current user: public

If you have questions about the server, please let us know.

Query: gi|238922437|ref|YP_002935950.1| DNA gyrase, B subunit (EUBREC_0005) [Eubacterium rectale ATCC 33656], from E.rectale

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .
# Score Template Links and tools%idFirst MSKEIQQNNQEYGADQIQILEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNAVDEALAGYCKNIEVTIEEDNSITVQDDGRGIPVGTNHKAKKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLTVEVYKDGNIYRQSYKRGKTDDTVKIVGQCDESLHGTKVHFLPDPEIFEETVYDYDTLKQRLRETAFLTKGLKITLKDVRENSHHNHVFHYEGGIKEFVEYLNRGKEALYDEVIYCEGTQNGVYVEVALQHNDSFNDSTFSFVNNVITPEGGTHLAGFRNALTKTFNAYAREKKILKDSDPALTGDDIREGLTAIISIKIEEPQFEGQTKQKLGNSEARGAVDAVVSEKLTYFLEQNPDVAKNICEKSLLAQRAREAARKARDLTRRKTSLDGGTLPGKLADCSDKDPKNCEIFIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDRIYDNAEIRAMITAFGTGIHEDFDITKLRYDKIIIMTDADVDGAHIATLMLTFLYRFMPDLIKEGHVYLATPPLYKVEKNKGVWYAYDDDELKQILNDIGRDNNNKIQRYKGLGEMDADQLWETTMDPDHRILKQVMIDGENSSELDVTFTTLMGDKVEPRKEFIEANAKYVTNLDILast
1 -200.000IDP04572 DNA gyrase subunit B [Bacillus anthracis str. Sterne] BAS0005 [Bacillus anthracis str. Sterne]  ali follow..  60  2..EQKQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKYERGIPVADLKVIGDT--DQTGTITRFKPDPEIFQETTYEFDTLATRMRELAFLNRNIKLTIEDKR-EHKQKKEFHYEGGIKSYVEHLNRSKQPIHEEPVYVEGSKDGIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSL--QDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 640
2 -191.000IDP02606 gene: gyrB; DNA gyrase subunit B [Listeria monocytogenes EGD-e] lmo0006 [Listeria monocytogenes EGD-e]  ali follow..  58  6.ITNVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRGLHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRFERGDVVMDMEEQGET--DYRGTIVHFTPDPQIFTETTEDFDTLRTRTRELAFLNRGLTISIEDKREEHKVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERDDIMVEISMQYNTGFSSNIISFANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKRAREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPIRGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDGDTKYSIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNI--KDAIDADETFEMLMGDRVEPRRKFIEDNAQYVKNLDV 646
3 -187.000IDP90817 DNA topoisomerase IV subunit B [Vibrio cholerae O1 biovar eltor str. N16961] VC2431 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  38  2........TEQYNAGAIEVLNGLEPVRRRPGMYTDTT---RPNHLGQEVIDNSVDEALAGYASKIQVILHADQSLEVIDDGRGMPVDIHPEEKVSGVELILCKLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVAVRRDGQVYEIAFEHGDKVTELTVTGTCGRRNTGTSVHFWPDTKYFDSPNFSVSRLINNLRAKAVLCPGLEIIFTDK--VNNNEHRWLYEDGLKDYLAEGVKGYTLLPEEPFTGEFTAQTEAATWAVIWPEGGELITESYVNLIPTAQGGTHVNGLRQGLLDAMREFCEFRN-LLPRGVKLTGEDVFDRCAYVLSIKMQDPQFAGQTKERLSSRQSAAFVSGVVKDAFSLWLNEKPQLAEQLAEVCIANAHSRMRASKKVV---RKKIASGPALPGKLTDCTVQDLNRTELFLVEGDSAGGSAKQARDREFQAVMPLRGKILNTWEVSADQVLASQEVHDISVALGIDP-DSDNLEALRYGKVCILADADSDGLHIATLLCALFTRHFRALVKAGHVYVAMPPLYRIDCGKEVFYALDDQEKEGVLERLSQKAKVNVQRFKGLGEMNPLQLRETTMDPNTRRLVQLTI--DDAEATDEMMDMLLGKKADDRRAWLQRNGDMAE.... 625
4 -186.000IDP05229 gene: parE; DNA topoisomerase IV subunit B [Listeria monocytogenes EGD-e] lmo1286 [Listeria monocytogenes EGD-e]  ali follow..  49  2.......NRNEYNDDSIQVLEGLEAVRKRPAMYIGSTDVRGLHHLVYEIVDNSVDETLAGFGKKIVVTLHEDGSVSVSDEGRGMPVGMHKTGKSTVEVILTVLHAGGKFGQEGGYKTSGGLHGVGSSVVNALSEWLVVTINRDGATYQQKFKDGGKPDGTLKKIG-KSKATGTTIRFKPDPAIFPTTSFNYETLSERLRESAFLLKGMLIELIDE--RVGMAEAFHFEEGVKNFVEYINEGKDVLHPVA-SFEGENATIEVEMAFQFNDGYSENILSFVNNVRTRGAGSHESGMKAAMTRIFNDYARRVNLLKEKDKNLEGSDIREGLSAVLSIRVKILQFEGQTKEKLGTQEARQAVDAVVAEHLAYFLAENPETSSLLVKKAVKAREAREAARKAREETRKKKKRSETLLSGKLTPAQSRNPNKNELYLVEGDSAGGSAKQGRDRRFQAILPLRGKVINTEKAKLQDILKNEEISTIIHTVGAGVGTEFDVEDCNYDKVVIMTDADTDGAHIQVLLLTFFYRYMRPLVEAGKVFIALPPLYKVSRGSGKKEVIEYAWTDEELDSAIQKKGYMIQRYKGLGEMNADQLWETTMNPDTRTLIRVRV--DDSARAERRVATLMGDKVEPRRQWIEKHVEFS-MED. 637
5 -159.000IDP02529 gene: gyrB; DNA gyrase subunit B [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0003 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  53  2........QENYGASNIKVLKGLEAVRKRPGMYIGDTNIGGLHHMIYEVVDNSIDEAMAGHCDTIDVEITTEGSCIVSDNGRGIPVDMHPTENMPTLTVVLTVLHAGGKFDKDTYKVSGGLHGVGVSVVNALSKKLVATVERNGEIYRQEFSEGKVISEFGVIGKS--KKTGTTIEFWPDDQIFEVTEFDYEILAKRFRELAYLNPKITINFKDN--RVGKHESFHFEGGISQFVTDLNKKEALT--KAIFFSVDEEDVNVEVALLYNDTYSENLLSFVNNIKTPDGGTHEAGFRMGLTRVISNYIEANASAREKDNKITGDDVREGLIAIVSVKVPEPQFEGQTKGKLGSTYVRPIVSKASFEYLTKYFEENPIEAKAIMNKALMAARGREAAKKARELTRKKESLSVGTLPGKLADCQSKDPSESEIYLVEGDSAGGSAKQGRERSFQAILPLRGKILNVEKARLDKILKSEQIQNMITAFGCGIGEDFDLSKLRYHKIIIMTDADVDGSHIQTLLLTFFFRFMNELVANGHIYLAQPPLYLYKKAKKQIYLKDEKALSEYLIETGAKKGATIQRYKGLGEMNPEQLWETTMDPSVRRLLKITI--EDAQSANDTFNLFMGDEVEPRRDYIQAHAKDVKHLDV 769
6 -156.000IDP90603 gene: gyrB; DNA gyrase subunit B [Vibrio cholerae O1 biovar eltor str. N16961] VC0015 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  53  2........SNNYDSSSIKVLKGLDAVRKRPGMYIGDTDGTGLHHMVFEVVDNSIDEALAGYCKDIVVTIHEDNSVSVSDDGRGIPTEMHPEEKVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEKVLLTIYRGGKIHSQTYHHGVPQAPLAVVGET--ERTGTTVRFWPSAQTFTNIEFHYDILAKRLRELSFLNSGVSIKLTDER-EEDKKDHFMYEGGIQAFVTHLNRNKTPIHEKVFHFNQEEDGISVEVAMQWNDGFQENIYCFTNNIPQRDGGTHLAGFRGALTRTLNNYMDKEGFSKKAQAATSGDDAREGLTAVVSVKVPDPKFSSQTKDKLVSSEVKSAVESAMNEKLADFLAENPSEAKNVCSKIIDAARAREAARKAREMTRRKGALDLAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYRQMPELIERGYIYIAQPPLYKVKKGKQEQYIKDEEAMNQYQVALASRRGLSIQRYKGLGEMNPDQLWETTMDPETRRMMQVTI--EDAVGADELFTTLMGDQVEPRRAFIETNALKVANLDV 805
7 -151.000IDP90819 gene: gyrB; DNA gyrase subunit B [Yersinia pestis CO92] YPO4094 [Yersinia pestis CO92]  ali follow..  53  2........SNTYDSSSIKVLKGLDAVRKRPGMYIGDTDGTGLHHMVFEVVDNAIDEALAGHCKEILVTIHADNSVSVQDDGRGIPTGMHDEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEKLELVIRREGKVHEQTYKMGVPQAPLKVVGET--EQTGTTVRFWPSFQTFTNNTFQYEILAKRLRELSFLNSGVSIKLKDKRNDKED--HFHYEGGIKAFVEYLNKNKNPIHPKVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLVGFRTAMTRTLNSYMDKEGYSKKAKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKTAVETLMNEKLVEYLLENPTDAKIVVGKIIDAARAREAARKAREMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYRQMPEIIERGHVFIAQPPLYKVKKGKQEQYIKDDDAMEQYQMTLASRRGLAIQRYKGLGEMNPDQLWETTMDPESRRMLRVMV--KDAIAADQLFTTLMGDAVEPRRAFIEENALRAANIDI 804
8 -112.000IDP92142 DNA topoisomerase II, putative [Toxoplasma gondii ME49] TGME49_112230 [Toxoplasma gondii ME49]  ali follow..  25  26.GKKSGGGKPKTIEQRYQKKSQLEHILLRPDTYIGSTEVPGLYKIVDEILVNAADKPGARRMSAIKIDINASGRITIWNDGEGIPVAIHQEHKVYVPEMIFGQLLTSDNYDDSECRVTGGRNGYGAKLTNIFSREFTVECGERKKKFKMTWTKNMEQKSESEISSY-NGTDYVKISFIPDFAKFGMTGFDDDSLSLLRKRAYDLTSGVKVFLNGTRIDINESDDDWDEGPKRKKAAKKNGKKGELEDEEDVANGHDKQWRWEVVISSTDGGQFQQVSFVNSICTTKGGTHVSHVIEPLLAAIVKKANTK---NKGGMEIKAAHVKQHLWIFVSCLIVNPAFDSQTKETLTTKPAKFGSKCTLADKTIGWAQTKQQSVRAFSLSLLDCWRLGALSVDRPVFRLKTKGRERLAGIPKLEDAGGRHSQDCTLILTEGDSAKTSCLAGLGRDRYGVFPLRGKLLNVRDASFKQLTENKEIQNILKIVGLQVNDRTDTRGLRYGSVMIMTDQDHDGSHIKGLLINMMHHYWPQLLKRGFLKAFSTPIVKVSKNNVEKAFYTIPEYEQWKRSCNT-TGWKIKYYKGLGTSTDREFKEYFNDLDKHQIDFVWSGQHDGELIDMAFNK---KRAEDRKRWLQSY......... 762
9 -78.600IDP92137 DNA gyrase subunit B, putative [Toxoplasma gondii ME49] TGME49_097780 [Toxoplasma gondii ME49]  ali follow..  39  247.SRSFASPSSAYTSDSIRVLEGLEPVRMRPGMYIGSTDSEGLHHLVWEAIDNAVDEVENGDCRRIVVVLHADRRVTVADDGRGIPCDVHPQTGLSALETVFTKLHAGGKFSPASYAFAGGLHGVGSSVVNALSSQLRVSVLRDGKLHAISFSRGQVVSPLTVQTSPSLSRSGTCLTFEVDREIFELFSDAPVISINGSHPSSGLLLSVRLFFSSPSSSPSSSSSASSSASSSSSASSLSSSDSSASASLCS----SSSAAASPLSPSSVSSSDFFLSFVNSIPTPEGGVHVEGIRAALSRAVQRLLRLSDNSHEKSLNIPGEFLREGLVGVVSLKMREAEFEGQTKKKLGNKKVRGIVEELVTDALLNYFERHPQNLQKLLQKATAARAAAAAAKAARDFKQQSSSLHLTLLPGKLSDCSPTNARSKELFIVEGESAAGSAKQARDRRTQAILPLRGKILNVEKLNFARIFENEELKALVAALGISVTKAADLEGLRYSRVIILTDADVDGAHVRSLLLTFFFRLQPELFRQGRIFVACPPLFKIAHFPVPHKLLQDATAAFRKRPCSSLPGVTLQRFKGLGEMQPEQLRRTTMSPVTRILKKISV--ADAEAAEAAVASLMGDDVDARKKIIFEANRFVEELDV 1257
10 -8.120IDP01893 gene: pefC; usher protein [Salmonella typhimurium LT2] PSLT017 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  198..SRYADGSGEFTARDITLSTAISQVQGD--LLLGKSQTRS--ALFSDF-SNMLPWEARGYAPLITGVANSTSRVTISQNGYAVPYQLDDVRSVGNGDLVVTVEDASGH-GEVEYNVAVGRKSSNYKLKKPFAD------GENGMFWMGSVGYGFDSTTLNAASILHGKYQAGGVSVTQALGGFGAVSAGMNLSQAKYDNGDNKRGSVSAKYAKSFSDSSDLQLLAYRYQSKGYVEFADFYSTD------RYTRYNTKSRYEMRFSQRLGNSNLNLAGWQEDYWWMKGKAIGSLSTTILDGVS-VFLNGSYSKRPYLDKPDYSTSLSFSIPFTLGGVRHYSSGLSYSSSGRMGMNSGVSASPTDRLSYGLNTNLSDKGDRSLSGNLSYGFDAIQTNMMLSQGRDNTTVSGSVSGTILGTADTKETGNTLGVARIPGVKGVRINGTNSKGYTVVNLSDYSLNRVSVDMENVPDDLELQTVVPTEKAVVYREFGAEH---VLRYILRVKERDGRIL-GSAQTEQGLDAGFIAGNGVLLM............................................................................................................ 763

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.