current user: public |
|
Query: gi|16127999|ref|NP_414546.1|(removed signal:1-23) predicted protein (yaaX b0005 exp) [Escherichia coli str. K-12 substr. MG1655], from E.coli |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . | |||||||
# | Score | Template | Links and tools | %id | First | AEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR | Last |
1 | -7.900 | [O] KOG1872 Ubiquitin-specific protease | ali follow.. | 20 | 407 | .....LQAVLTHKGRSSSSGHYVAWVRSSGDVWFK........................................ | 436 |
2 | -7.470 | [I] COG5056 Acyl-CoA cholesterol acyltransferase | ali follow.. | 15 | 404 | ..LNAFAEI-TKFADRGFYGAWWNTVTWDEREWFLMRHVYH.................................. | 449 |
3 | -7.360 | [I] KOG0380 Sterol O-acyltransferase/Diacylglycerol O-acyltransferase | ali follow.. | 15 | 348 | ..LNLIAEL-LRFADREFYRDFWNAETIGYKSWFAVRHIYS.................................. | 393 |
4 | -7.270 | [S] COG3671 Predicted membrane protein | ali follow.. | 14 | 30 | NGLTFFVGLIVAYVNRDAAGPINASHTFAIRTFW......................................... | 64 |
5 | -6.530 | [O] COG0755 ABC-type transport system involved in cytochrome c biogenesis, permease component | ali follow.. | 13 | 253 | FGLGIILGA---IWAEAAWGRFWG---WDPKETVS........................................ | 281 |
6 | -6.440 | [U] COG5120 Membrane protein involved in Golgi transport | ali follow.. | 8 | 37 | GNLLLVFGFFMIAGFSKSVSFFLRKDRMLGSISF......................................... | 70 |
7 | -6.430 | [R] COG2409 Predicted drug exporters of the RND superfamily | ali follow.. | 19 | 916 | VRSFMTPSIAALLGRW---------------FWWPLRVRSRPARTPTVPSETQPAGRPLAMSSDRLG........ | 967 |
8 | -6.300 | [S] COG4330 Predicted membrane protein | ali follow.. | 21 | 129 | LITHALCAIGIYWG-RFLRFNSWD................................................... | 151 |
9 | -6.260 | [C] COG1294 Cytochrome bd-type quinol oxidase, subunit 2 | ali follow.. | 28 | 18 | MMYVVMDGFDLGIGSGDRDAPVWDGNEW............................................... | 60 |
10 | -6.210 | [R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3 | ali follow.. | 27 | 43 | ..SHITPTQGFNIKSVQSQGNVWDGGQRKIRPYWKNYFE.................................... | 83 |
FFAS is supported by the NIH grant R01-GM087218-01
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02. |