current user: public |
|
Query: gi|16128012|ref|NP_414559.1| regulatory protein for HokC, overlaps CDS of hokC (mokC b0018 exp) [Escherichia coli str. K-12 substr. MG1655], from E.coli |
. 10 . 20 . 30 . 40 . 50 . 60 . | |||||||
# | Score | Template | Links and tools | %id | First | MLNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE | Last |
1 | -5.240 | [NU] COG4726 Tfp pilus assembly protein PilX | ali follow.. | 17 | 7 | ................GPYRQRGISLIVILLLLLVMTLIGLAVLRTTLLQERMSANLRD-LSFQAAEA. | 59 |
2 | -5.180 | [S] COG4929 Uncharacterized membrane-anchored protein | ali follow.. | 15 | 1 | ...................MLKRKWLSIAVIIVALIMVNISIYQKQHL----LAKGDIIILELAPVDPR | 46 |
3 | -5.050 | [S] KOG4478 Uncharacterized membrane protein | ali follow.. | 6 | 121 | .............................LVLLSFTPLLLHFLAKRFPIDIFYNNDKKVFTT....... | 153 |
4 | -4.960 | [H] COG3585 Molybdopterin-binding protein | ali follow.. | 20 | 37 | ......................................VTSVITTRSVKELELAIGSEVIAFVKSTEV. | 66 |
5 | -4.790 | [S] COG4897 Uncharacterized protein conserved in bacteria | ali follow.. | 19 | 4 | .........................IISALIFPCLLVILFARITYNRYVALVLMVVLIAASAKLGY... | 44 |
6 | -4.720 | [S] KOG2765 Predicted membrane protein | ali follow.. | 13 | 1 | ....................MLGRTQRLLLGISILVLVDVVWVSSSELTKFLYNEANFDKPFFCTY... | 46 |
7 | -4.630 | [S] COG3771 Predicted membrane protein | ali follow.. | 19 | 2 | .......................KYLLIFLLVLAIFVISVTLGAQND--NYLLAQGEYRISTLLA.... | 46 |
8 | -4.540 | [S] KOG4484 Uncharacterized conserved protein | ali follow.. | 21 | 309 | ...SSNSDAHKPKRKRRPKKKKQQVGLLTYELIC----------RKQIFE................... | 345 |
9 | -4.480 | [C] KOG4770 NADH dehydrogenase subunit 1 | ali follow.. | 25 | 10 | .........................SLLLIICVLVSVAFLTLLERKVLGYIQIRKGPNKV......... | 44 |
10 | -4.450 | [G] KOG3765 Predicted glycosyltransferase | ali follow.. | 16 | 8 | .....................RRKFLAASLSLLCIPAITWIYLFSGSFVSLSPLESQAHSPRYTASSQR | 60 |
FFAS is supported by the NIH grant R01-GM087218-01
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02. |