTPDGSAFRSLRRMLRPAEAAHLASLLYPPERPEGFGWIVPAAVGYRLLEDPQARIRTRSKDIPHVFAEPVVGIAELVSVRNRRELGNILWSWEARGDLVLGHSDY.. 269
189 8.000e-32UniRef50_A0A1H6NK42 CRISPR-associated protein Csy2 n=1 Tax=Rheinheimera pacifica TaxID=173990 RepID=A0A1H6NK42_9GAMM  ali  13  385..QYLVLPGIKISGATAFSSAYTVGIPSLMGIWGFLHAFERNIQRRTSSFQIESFALCLH--QFVLDDRGLTREVKLD-SKRLVTPATLPTRYCDFVISFVLKVRKAQLQLEPIQLISYL--PNSLCQGAVHAQIDRLESFLWMDSFYRAVQAIPEKGRWLTPDLNFSPSDVETLTPELLLTTVGYQLLETPTEKTGAVDDM-PHAFAEPVLGNV-YQRHAGADALDHFFWKLAVLPNAFLL...... 622
190 7.000e-30UniRef50_A0A1G7MB51 CRISPR-associated protein (Cas_Csy2) n=1 Tax=Limimonas halophila TaxID=1082479 RepID=A0A1G7MB51_9PROT  ali  16  1MSIFAIGP-FTAADAALDSSPVVAGLPSITALAGVADVIARAGGQANLPVALLLHRVTPHSGMFRPTPQPSGEPAEAPGRLFGQVRATI--------------CLADPADTLFSDTVRRAVQRARFAGARMEGDDAPVPPV-RACDDLGEALRSVPPGHLLADRTDILELHRDEDGRWLTPLSVGFQALEPIENREGTREPETPHVFAEGVATVAEFVSARALARAPSILWSWHIDRPTGL....... 266
191 1.000e-29UniRef50_A0A165S9U3 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Wohlfahrtiimonas chitiniclastica TaxID=400946 RepID=A0A165S9U3_9GAMM  ali  21  4.RYFLKIPHLSIHNANALSSPLTIGFPAITSWLGAMHALERHLSVRLTQLAVSCHDFHLRTHKGRGDFVHSVINSRNPMQLKKKRSPFIEEPLCDLRVTLLMEVTGSDVRAALVKACDQYVMRMKFASGDVMSVKE................................................................................................................ 161
192 4.000e-29UniRef50_A0A210VXF0 Uncharacterized protein n=1 Tax=Delftia sp. K82 TaxID=1472718 RepID=A0A210VXF0_9BURK  ali  18  2...FVLISRFKVAHYNAQQCKDIIMPVPIHAAVMLGHALGARLGKPVQGVALVLHEANVEQESLPGAGATTFYVDRPHGGGYASTSSYQMHATANGCFSMALDL---GEAQVAPDDVKALLMEMRFAGGCLQGPPQVQAF-----DTQRQLLQGVRPGYLVMDAAWRAAIALESNHPYIVPAVVGYHMLTELSQRQGIRRMGDMHAFAESITGLIEFRHINRFKHMPE.................... 249
193 5.000e-29UniRef50_A0A0N0XLC9 CRISPR-associated protein n=2 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0N0XLC9_9NEIS  ali  11  1MS-YVLIPRLRINHANAFVGRYAISPAQVMAITLFAHNLARHFDYSAVGVAIIHHDAQMLGEFHPQQRRGAALIDNNDYAQGSKSASLQPVATCHLTVSLVVHLPGAFSEL----KLARFLQRARIAGGLVIGHGE--LQIEAEWQSLK-----LPQGYWIIDRSDLL----EGNPLDALIAALGRQAREPVAERTGVRDEIPLHAWGEAMLGLVQYVSQRHWASLPDVFWYPTWLRDD......... 290
194 5.000e-29UniRef50_UPI00082A4BB6 hypothetical protein n=2 Tax=Endozoicomonas ascidiicola TaxID=1698521 RepID=UPI00082A4BB6  ali  17  445...FIVIPRLTVIDAHADSSAYTTGLPGITALVGYVDKLCRNIQIQNIEVAWLLRDFQRIEGMKKHE------PARWDSKKKTTLSDVVSRKFCNLSFDLILKCSADYEQLNCLKEELPDCLPAKFASGMVSTAEEIFLIFQSEQDLLNELQSEDSLRWAVLDYSDAFLEYKEQNPRWLTVSNVGFKLLEEPVTRPNSR--LTHHAYAEPVIGVQELWLIKNLSPELPIFWAYRSAGKRILCQ..... 712
195 7.000e-29UniRef50_A0A1H5WJK3 CRISPR-associated protein (Cas_Csy2) n=2 Tax=Oceanospirillales TaxID=135619 RepID=A0A1H5WJK3_9GAMM  ali  18  415...YASLHNVSVTDGNALNNPYCAGMPSMTGLWGFCKNLEMQLKVSVQRVALMCHEFSANRSTLIPEPSRPSPQ---KGSQTVKRSGLLPQFTFSGQFSVVIEYSAGRLSELTTDDLRNHLPD-RLWGGSLMSANNHGIHLTDEFDLYRKLIRQFRRGVWLVPDSSEVIEQNSLFDLLLAPLLTGFKALEEPKIREGAL--CGLHFYAEPAIGICRRETMFRLTFLNKAFW................. 657
196 8.000e-29UniRef50_A0A1M5CYC5 CRISPR-associated protein (Cas_Csy2) n=2 Tax=Marinomonas TaxID=28253 RepID=A0A1M5CYC5_9GAMM  ali  14  416...YLVLKNLRLTEANGLNNPFVAGMPSMIGLYGFLHRFERQLIDCYPEVIVESFALQCNQYQVINKNKLPAYSIPEKDMG-IRRSGIVPECSFDGKFSIVVKLHKHSGFTDKLDELLKQVLPERLWGGSLHPPETEWAQLFYGSNNLKQFIAILFDGNWLTPVRDSSNLQLLKQKAKLSLCLVGYRLLEPIKSRE---VDSGIHAFCEPLIGLCTRERSIDVNIEKQIFWQF............... 657
197 1.000e-28UniRef50_A0A0A8THC5 CRISPR-associated protein, Csy2 family n=1 Tax=Acinetobacter bereziniae TaxID=106648 RepID=A0A0A8THC5_ACIBZ  ali  17  1MSRYVVIPRIRVQNANMHTNGFLLGGVPLFAANMFANHLARQLGTQEEGIIYIHHDQQRLGGQTPAQRRGAVFIGKKDYSSKNKYASLQPTASCHLEFSLVIKFTSS---RISPEKLTNILNRSRFAGGQIIEFLEITTHAENELEALKKIK................................................................................................ 156
198 1.000e-27UniRef50_T0ZZX8 CRISPR-associated protein Csy2 (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T0ZZX8_9ZZZZ  ali  22  1...........................................................................................ALADIEWTLLLQCERNISA---HEQVRETLLRMRLAGGPIRSVHVSTHSTWDD-----AMAHTLRNGFWIEDATDLLTDAVDPSNGWIVPANLGYALLEPPRERRGARDGR-HHAFAEPMIGLIRYVPANAARSPERALWRYGWDADQFLITNRR.. 162
199 2.000e-27UniRef50_A0A2W5AY78 Uncharacterized protein n=1 Tax=Mesorhizobium amorphae TaxID=71433 RepID=A0A2W5AY78_9RHIZ  ali  17  3.....LIGPFAASRVNVLQNDFAAGLPAPTAFVGLAASVAPAVGAPRWGVGVLIHEISV-----------SPGQTRGQMSKDGKVLDIPADMTGTVRFSLIVDLPVGKAGQ-----IMTAVSTARLAGGLIFPCDDAKMVEIQDGASLRRIARLILPLAAVFPSPVTDDAGDKVPTGWRVPLAVGFGLLEDPARRGATRSDAVPHVFAEPIAGVGELASHKSVEDLRALCWKYHTRGDVVAAHRAY.. 260
200 8.000e-27UniRef50_D5BZR4 Uncharacterized protein n=4 Tax=Nitrosococcus TaxID=1227 RepID=D5BZR4_NITHN  ali  18  1MSYYLLLPTLNVTGCNWESSHLTRSLP-LTAIAGFADYLAADAGAGLEGFVVCLHDGQIHEGLSKNPLALCKGNGLSQTQDDLLNPPLIPEVKGSMSLSLVVALEL-ENKSALDEWLKAFLQTRRLAGGDIIGIGQPKIYIKR--SDLAREMGRLPPGWFISNGADLIAHEPDHPGHWLYATCVGYQLLESPQPRRNDADSSTNHAYAEPVHSLAKLRGVLRLQNKNKLLWRWDTNAPSRTVY..... 303
201 9.000e-27UniRef50_A0A090P759 Uncharacterized protein n=1 Tax=Vibrio ponticus TaxID=265668 RepID=A0A090P759_9VIBR  ali  13  97..QYIYLSSLRVQDALAMSCPYLCGAPSLTTIWGFVHHYQREFNRDFLGFAFYVRS---QTITATAKLTEPNSLAKSRTVSNAKRPTIRGDRLADLEIDLVIRVQSNGRISDYSSELKNALPLS-LAGGSVFQPIDWLRTFNSRSSLFCTLKGQLMDGYIPESSSQKLLMNWN........................................................................... 278
202 2.000e-26UniRef50_A0A2G6L4C0 Type I-F CRISPR-associated protein Csy2 (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2G6L4C0_9GAMM  ali  19  2MSHYLVFQKVVIAGANTISSPIT--------------------------VLLACHDLQVQAYRTSKYSDYTFNQTRNPIKKDGKTASIIEEGKCRVMMSFVVEVLGDDEKQQLPQNAEMWIQQSRIAGGSVQHLGAQVRFV--ETESIDDVAMLLTPAFVLMDAQEEFAQHHEPQHGWLVPMPVGYQGIADL........................................................ 216
203 5.000e-25UniRef50_UPI00071D6CF1 hypothetical protein n=1 Tax=Vitreoscilla massiliensis TaxID=1689272 RepID=UPI00071D6CF1  ali  15  169...........AQNINMSACYVSMGLPALTGIGGAVHVLERETGLAL-SFGFGIKNIENLTHASRGANSHRTAL------KHQKAMPMVNEVTSNAEIAIIIACDDADKAQAIIAACDKL---QRLCGGSLFEQQARFVSNND-----------LPPYFWYFESDDWRGYITAINQRSAKLVQSGYALLEQPRPKKLAR--NYPHAWAEPVFSLIKLGSPPDFFRLEHLMW................. 377
204 7.000e-25UniRef50_A0A2G6EPZ8 Type I-F CRISPR-associated protein Csy2 (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2G6EPZ8_9GAMM  ali  16  1.........................................................................................EEGKVHLTVTLAVEVCGDDELSKKIALVEKMIISRRIAGGSVRGLHQKTPVSYFSPESVDGIIPLLFPAFVXLDALIDVAALHHVPRGWLVPLPLGFQGIAPPGELQNCRTNEYPSQYVEAVYSLGKWVFPHRIPDITRAFWRYDVEDDFYLVTQ.... 205
205 9.000e-25UniRef50_UPI00094B34E6 hypothetical protein n=3 Tax=Pasteurella multocida TaxID=747 RepID=UPI00094B34E6  ali  17  161ISEYITI-RCKVEKMNVSSGMAAVLFPSITAIGGAVHTIERAVNKKLD-FAL---------GFKNLDFTTSGSLGNALKGKKVIPQLILDEITATADVILLLKLERGASEEEKKEVLQYLQPLHRIAGGTTWEYSATLETYNDNVDCSKEVEKELQSGIDVLDTNEKTGLFEITEKTSVIINHTGYAFLEKPHIRTNAR-NNYPHAWVEPVFSVVEQETFSR-----RAFW................. 392
206 2.000e-24UniRef50_A0A2J9HH56 Uncharacterized protein n=2 Tax=Hafnia TaxID=568 RepID=A0A2J9HH56_HAFAL  ali  18  172..........RCEGMNISSGMVAAGFPAITAIGGFVHSLERKIGQDIEAFGFKSAD-WVSGVPKLTLYKASNRSSTGRVKGACKVTPSTEEIVANCEIVLLLKTKADSAELKDI-----LMNTHRISGGRLFNVEVSVISNGIPPKASYMLRKRKNDGLDSLQAALEMYAMDWVDGEWYTLNQTGYAFLERPIERTGSR-GNYPHAWAEPTFTLITQGSMSENKNINDMFWK................ 412
207 1.000e-23UniRef50_A0A149QZG3 Uncharacterized protein n=1 Tax=Gluconobacter oxydans TaxID=442 RepID=A0A149QZG3_GLUOY  ali  13  1MKVYIVFPRFTVVNANCVQSVLVAGFPSQSQFAGHSHAMSRHLGVLEDGIQIIVHDFLL--------NKGSPKSPADIMNGKPQAGRLIESIRGRIEYTLVQRVDVPDSEKLLERRIKE--HGLQVAGGSTMSIGDHPSVFSSLESLEKGVMTKLPWGWIIRERMDLLRDASNKMEAVILIIPMGHNLLQEPLSRKGTRTKTSPHAFASPLIGLGEFIRFRGKLEDVGVWWRYRIMDD.......... 292
208 4.000e-23UniRef50_A0A1J8Q350 Type I-F CRISPR-associated protein Csy2 (Fragment) n=1 Tax=Bathymodiolus thermophilus thioautotrophic gill symbiont TaxID=2360 Re  ali  14  1...................SPYTIGFPAMSGWLGFMHNLQRRLNIKFNGVAVSVHEINLHTNKSENDFNYSIISKRNPMGKDGKPTAFIEEARCDLEVSIAIE................................................................................................................................................. 89
209 5.000e-23UniRef50_A0A014MB47 Uncharacterized protein n=1 Tax=Erwinia mallotivora TaxID=69222 RepID=A0A014MB47_9GAMM  ali  17  174............EGMNISSGMVAVGFPAIAGIGGFIHSLERKIGQDIEAFGIKSAD-WVSGVPKINVHRTSNGSSPGRVKGGKVTPASTEEIVANCEIVLLLKTKADPLELRDI-----LVNTHRLAGGRLFNINVSVIYLIDASSDIERKRKK--EGVDSLQAALEMYAMDWIDGEWHQPNQTGYAFLERPVQRMATR-GNYPHAWAESIFSLITQGSMSKNSNEAGIFWK................ 411
210 2.000e-22UniRef50_A0A202B2K2 Uncharacterized protein n=1 Tax=Chromobacterium violaceum TaxID=536 RepID=A0A202B2K2_CHRVL  ali  13  167..........RVRNMNISGGMLSVGWPALSAIGGTVHALERKIGDRIQ-FAFGMSSCQRMRGAVKAVVNKANAVGRLPGKTIHTLPGYNSQISGHCEIVLLLKTNPDKHRQ-----LKQAAQELRLAGGSIEEMKIQIAHLLDASKDIARLRASDADAFDAMLA-LYLGDGEWTARGWLLPIMSGYGFLHEPAESPNSRSVGYRHAFVEPIFS................................... 381
211 3.000e-22UniRef50_A0A2X1UMM3 CRISPR-associated protein (Cas_Csy2) n=2 Tax=Oligella TaxID=90243 RepID=A0A2X1UMM3_9BURK  ali  18  156........RFKVYRANVSSGFVSCGMPSIAAVGGLVHSIEREFGAPIQ-FAVGYRDIEVSDSATLSSQRLSKGVRKVLVTS---------EVTATIEVTLRLKSEKDGLREHMANNAIN-----RFAGGAVFDYRLVDSVNARFLQSVKINSKK---RDTLVAAITLYKLGLRRNKTPHTVLHSGYAFLEQPKNRECAR-NGYLSAWAEPVFSIVKLV------DFDDSCW-FSRKEKDGLVY..... 364
212 4.000e-22UniRef50_A0A0Q4NFP5 Uncharacterized protein n=1 Tax=Pseudomonas sp. Leaf58 TaxID=1736226 RepID=A0A0Q4NFP5_9PSED  ali  17  4....LVIP-FAAHNVNLRSSLHVVGTPAATAISGFGHA-ALRLIAEITRQSFVDRALVIKSYDMLPGRSKARLAMRDDAGKAGTEAGMFDERLGIITGSFVIRFEASSGALFQLEEVKDALHTLGFSGGVLQVTDKLKINANDDNGLI-AFKQLPGHHRVLVDRTEMLTTYAEAMEGRLVPMSIGYRAIE-LARLRNTGMP-YLHVYAEPVTGLARLQSYIRSEEGISAFWAHSHNDRAYISKG.... 298
213 1.000e-21UniRef50_A0A0C4XXF2 Uncharacterized protein n=1 Tax=Acinetobacter baumannii TaxID=470 RepID=A0A0C4XXF2_ACIBA  ali  14  172.........VQLKNANLSSNMIAVGLPSITAIAGFFMFIEHRTGIKAD-FAIGIKNTIKNTVVEMYGNRSSLRGFRSFIDKR------VDQRNGDIELTFIIRCNSTEEVINLKSWIQS--NDFKIAGGDVHYKVISDVLYDDCQEDIREITEIPLNADALDYALILHRTNYIDSDNKYTVSANGYAFLGSPEFDPYSRAHSGMHVWAEVIFAV---IYLNRNLDLKKCFWS................ 395
214 2.000e-21UniRef50_A0A1I4GVK3 Uncharacterized protein n=1 Tax=Azotobacter beijerinckii TaxID=170623 RepID=A0A1I4GVK3_9GAMM  ali  16  174..........RVERMNVSGGMLSIGWPAITAIGGLVHAIERKTGEDLE-FAFALDDIQWIASGLHTVSRGSNPL-PPRSQSGGVRSGQVDEIQANGHFSLLLRGARDIDAVA-----RELSAVTRLAGGSVFDPGAVFAAQAFLIDASSELRRR-APGMDALDAALAAYGRDWTDGQWFQPNATGYAWLEEPQPRKNVR-GNYPHAWSESAFSLVTQGGLT-----SAAWWRRHAGPHGI........ 416
215 3.000e-21UniRef50_UPI0009FC40F4 hypothetical protein n=1 Tax=Psychrobacter lutiphocae TaxID=540500 RepID=UPI0009FC40F4  ali  18  58..............................................................................................................................................EDNKSLKKLLKQWQD-YINPDNKTDWEYVPKPASGYLVPIMTGYKAISPVDDVDNTRDASTDVCFVEAVHSIGEWQSVHRIEDLKQLLWCYDYQPNWYLCKQNYQ. 169
216 1.000e-20UniRef50_UPI000D7DF968 hypothetical protein n=1 Tax=Psychrobacter sp. YP14 TaxID=2203895 RepID=UPI000D7DF968  ali  15  246.....................................................................................................................................PDAITQHFDTNDKSFKALLKQWQS-YLNPDSKTQWEYQPKPASGYLVPIMTGYKAISPVDEVDNTRDATTDVCFVEAVHTVGEWQSVHRIKELEQALWCYNYQPNWYLCKQNYQ. 367
217 3.000e-20UniRef50_T1C9X8 CRISPR-associated Csy2 family protein n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1C9X8_9ZZZZ  ali  22  6............................................................................................................................................................................RKRPGWLVPLPIGYAALSPAGEVENARDDSTPFRFVESLYSLGQWVSPHRLENLQQLLWHVKSEPE-KGIYQCVN. 82
218 3.000e-20UniRef50_UPI000B15AA6F type I-F CRISPR-associated protein Csy2 n=2 Tax=Limnohabitans TaxID=665874 RepID=UPI000B15AA6F  ali  16  256......................................................................................................................................................................KDWTVSRRKPGWLVPLPVGYAAISPPGEVKNARDNDTPFRFVESVLSLGEWVGPHRIKNLHDLLWRHHAQPEAGL....... 333
219 6.000e-20UniRef50_A0A165S9V3 Type I-F CRISPR-associated protein Csy2 n=9 Tax=Wohlfahrtiimonas TaxID=582472 RepID=A0A165S9V3_9GAMM  ali  18  49......................................................................................................................................................................QWSSARLGDHGWLVPISVGFQALSPVTDPINQRDDVTPHCFAESILTLGRFVMPHRCESLSSLFWSYHVD-EAQGLYLCRN. 129
220 1.000e-19UniRef50_UPI000B41ABAF hypothetical protein n=1 Tax=Comamonas thiooxydans TaxID=363952 RepID=UPI000B41ABAF  ali  15  1MALVIRIP-LVVQGANLLAGYATHG-PTMTALYGLTARLEDSAGFTAQRFGLVLTEYSPRLGEQLTTSLDVILKAKQGLARSATPARI-----GDLALSLYLEVDEDDDCDWLMERIALALNNSRFQGGRLSDDMQVTYHLDEPQQALMELLRKEAPLAKVYSSDDLIEAFAQGIASGAHLVCNGFRVAGEVSCIQGQQRKVG-----EPLFTLATTQPVYDLRRLKNFWWQFKAETTNHL....... 257
221 2.000e-19UniRef50_A0A0P0L4P4 Uncharacterized protein n=1 Tax=Burkholderia plantarii TaxID=41899 RepID=A0A0P0L4P4_9BURK  ali  15  174..........HVESANLASGLICLGFPAMTAIGGLLHGIERNTNQTLD-FAFGMRDIEWKAPSKQAGKRNKYAEVSWMYS--------LDTMQGNGDFVLLIR------GATDIEAVKAAVERVRVAGGSIFEIDVSVIAPGDELDASREIGRRAPDGRDGFYRDSPTDGFRAGYSRWYQPAMTGYTWLETPQQRANARDD-YPHVWSEPVFSLVTQGCLTDM-----AWWR................ 405
222 3.000e-19UniRef50_A0A135ZYH2 Uncharacterized protein n=1 Tax=Paraglaciecola hydrolytica TaxID=1799789 RepID=A0A135ZYH2_9ALTE  ali  11  26..........................................LKVDFQEFAICLHSYSFH-------KRGITKEQYYTINDVQKIPGIVDSRQCDFLLSLLIKVNYLELDKEHI----LACLPQKLCGGAVH-IGLPNLSSVDVYNDFKHAVEALTKGKWLAIDDSNDMMSKIEKRDDLVAGCVGYHFLELPEDKIGSLDNIQ-HVFAEPILAAVRMSSFVFGDTHEKLIWQYQKNSTSLYLTN.... 223
223 8.000e-19UniRef50_U5QEY6 Uncharacterized protein n=39 Tax=Acinetobacter TaxID=469 RepID=U5QEY6_ACIBA  ali  17  172...........IDDANLSSNLIATGLPSVTSIASFFNYVELKTGQKVD------FAIGISGTEKNQNVSVREKVIKYPRTRTNVGVGQVDQSNGKLALHLIISCESPSAANQVRDYILN--EDIRIATGDFVPENTYWLYEADPKTVDDDLRNRYVSGFPVFQPDTLDYAMQLDSRHKYTVTSNGYALLNAPTFSTYSRSETKLHCYAEILYAVC---YLSEEYLPDNLFWK................ 395
224 1.000e-18UniRef50_G9YI72 CRISPR-associated protein, Cys2 family n=1 Tax=Anaeroglobus geminatus F0357 TaxID=861450 RepID=G9YI72_9FIRM  ali  25  25.............................................................................................................................................................................KESGWLVPIAVGFKRISEIGKIKGQRDKSKNHCFVEPVVTIGEFKMAYRFESIDDMMWHYEYKENEKL....... 92
225 2.000e-18UniRef50_A0A272EN45 Uncharacterized protein n=1 Tax=Candidatus Dactylopiibacterium carminicum TaxID=857335 RepID=A0A272EN45_9RHOO  ali  19  32.............................................................................................................................................................GAWQHDRSGL---------GWVVPIPVGYGALGEMGSVANARDTTTPFRFVESLYSVGQWLSPHRLEHAEQLLW-YAASQPDAGRYRCCND 115
226 2.000e-18UniRef50_A0A177NU71 Uncharacterized protein n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A177NU71_9GAMM  ali  12  264..........................................................................................................................................FRTIDDNKANKKLLEQWQSYCEPNENTDAIWEYVNKPPGFLVPIMTGFKAISPVHEVANTRDNETDVCFVEAVHSIGEWQGVHRIKDLKQSLWNYHYEDNWYLCRQ.... 376
227 5.000e-17UniRef50_S4YVR0 Uncharacterized protein n=1 Tax=Psychrobacter sp. G TaxID=571800 RepID=S4YVR0_9GAMM  ali  16  287...................................................................................................................................................................TTAKWEYIPKPARGYLVPIMCGYKAISEVDEVTGTRDSATEVCFVEAVHSIGEWQSVHRWKNLNDVFWQYNYSPDWYLCSN.... 373
228 1.000e-16UniRef50_A0A1H9M3J6 CRISPR-associated protein Csy2 n=1 Tax=Nitrosomonas sp. Nm51 TaxID=133720 RepID=A0A1H9M3J6_9PROT  ali  14  278..........................................................................................................................................FSTIDENKVNKKLLEQWRSYCEPNENTDAVWEYVNKPPGFLVPIMTGYKAISPVHEVASTRDNEADVCFVEAVHSIGEWQGVHRIKDLRQALWDYHYETNWYLCRQ.... 390
229 4.000e-16UniRef50_A0A1R4GYR3 CRISPR-associated protein Csy2 n=1 Tax=Psychrobacter piechaudii TaxID=1945521 RepID=A0A1R4GYR3_9GAMM  ali  16  268................................................................................................................................................NKQHKALISQWQH-YINPDTPAQWEYQPKPNKGYLVPIMCGYKAISDVEEVLGTRDNETEVCFVEAVHSIGEWRSVHRFKSLDNAMWQYHYAPNWYLC...... 372
230 6.000e-16UniRef50_A0A1Y5CZG4 Type I-F CRISPR-associated protein Csy2 n=1 Tax=Colwellia sp. 39_35_sub15_T18 TaxID=1856279 RepID=A0A1Y5CZG4_9GAMM  ali  16  271................................................................................................................................................NENTQSVLKQWADYCKPIEKIDTDWEYIKKPEGYLVPIMTGYKAISKVSEIENTRDHETPVCFVESVHSVGEWLSTHRLEKFEDCFWRYSYKENWYLCTQ.... 383
231 1.000e-15UniRef50_A0A2X1UM46 CRISPR type I-F/YPEST-associated protein Csy2 n=1 Tax=Oligella urethralis TaxID=90245 RepID=A0A2X1UM46_9BURK  ali  12  239..................................................................................................................................................................EQSEWTRYSFKRDRGWLVPIPVGYQAITQADQVANIRNPNYASQFVEVIYGLGKWVFPHRLKDINQYFWRYDNSENLYLITQ.... 325
232 1.000e-15UniRef50_K6ZW18 Uncharacterized protein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=K6ZW18_9ALTE  ali  17  261..............................................................................................................................................EKNKSTKAVLEQWQHYLQPTDKSSADWEYLKPSSGYLVPIMTGYKAISQVIDIENTRDSRTPVCFVEAIHSIGEWQGVNNFRNAEDILWHYEHKEHWYLCKQ.... 369
233 3.000e-15UniRef50_UPI000425113D type I-F CRISPR-associated protein Csy2 n=1 Tax=Ignatzschineria larvae TaxID=112009 RepID=UPI000425113D  ali  13  289......................................................................................................................................IQDQLSKQFNKKLYEQWQNYLMP---TEKTDAQWEYVRKPNPGFLVPIMVGYKAITPAGEVDGARDIETDLCFVESVHSIGEWQSVHRLKELADWVWTYYHDLKWYLCRQ.... 401
234 4.000e-15UniRef50_UPI0005F7F673 type I-F CRISPR-associated protein Csy2 n=1 Tax=Alteromonadaceae bacterium Bs12 TaxID=1304902 RepID=UPI0005F7F673  ali  17  269....................................................................................................................................................KDVQGQWQHYCQPTDKSPADWEYLKASSGYLVPIMTGYKAISEVLQILGARDNETPVCFVEAVHSIGQWLGVNRFKDIASCLWQYDYKKNWYLCRQ.... 376
235 1.000e-14UniRef50_UPI000D6E95A4 hypothetical protein n=1 Tax=Leucothrix pacifica TaxID=1247513 RepID=UPI000D6E95A4  ali  15  71....................................................................................................................................................KALLAQW-NQYLNPDSKTDWGHLPKPSTGYLVPIMTGYKAISPLSEIENTRDYETDVRFVESIHSVGEWRGVNRLKHFAHCQWEYFYDDGWYLCRQFKKD 177
236 2.000e-14UniRef50_C9PQ76 CRISPR-associated protein, Csy2 family n=3 Tax=Pasteurellaceae TaxID=712 RepID=C9PQ76_9PAST  ali  15  233............................................................................................................................................................PNHINAGPSDWQTYSVKKGRGWLVPIPVGYQAISPLVKVQHCRTQQYPSQYVETIYSLGKWVFPLSLKDLSQCFWRYNAPQN.......... 318
237 2.000e-14UniRef50_UPI00082AA0F9 type I-F CRISPR-associated protein Csy2 n=1 Tax=Neptuniibacter pectenicola TaxID=1806669 RepID=UPI00082AA0F9  ali  16  295.............................................................................................................................................................................PKAGYLVPIMTGYKAITPAGEIDGSRDSETDLCFVESVHSVGEWQSVHRLKRQEQWIWRYAYKKDWYLCKQ.... 372
238 3.000e-14UniRef50_A0A1A8T9B9 CRISPR-associated protein Csy2 n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A1A8T9B9_9GAMM  ali  13  253.....................................................................................................................................PNELITYFAEQQECIDKILMQWQNYLEPNEKTSANWEYAKKPQGYLVPIMTGYKAITPAGEIDGARDSETDLCFVEAVHSIGEWQSVHRLKKLEQWVWRYAYEKDWYMCQQ.... 372
239 4.000e-14UniRef50_A0A1Z4VQN7 Uncharacterized protein n=2 Tax=Thiohalobacter thiocyanaticus TaxID=585455 RepID=A0A1Z4VQN7_9GAMM  ali  16  1.................MQTPTIVSPAPVFATYMFSHALERKLGFKLHGVSMILHEARMDTDAIPSGGKNVGSDMGGDYSSRSVSPASQPSVTASCVVSLILKVSGFDSEEA-----EELVRTMRFAGGSIDDIGGIRIYEND-------LPSRLPPGRFFMDARDKVESRL-KTGANIVEAMLGYALLGDLKPREGARLGQIPAAPAEAMVGLVGLENVYEVMNSDNIFWEFNWDNDGDIPY..... 310
240 4.000e-14UniRef50_A0A2M7Q2H4 Uncharacterized protein (Fragment) n=1 Tax=Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80 TaxID=1974111 RepID=A0A2M7  ali  12  1.........................................................................................................................................................................................YKAISPPGEVENTRDTVSHTCFVEAVHSIGEWRSMHRVGDISETIWKYQQQDDWYLC...... 60
241 5.000e-14UniRef50_E8KI88 CRISPR-associated protein, Csy2 family n=1 Tax=Actinobacillus ureae ATCC 25976 TaxID=887324 RepID=E8KI88_9PAST  ali  19  1...............................................................................................MDISLVVEMEVKDPETQFLEHCKKLLMQQRIAGGSVFQIENVELFNLSDTKEIKLA---LMPAFVLMDAKQTLADITQSLQGWLVPIPVGYQAISPLGEMQNCRTNEYPSQYVETVYT................................... 183
242 1.000e-13UniRef50_UPI000669214F type I-F CRISPR-associated protein Csy2 n=2 Tax=Pasteurella multocida TaxID=747 RepID=UPI000669214F  ali  17  253.............................................................................................................................................................................QGRGWLVPIPVGYQAISPPGQLKHCRTMQYPSQYVEAIYSLGKWVFPLDLENLSKCFWHYTPPENNF........ 323
243 2.000e-13UniRef50_A0A2D2LX25 Uncharacterized protein n=1 Tax=Moraxella osloensis TaxID=34062 RepID=A0A2D2LX25_9GAMM  ali  14  185........RLVIENASILSGFVGVGHPNITSLGTYVANIEKSIGQSIR-FSIGLTDVKYNGDFLPKDGLTGKVNKRLYSLKDTE---------FGATITLVLLLQGSDN-----RALYEYLQTQHLCGGEVISREIGVFNNTPAPQALYDASESL-NQIEGQDALAKIMEAQNDAKLFISINHVGYAALEQPVANRSPRRNNLEHCWTEPVYGVGQQVFDNNKT------WWYRSDFKDGLMTWC... 406
244 2.000e-13UniRef50_D7N1Y1 CRISPR-associated protein, Csy2 family n=1 Tax=Neisseria sp. oral taxon 014 str. F0314 TaxID=641149 RepID=D7N1Y1_9NEIS  ali  13  233..................................................................................................................................................................EHPQWHSYHIRQGRGWLVPIPVGYQAIAPAGVMQHVRNPEYPSRYVETVYSLGKWLFPNKLSDLHAYFWRYAPQDNLYLITQ.... 319
245 8.000e-12UniRef50_A0A1C0TZP3 CRISPR-associated protein Csy2 n=1 Tax=Photorhabdus australis TaxID=286156 RepID=A0A1C0TZP3_9GAMM  ali  14  28.....................................................................................................................................................................EYWEYVPKPDSGYLVPLMTGYQAILPLEQVEKTRDLNIPYCFVEAIYGVGEWKSPHRINDI...................... 91
246 4.000e-11UniRef50_A0A0M0I9G0 Uncharacterized protein (Fragment) n=1 Tax=Vibrio xuii TaxID=170661 RepID=A0A0M0I9G0_9VIBR  ali  20  1.....................................................................................................................................................................................VQIGYKKIAPAGEVANVRDSQSPVSFVESVYSVAEGISPSRINNLRDMIWQYRYHDPFYVCH..... 66
247 1.000e-10UniRef50_UPI000B9E4CBE hypothetical protein n=1 Tax=Zooshikella ganghwensis TaxID=202772 RepID=UPI000B9E4CBE  ali  15  12.................................................................................................................................................................QPVPSLISALGNQSIPWLFATSTGYRTLSSPEDREGTRDHDYPHAFVEPILGLYQYVPLRRMAEPLPYLAGHWADEKTFLIHQ.... 97
248 1.000e-10UniRef50_A0A2T3J4Q7 Uncharacterized protein n=1 Tax=Photobacterium lutimaris TaxID=388278 RepID=A0A2T3J4Q7_9GAMM  ali  15  300.................................................................................................................................................................................WLSATSLGYALINEPTQRTNARAG-YNHAFAEPLLGLVQYRSIRQTVDAELPFWQGHWRDNHTFI...... 363
249 3.000e-10UniRef50_A0A2A5T345 Uncharacterized protein n=2 Tax=bacterium symbiont of Melanocetus johnsonii TaxID=1927127 RepID=A0A2A5T345_9BACT  ali  12  1.............................................................................................MHLTVSLIIECNGDELERAQSDFVKRLAERNKLAGGSITDIGS--CYFTDEPHT--KLLRRLLPGFILIDRSHYLEQ.............................................................................. 78
250 2.000e-08UniRef50_A0A257UHX9 Uncharacterized protein (Fragment) n=1 Tax=Deltaproteobacteria bacterium 37-65-8 TaxID=1970507 RepID=A0A257UHX9_9DELT  ali  12  5......ITNIETGQANLLMNDYVAGLPSPLTSLGFAEAIVRQLDLKPWSARVVIHAVQPSEGRTRPEYTGRFAPTEMP-----------EDMKGHVDISLIVELD............................................................................................................................................... 97
251 3.000e-08UniRef50_A0A2A5T370 Uncharacterized protein n=2 Tax=bacterium symbiont of Melanocetus johnsonii TaxID=1927127 RepID=A0A2A5T370_9BACT  ali  27  2....................................................................................................................................................................................PIQIGYKKIAPKGDVANARYNDPPVSFVEAIYSVGEWVSPSRLESMQQALW................. 56
252 5.000e-08UniRef50_A0A0A8TN53 CRISPR-associated protein, Csy2 family n=1 Tax=Acinetobacter bereziniae TaxID=106648 RepID=A0A0A8TN53_ACIBZ  ali  17  25...................................................................................................................................................................ADALRAFFNDQHLSWISATNLGYALLEPLTQRTGIRQETTVHAYAEPLTGIVQYFSLNTWHNLQKLLWTHHWPQDDILQQNC... 125
253 6.000e-08UniRef50_A0A0Q4N982 Uncharacterized protein n=1 Tax=Pseudomonas sp. Leaf58 TaxID=1736226 RepID=A0A0Q4N982_9PSED  ali  20  251...............................................................................................................................................................VLLDQEGWLEEYF----GRLIPVDIGYRLLEEPVQRRHRYTDEYPHAYAEPVTGLARLQIVASCRQAAPIFWTRQSSFPYLTVTG.... 334
254 5.000e-07UniRef50_A0A0N0G7Q0 Uncharacterized protein n=1 Tax=Pseudomonas amygdali pv. lachrymans TaxID=53707 RepID=A0A0N0G7Q0_PSEAV  ali  20  219..............................................................................................................................................................FSLLDAEEWADASEDDVEGWLIAVDIGYRLLENPVERPHSEQPHYLHAYAEPVLGLARLQIVASCRKHNPIFWQCQQNHPYLV....... 314
255 7.000e-06UniRef50_A0A2W4R199 Uncharacterized protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2W4R199_9PROT  ali  13  268..................................................................................................................................................................DSKQNKDDATEAYHGRILPTLIGYRLLEAPRKRTGARRG-YEHAFAEPLIGLLRAQLVGREGRLPPVFFRPRTIRDEILVYSALDD 359
256 1.000e-05UniRef50_A0A090P689 Uncharacterized protein n=1 Tax=Vibrio ponticus TaxID=265668 RepID=A0A090P689_9VIBR  ali  16  1............................................................................................................................................................................................MELPTPRKNALTD--LHAYAENTLCLAEQVNPIDMHFFEQAFWSLECSPTTILIKK.... 60
257 2.000e-05UniRef50_A0A2M6ZSJ9 Type I-F CRISPR-associated protein Csy2 (Fragment) n=1 Tax=Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_38_7 TaxID=197397  ali  31  5IKRLLLLPHIKVHNANALSSPFTIGFPAMTAW........................................................................................................................................................................................................................ 36
258 2.000e-04UniRef50_G7G153 Uncharacterized protein n=1 Tax=Pseudoalteromonas sp. BSi20495 TaxID=386429 RepID=G7G153_9GAMM  ali  34  1MSQYLLLKKVSVQNANAIAG-LTYGFPAITNFW....................................................................................................................................................................................................................... 32
259 4.000e-04UniRef50_A0A1W6MDE6 Uncharacterized protein n=4 Tax=Vibrio TaxID=662 RepID=A0A1W6MDE6_VIBVL  ali  14  318..............................................................................................................................................................FTQLYRNEYLEPVEREYHGYLFALNIGYCGIGELQKRRGTRINE-LHTYAEPVLGVARARTVGSV......................... 381

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.