|
current user: public |
|
Query: gi|238922440|ref|YP_002935953.1| hypothetical protein (EUBREC_0008) [Eubacterium rectale ATCC 33656], from E.rectale |
. 10 . 20 . 30 . 40 . | |||||||
# | Score | Template | Links and tools | %id | First | MLYVFPFFSPDSFIFTVFLFFQHNITCNNYSFLITLHISLFHYSCNN | Last |
1 | -6.200 | IDP00603 gene: sarX; staphylococcal accessory protein X SACOL0726 [Staphylococcus aureus subsp. aureus COL] | ali follow.. | 25 | 2 | ..........................AEKFKIIMTEALSLYIWGCN. | 21 |
2 | -4.620 | IDP93949 hypothetical protein YWA314_20249 [Yersinia enterocolitica subsp. enterocolitica WA-314] EKA25320 [Yersinia enterocolitica subsp. enterocolitica WA-314] | ali follow.. | 22 | 49 | ......FDIEEYWIPILQKYFSHQINTSEYDYQISFD.......... | 79 |
3 | -4.030 | IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A] | ali follow.. | 21 | 179 | .....RYTTNDGYVFN-----PADIIEDTGNAYIVPHGGHYHY.... | 211 |
4 | -3.660 | IDP05140 prolyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS0382 [Bacillus anthracis str. Sterne] | ali follow.. | 42 | 483 | ...................FGLHN-KCNPKSFLVLQFVSCI...... | 503 |
5 | -3.620 | IDP05644 gene: bclA2; exosporium glycoprotein [Clostridium difficile 630] CD3230 [Peptoclostridium difficile 630] | ali follow.. | 3 | 522 | ....................LSFLVDARAAAVTLSFTFSGTTGTSAA | 549 |
6 | -3.400 | IDP91413 hypothetical protein VV1_0714 [Vibrio vulnificus CMCP6] VV1_0714 [Vibrio vulnificus CMCP6] | ali follow.. | 21 | 1 | MLREFAVYRPRQVARFVKTLFKGSFSINGIGEF.............. | 33 |
7 | -3.270 | IDP91770 gene: yqgE; hypothetical protein STM3096 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] | ali follow.. | 25 | 7 | FLIAMPALQDPIFRRSVVYICEHN....................... | 30 |
8 | -3.270 | IDP05487 hypothetical protein BA_4765 [Bacillus anthracis str. Ames] BA_4765 [Bacillus anthracis str. Ames] | ali follow.. | 62 | 39 | ......................EQIACNNY................. | 46 |
9 | -3.220 | IDP93831 cellulose synthase subunit BcsC [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001008212 [Yersinia enterocolitica subsp. enterocolitica 8081] | ali follow.. | 20 | 1026 | ......YYSPQKYL-SLAIPVNYRQRTDNWSWELGGSVSLSHSATND | 1065 |
10 | -3.220 | IDP91924 pneumococcal histidine triad protein B [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007441 [Streptococcus pneumoniae str. Canada MDR_19A] | ali follow.. | 21 | 37 | ......HVESDGLIFD-----PAQITSRTARGVAVPHGNHYHF.... | 68 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82. |