current user: public

If you have questions about the server, please let us know.

Query: gi|238922448|ref|YP_002935961.1| DNA-binding response regulator (EUBREC_0022) [Eubacterium rectale ATCC 33656], from E.rectale

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MTILVCDDDKEIVEAIEIYLMQEGYDVEKAYDGIQAVEIMKNKKIDLMIIDVMMPKLDGIRATLQIRKESRVPIIILSAKTEDADKILGLNVGADDYVTKPFNPLELVARVKSQLRRYTTLSSNDAAGDKVYEAGGLLVNDDLKKVTVDGEEVKLTPIEYNILLLLLKNKGKVYSINEIYESIWNEEAIGADNTVAVHIRHIREKIEINPKEPRYLKVVWGVGYKIEDNKLast
1 -104.000IDP91043 gene: vanRG; response regulator [Enterococcus faecalis] EFE0003 [Enterococcus faecalis]  ali follow..  48  4.KILIVDDEKEIADLIELYLKNDGYKVYKFYNGIDALKCVESEKMDLAILDVMLPDVDGFHICQKIRERYFYPIIMLTAKVEDADKIMGLTIGADDYITKPFNPLEVAARVKTQLRRYVCYNNAADIEKEEYDINGLVINKNTHKCTLYGKAVTLTPIEFSVLWYLCENRGKVISSEELFENVWGEKFLDNNNTVMAHIGRLREKLKEPARNPKFIKTVWGVGYTIEE.. 235
2 -103.000IDP04024 DNA-binding response regulator YycF [Bacillus anthracis str. Sterne] BAS5319 [Bacillus anthracis str. Sterne]  ali follow..  37  5.KILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKATEEQPDMVLLDIMLPGKDGLEVCREIRKSSEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRHQQGGAAEKEENTEMVIGPIVINPNAYSVTKREENIELTHREFELLHYLAKHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPTLIVTRRGVGYYLRDPE 233
3 -103.000IDP02446 hypothetical protein lmo0287 [Listeria monocytogenes EGD-e] lmo0287 [Listeria monocytogenes EGD-e]  ali follow..  39  5.KILVVDDEKPIADIVKFNLNKEGFDVYCAYDGDEALELVEEVQPDLILLDIMLPGRDGIEVCREVRKKYDMPIIMVTAKDSEIDKVIGLELGADDYVTKPFSNRELIARVKANLRRHSQVSSSEEEENSELEIGSLIIHPDAYVASKRGETIELTHREFELLHYLAKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPAWLVTRRGVGYYLRNPE 235
4 -101.000IDP91047 gene: vanRD; response regulator [Enterococcus faecium] EFA0003 [Enterococcus faecium]  ali follow..  43  4.KILVVDDEKELADLVEVYLKNDGYTVYKFYNGKDALKCIESVELDLAILDIMLPDVDGFQICQKIREKFYFPVIMLTAKVEDGDKIMGLS-VADDYITKPFNPLEVVARVKAQLRQYMRYKQKQEAECTEYDIRGMTISKSSHKCILFGKEIQLTPTEFSILWYLCERQGTVVSTEELFEAVWGERFFDSNNTVMAHIGRLREKMKEPSRNPKFIKTVWGVGYTIEK.. 232
5 -100.000IDP95471 hypothetical protein [Listeria monocytogenes 10403S] YP_005962623 [Listeria monocytogenes 10403S]  ali follow..  35  1MKLLMIEDNVSVCEMIEMFFMKEEINATFVHDGKMGYEAFFKDDYDIAIIDLMLPNMDGMTICRKIREVSDVPIIILTAKESESDQVLGLEMGADDYVTKPFSPLTLMARIKAVTRRKNS-ATSTENNEDILETTYFKISKRTREIFYQDELLDLTPKEFDLLYFLMQHPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRQKIATET--KPFLHTVWGVGYKFDETE 228
6 -99.500IDP95294 response regulator protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] YP_494943 [Staphylococcus aureus subsp. aureus USA300_FPR3757]  ali follow..  29  2VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKNDYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYN------INSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLK-KLNATLTIETVRGQGYKVENH. 223
7 -97.900IDP95461 DNA-binding response regulator [Bacillus anthracis str. Sterne] YP_028080 [Bacillus anthracis str. Sterne]  ali follow..  35  33.NILIVDDDPHIRELVSVFLECEGFQTYEAIDGLDALQKINQVKVDMVILDIMMPNMDGFDVCFELRKYYDIPILILTAKGETSQKVKGFHLGTDDYLVKPFDPIELVVRVKALLKRYQ------ITVSQSIQVGTVLLNRKTFEVTIGEQTVTLPLKEFELLFTLGSKAGRTCSREQLIEDVWGYDFEGNERTLDVHINRLREKFQEEK-SKFSIKTIRGLGYRLEVSK 254
8 -97.200IDP91279 DNA-binding response regulator [Bacillus anthracis str. Sterne] NT05BA4913 [Bacillus anthracis str. Sterne]  ali follow..  29  3.KILIVEDDPNISSLLQSHIQKYGYEAVVAENFDDIMESFNAVKPHLVLLDVNLPKFDGFYWCRQIRHESTCPIIFISARAGEMEQIMAIESGADDYITKPFHYDVVMAKIKGQLRRIYG-DYAPNISERIVEVEGLKLFPERPEIHFGSEQVLLTKKEAILAEMLLSKFPRTASREDLLAALWDDESFVEENTLNVNITRLRKKFN-ELGIENAIETVRGLGYRFNATW 229
9 -97.200IDP02231 gene: lisR; two-component response regulator [Listeria monocytogenes EGD-e] lmo1377 [Listeria monocytogenes EGD-e]  ali follow..  33  3.RILIVEDEKNLARFIELELQHENYETAVANDGRAGLELALNEEWDAILLDLMLPHLNGVEVCRRVRQVKQTPIIMITARDSVIDRVSGLDHGADDYIVKPFAIEELLARLRSLLRRVE--NAEQSAKQTTLQYRNLIVEKENRIVKRDEEIIDLTKREYELLLTLMENVNIVLTREVLLNKVWGYETEVETNVVDVYVRYLRNKID-HPDEESYIQTVRGTGYVMRT.. 226
10 -97.000IDP91441 response regulator [Vibrio vulnificus CMCP6] VV1_0468 [Vibrio vulnificus CMCP6]  ali follow..  33  4.RILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKLAEPFPDLVLLDWMLPGGSGINFIKHMKRERNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIRRV-----TPTALEDVIDVQGLKLDPVSHRVTANDAPVDMGPTEFKMLHFFMTHQERVYSREQLLNNVWGTNVYVEDRTVDVHIRRLRKALE-DAGHDKLIQTVRGAGYRFSTK. 228
11 -96.900IDP00057 lantibiotic biosynthesis DNA-binding response regulator, putative BA_3900 [Bacillus anthracis str. Ames]  ali follow..  34  3.RILAIDDEDGILYIIKSALEKEGHEVTAVSNP-LTIPKEKFCHYDLILLDVMMPEIDGFTLCKEIRDFVDSPIVFLTAKTMEKDLITGLSLGGDDYITKPFGIGELRARVSAHVRREH------REKQNAFFLSGLTFHLSCKEIWYDDTSIAFTKSEYGICEYLALNHGQVFSREKIYENVFGYEGESDNQVIVEHIKNIRHKLSKYGMNP--IETVWGIGYKWRK.. 220
12 -96.200IDP92626 gene: cpxR; DNA-binding response regulator in two-component regulatory system with CpxA [Escherichia coli str. K-12 substr. MG1655] b3912 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  33  3.KILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDD-SIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQNNDNGSPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSA. 231
13 -96.000IDP01662 hypothetical protein lmo2583 [Listeria monocytogenes EGD-e] lmo2583 [Listeria monocytogenes EGD-e]  ali follow..  35  3.QILVVDDDRHILKLVGHYLRAEGFHVLEASDGVEAEKIVETEQVHLAVIDVMMPNMDGFELCQKMRASPDIPVIMLTAKDALADKSRGFEVGTDDYVTKPFEPEELIFRIRALLRRSN------QASEVKINIGNITIDQKSYGIKIGNQERMIPVKEFELLYQLASYPGRIFTREELIERIWQRDYDGSDRTVDVHIKRLRDHFDEEK-DGIRIVTVRGVGYKLEETR 225
14 -95.200IDP01942 hypothetical protein lmo1745 [Listeria monocytogenes EGD-e] lmo1745 [Listeria monocytogenes EGD-e]  ali follow..  32  2VKVYIVEDDEVIRDTIRKHLSKWGFEIGVVEDFNNILQEFLAFEPQLVILDVNLPFFDGFYWCNQIREVSNVPIIFLSSRNSRMDQIMGMNMGADYYIEKPVDLDVLMARINALLRRTY--SYADLEEANVMEHNNVFLHIDTNTLTHLEDKIELTKNEFLILYELMKQKGSIVSRDEIMRALWEDESFVDDNTLTVNVVRIRKKLA-EIGLSEFIKTKKGQGYMIE... 225
15 -91.300IDP91042 AdeR [Acinetobacter baumannii] ACB0002 [Acinetobacter baumannii]  ali follow..  34  14.VILVVEDDYDIGDIIENYLKREGMSVIRAMNGKQAIELHASQPIDLILLDIKLPELNGWEVLNKIRQKAQTPVIMLTALDQDIDKVMALRIGADDFVVKPFNPNEVIARVQAVLRRTQ---FANKATNKNKIYKNIEIDTDTHSVYIHSENLNLTLTEYKIISFMIDQPHKVFTRGELMNHCMN-DSDALERTVDSHVSKLRKKLEEQG-IFQMLVNVRGVGYRLDNPV 241
16 -86.700IDP91359 response regulator [Vibrio vulnificus CMCP6] VV1_2847 [Vibrio vulnificus CMCP6]  ali follow..  37  1MKILVVEDDPRLGEQIIESLEKTGWVPELSQDGIDALYRATSEEWDAIVLDLGLPKLDGLTVLKGIRDENNTPVVILSARDTLTQRVEGLNAGADDYLTKPFEMVELIARIRAQLRR------ASGNASPVMQIGDLSLDTRTSKVMWQGQAVSLTALEYKVVAYFVHNADKVISRTELVEHIYKQDFDRDSNTIEVFIGRIRKKIA-----PNIIKTVRGLGYQLNAN. 219
17 -83.400IDP90005 gene: qseB; quorum sensing Escherichia coli regulator B [Escherichia coli O157:H7 EDL933] Z4377 [Escherichia coli O157:H7 str. EDL933]  ali follow..  30  1MRILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGREPVLILTARDALEERVXGLRLGADDYLCKPFALIEVAARLEALMRR------TNGQASNELRHGNVMLDPGKRIATLAGEPLTLKPKEFALLELLMRNAGRVLPRKLIEEKLYTWDEEVTSNAVEVHVHHLRRKLGSD-----FIRTVHGIGYTLGEK. 219
18 -61.500IDP04262 gene: spo0A; Spo0A protein [Clostridium perfringens ATCC 13124] CPF_2067 [Clostridium perfringens ATCC 13124]  ali follow..  22  6ISVLIADDNKEFCNILNDYLLSQRDITGIAKDGLEALKLIEEKQPDLVVLDIIMPHLDGLGVLERINSEKTPRVIVLSAVGQDKITQRAITLGADYYVVKPFDMDVFTERIRQMFNSTISEEPTNSKPSEDSSSDDNKEPMDLEVEITSIIHEIGVPAHIKGYMYLREAITMVVNDMELLSAITKELYPSIAKKYNTTASRVERAIR------HAIEVAWGRGQIDAINK 243
19 -50.900IDP01029 gene: cheY; chemotaxis regulator transmitting signal to flagellar motor component STM1916 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  26  6LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG............................................................................................................... 128
20 -40.700IDP01814 gene: hnr; response regulator of RpoS [Salmonella typhimurium LT2] STM1753 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  24  9.QILIVEDEPVFRSLLDSWFSSLGATTALAGDGVDALELMGRFTPDLMICDIAMPRMNGLKLVENLRNRDQTPILVISATENMADIAKALRLGVEDVLLKPVDLNRLRETVFACLYPNMFNSRVEEEERLFRDWDAMVSNPTA....................................................................................... 152
21 -40.600IDP91348 response regulator [Vibrio vulnificus CMCP6] VV1_3127 [Vibrio vulnificus CMCP6]  ali follow..  22  9.EILVVDDTVDNVKLLSQLLQNEGYLVKGALSAKSALRMCQKKKPDLILLDIMMPEVDGYELCRQLKKDQDIPVIFLSALDHVQDKVRAFQIGGVDYIQKPFEVMEVLARVRTHAGLVTLQRALIEQNEQLKRMATTD----ADMAGKVSGNFALILFDIDVLVRIAEITRRVIGQHGYCARWGGEEFLFDAKRAYDLAACIQDEFNESKGTLGAYHFTASFG....... 261
22 -36.100IDP90946 gene: bvgA; virulence factors transcription regulator [Bordetella pertussis Tohama I] BP1878 [Bordetella pertussis Tohama I]  ali follow..  20  3NKVLIIDDHPVLRFAVRVLMEKEGFEVIETDNGIDGLKIAREKIPNLVVLDIGIPKLDGLEVIARLQSLGPLRVLVLTGQPPSLFARRCLNSGAAGFVCKHENLHEVINAAKAVMAGYTYFPSTTLSE----------MRMGDNAKSDSTLISVLSNRELTVLQLLAQGMSNKDIADSMF----------SNKTVSTYKTRLLQKLN....................... 192
23 -35.800IDP02322 gene: cheY; chemotaxis response regulator CheY [Listeria monocytogenes EGD-e] lmo0691 [Listeria monocytogenes EGD-e]  ali follow..  24  2LKLLIVDDAMFMRTMIKNIVKDSDFEVVEAENGLEAVKKYDEVKPDIVTLDITMPEMDGLEALAQIMAKDSAKVIMCSAMGQQGMVVDAIKKGAKDFIVKPFQADRVLEALEKAAK.................................................................................................................. 119
24 -35.800IDP93893 regulatory protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005758 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  20  2.....................................................................................................................................SSSVVLDKLKNVLMINNEAHALSKNEVLLLEYLYLRGGEVIPRDELISHCWPDRVVSA-VSLPVAIKHIRDVLR-KATLNEVIKTHKSVGYSLQKDS 96
25 -35.600IDP00102 gene: evgA; putative positive transcription regulator (sensor EvgS) NT01SF2944 [Shigella flexneri 2a str. 2457T]  ali follow..  21  1MNAIIIDDHPLAIAAIRNLLIKNDIEILELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFVGSLTSDQQKLD-------------SLSKQEISVMRYILDGKDNNDIAEKMF----------SNKTVSTYKSRLMEKLE....................... 187
26 -34.600IDP95113 two-component response regulator [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001333743 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  14  6VDVLIIEDESELARLHAELVQKPRLRLAMAASLAQARQLLHATPPQLVLLDNYLPDGKGVTLMTDPALATQCSVIFITAASDMETCSQAIRNGAFDYILKPVSWKRLSQSLERFIQFYDQQREWKIVDQQNVDYQLQAKNYRVDSGSKGIEEKTLALVQGLFS----DREAHCFSVDEVVSAA-------SKTTARRYLEHGVET......................... 206
27 -33.900IDP92614 gene: vraR; DNA-binding response regulator [Staphylococcus aureus subsp. aureus USA300_FPR3757] SAUSA300_1865 [Staphylococcus aureus subsp. aureus USA300_FPR3757]  ali follow..  25  3IKVLFVDDHEMVRIGISSYLSTQS--VGEGASGKEAIAKAHELKPDLILMDLLMDDMDGVEATTQIKKDLQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSR------------GESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIAKG----YSNQEIASASH------TIKTVKTHVSNILSKLEVQDRTQAVIYAF........... 203
28 -33.800IDP00997 putative chemotaxis signal transduction protein STM2314 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  27  188.VAIVAEDSKVARAMLEKGLNAMGIPHQMHVTGKDAWERIQQEKIALVLTDLEMPEMDGFTLTRKIKTDKKIPVVIHSSLSGSANEDHIRKVKADGYVAKF-EINELSSVIQEVLERAATNSQGPLISRK.................................................................................................... 331
29 -32.200IDP00850 transcriptional regulatory protein DegU, putative SACOL2389 [Staphylococcus aureus subsp. aureus COL]  ali follow..  23  1MKIVIADDHAVVRTGFSMILNYQN--VATAADGVEAYQKVMEYKPDVLLMDLSMPGESGLIATSKIADSFETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKLTTS-----VNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKG----YGNKEIAEKLF------SVKTVEAHKTHIMTKLG....................... 198
30 -29.200IDP04184 sensor histidine kinase/response regulator LuxN [Vibrio cholerae O1 biovar eltor str. N16961] VCA0522 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  32  568RRILVVDDNQSIRTFTAILLEQQGYEVVQANDGSEVLKHMESQNIDLVLMDIEMPNVGGLEATRLIRNSKNIPIIGYTGDNSPKTLALVQTSGMNDFIVKPADRDVLLNKVAAWV................................................................................................................... 686
31 -28.900IDP04495 sensory box sensor histidine kinase/response regulator [Vibrio cholerae O1 biovar eltor str. N16961] VC0622 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  33  770PLLLVADDEPVNLRVLDSFLRLEGYRVHTAQDGHQVLEAIKREKPELVLLDIMMPGMSGYQVCEKLRQTAELPIIMLTALNQSDDRVRGFEAGANDYLSKPFNKQELAARIVAHLTASKAELRRIENAQ..................................................................................................... 901
32 -28.000IDP02415 sensory box sensor histidine kinase/response regulator, putative [Coxiella burnetii RSA 493] CBU_1761 [Coxiella burnetii RSA 493]  ali follow..  17  410VPVLLVEDTPLAQKAIGIKLEELGCAVDLADNGEAAIKKASQNRYSLIFMDIGLPGIDGYEAAARIRAKSPTPIVALTAHVNEEGEQQCYKVGMNLVLHKPMLGQYGQRILNRFVNNERREIGSPASDAEKRNNNNKVIDWTSATRIFGNKAA-------KMFKLFLE------ELPRFHEDIKKAFEANDRKALAFHVHKLN........................... 607
33 -27.700IDP95126 transcriptional regulator RcsB [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001336285 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  18  4MNVIIADDHPIVLFGIRKSLEQIE--VGEFEDSTALINNLPKLDAHVLITDLSMPGGDGITLIKYIKRHFDLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRL--------------EKISASGYGDKRLSPKESEVLRLFAEG----FLVTEIAKKL-------SIKTISSQKKSAMMKLG....................... 194
34 -27.500IDP91817 gene: rcsB; DNA-binding response regulator in two-component regulatory system with RcsC and YojN [Escherichia coli str. K-12 substr. MG1655] b2217 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  4MNVIIADDHPIVLFGIRKSLEQIE--VGEFEDSTALINNLPKLDAHVLITDLSMPGGDGITLIKYIKRHFSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRL--------------EKISAGGYGDKRLSPKESEVLRLFAEG----FLVTEIAKKL-------SIKTISSQKKSAMMKLG....................... 194
35 -27.300IDP95163 positive regulator for ctr capsule biosynthesis, positive transcription factor [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001336074 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  12  1MSTMIMDLCSYTRLGLTGYLTSRGIKIVEVNSAADLQKHCTSCCPAVVFLNEFVHDDESNGIIRQIITQNPATLFVIFMSLANIHFDRYLRVRKNLLISSKSITPKDLDVILVNYLKYKNTSVGQ----------------------LTLPTLSLSKTESNMLQMWMAG----HGTSQISTQM-------KAKTVSSHKGNIKKKIQ....................... 181
36 -27.200IDP91185 AAC46367 [Vibrio cholerae]  ali follow..  21  5.KVLIVEDDEGLREALIDTLALAGYEWLEADCAEDALLKLKSHSVDIVVSDVQMAGMGGLALLRSIKQHWNLPVLLMTAYANIQDAVSAMKDGAIDYMAKPFAPEVLLNMVSRYAPVKSDDNGDA-------------VVADTKSLKLLALADKVAKTDANVMILGPSGSG----KEVMSRYIHNASPRKEGPFIAINCAAIPDNMLEA..................... 196
37 -27.100IDP93897 response regulator protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007718 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  16  7LNIAMIEDEPFSRLALMEILKKYPYHVGCVSNTPELITLLESNEIEVLLLDYSLVAQDGVGLIKRLLQLRALKIIVHTAHKSLAVARLAWQAGAWGFVQKSSDIQELFFAISYVAR------------------GKKFFPIELASLSQSAQK-TLTGRETEVLRMLLNG----LKQKEISVRL-------SFKTVSNTKTRAFKKLG....................... 220
38 -27.000IDP02403 sigma-54 dependent DNA-binding response regulator [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1024c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  17  1MNLVIVEDDINMRKSLEIALEYEEFNIKSYKSATEALKKIDD-NTDLIITDINMPGIDGIEFVKACEN--KYDFIIMTGNATLSRAIEAVRLGVKDFLTKPFDVDTLVEAIKRAKIIREKTADKKSKKNEKKEENKDFFSTSPNLEKTLNLSQKAAKTDASVMFFGESGVG----KEVFSRYIHTHSKRSNKPFIAINMAAIPANLIES..................... 203
39 -25.300IDP04164 sensor histidine kinase/response regulator [Vibrio cholerae O1 biovar eltor str. N16961] VC1445 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  38  454HHILVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLEKNHFDLVLMDISMPIMDGIAATKILRDKIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL................................................................................................................... 570
40 -25.200IDP02145 gene: psaE; putative regulatory protein [Yersinia pestis CO92] YPO1301 [Yersinia pestis CO92]  ali follow..  19  3......................................................................................................................................HCVVLNKLESVLIIGDSRYALSKNEVLLLECLYLRAGDVISHDELLTTCWPDRVV-SPTSLPVAIKHIRDVFRKI-TRSEVIKTYKNEGYSYQKD. 95
41 -25.000IDP04341 putative aerobic respiration control sensor protein arcB [Coxiella burnetii RSA 493] CBU_0634 [Coxiella burnetii RSA 493]  ali follow..  25  512VRVLLIEDDKLSQNIEKIFLEEFGCKVDTASNAEEALVKFNE-SYELICTDIGLPDKDGYALVREIRQHKPVPILAMTAHVFDREKNKCLEAGMNGFINKPVTVEEIRRALLDYL................................................................................................................... 629
42 -24.900IDP04733 two component system histidine kinase [Coxiella burnetii RSA 493] CBU_0789 [Coxiella burnetii RSA 493]  ali follow..  18  577LSVLVVEDNALAATAVAVVLKPFNCAVDFAESGAQAIEKARKGIYDLILMDVGLPDISGIEATQRIRAKAQVPIIALTGHADNGERQECLEAGMQEVLSKPLQRLAIESTLEQFIFRAKAEKEAKSGPPVTMPESTEVIDWNACVRMCNGSPEFTR----QLLTILDEDLKSTRAKRAELHRLRGGVSYLKLPQLDNALKMFHEVVKIEPPNPALLEES........... 811
43 -24.000IDP04664 sensor histidine kinase/response regulator [Bacillus anthracis str. `Ames Ancestor`] GBAA0996 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  36  777.TIMIVDDDHRNIFALQNALKKQHANIITAQNGLECLEILKNNNIDLILMDIMMPNMDGYETMEHIRMNHEIPIIALTAKAMPNDKEKCLSAGASDYISKPLNLHQLYSVMSVWLIK................................................................................................................. 896
44 -23.600IDP91425 aerobic respiration control sensor protein ArcB [Vibrio vulnificus CMCP6] VV1_0550 [Vibrio vulnificus CMCP6]  ali follow..  18  527LSIFMVEDIALNVTVARSLLESLGHKVTVAMTGDEAIRSFDPSRYDLVLLDIQLPDMTGFDVAAYYRKHQLPPLVALTANVLKDKR---LDNGMDEAISKPLAVQAIQDVIEKLIIKQESTTIEMEEAE..................................................................................................... 656
45 -23.100IDP01805 sensory box sensor histidine kinase/response regulator [Coxiella burnetii RSA 493] CBU_1084 [Coxiella burnetii RSA 493]  ali follow..  31  565MNVLVVEDNLINQRISKIMLEQVGCQVDIAGCGKDAIEKMKK-HYDMVFMDIGLPDMDGFETTQCIRHNQRVPIVAMTAHVFAQDRKRCFDVGMDEVMAKPIMQDDLIKVLKRWA................................................................................................................... 682
46 -22.600IDP93815 sensor kinase protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007719 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  19  662RRLLVVEDEPLLLEVQYELFSSMGFQVDAVANTQQAYQSWLQHHHTIIVTDCRLDESDGFELVRHLRKLEPVLIIGQSASLKTEDAQRAREVGMDYLLQKPVAREQWQQLIRDYFASKEKEHD........................................................................................................... 789
47 -22.500IDP04186 sensor protein TorS [Vibrio cholerae O1 biovar eltor str. N16961] VCA0709 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  20  746ANVLLVEDNEVNCLVAQGFLTSLGHQVTLAKSVQEAKLCFQQQRFDIALLDIHLPDGNGVDLLRDLRQNAVIPFIAVSAHVFNEEVAGYLAAGFDGYLPKPLVKEQLAAMLRQQLTAKSGDDADMRDKAE.................................................................................................... 881
48 -22.500IDP04543 sensor histidine kinase/response regulator [Vibrio cholerae O1 biovar El Tor str. N16961] VC2453 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  21  665LCVMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTACKAIKQLRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHWSPHTRSKQVAKVTPPD.................................................................................................... 797
49 -22.500IDP91057 gene: agrA; accessory gene regulator protein A [Staphylococcus aureus subsp. aureus USA300_TCH1516] USA300HOU_2035 [Staphylococcus aureus subsp. aureus USA300_TCH1516]  ali follow..  16  1MKIFICEDDPKQRENMVTIIKNKPMEIALATDNPYEVQAKNMNDIGCYFLDIQLSDINGIKLGSEIRKDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPATRIIDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMF----FESSTKSHRLIAHLDNRQIEFYGNLKELSQL--DRFFRCHNSFVVNRHNIES.......................... 212
50 -22.400IDP04484 gene: barA; two-component regulatory protein [Yersinia pestis CO92] YPO3381 [Yersinia pestis CO92]  ali follow..  23  668FRVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIRASEIIHQIQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRYQSDNPPLSTASTASTA.................................................................................................... 800
51 -21.500IDP01908 gene: ssrA; sensor kinase [Salmonella typhimurium LT2] STM1392 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  24  689LQILLVDDADINRDIIGKMLVSLGQHVTIAASSNEALTLSQQQRFDLVLIDIRMPEIDGIECVRLWHDEPDCMFVALSASVATEDIHRCKKNGIHHYITKPVTLATLARYISIAAEYQLLRNIELQEQD..................................................................................................... 822
52 -21.200IDP04166 sensory box sensor histidine kinase/response regulator VieS [Vibrio cholerae O1 biovar eltor str. N16961] VC1653 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  918GHVLVADDDAINRLLIKKQLSELGLSATLVSDGLQAFEKLSQEQYDLLITDCHMPHLDGFALTRKVKQEFKGAVVGCTAEDSRLAAEQALQAGMDKVIYKPYTLANLRKVLSRYLTQWVALPEQSWLDAYQEEEREEMAMVVAESLAQDIALLNQPDCDVKALAHRIKGAAGSLQLQRLADLAKTVEKQNDPQQLVADKQQLINAMHE...................... 1131
53 -21.100IDP04401 sensor histidine kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC1831 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  24  602LRVLIVEDNRTNIMILEAFMRNKGFECHSVMDGVQAITALQESSFDLVLMDNHMPLKDGIQATREIRQQAKILLFGCTADVFKDTRDKMLSAGADDIIAKPIAEHELDMALEQHSERLYQFHREPSLPS..................................................................................................... 734
54 -21.100IDP01829 hypothetical protein lmo0051 [Listeria monocytogenes EGD-e] lmo0051 [Listeria monocytogenes EGD-e]  ali follow..  15  2LPVFICEDNRMQRERLTKYIED-DMKLELSTGDPFELRMPTHQGMGLYFLDIDLPDMNGFELAQEIRKDPRGFIIFITTHAELSYMTFTYKVEALDYIIKDDIDLLHDRVLACMKQAEERISNDQDMQKYFTF---KVSDKKIIHELLDD--FETAPTIHKVILHGKNRQVEFYGKLKNIEKMLDESFYRCHRSYIVNKKNIHE.......................... 214
55 -21.000IDP02181 two-component sensor/regulator [Yersinia pestis CO92] YPO0256 [Yersinia pestis CO92]  ali follow..  26  694MHILLVDDSETNRDITGMMLQQLGHQVTRADSGTTALAIGRQHRFDLVLMDIRMPVLDGLATTARWRHDSHCMITALSANASPDEQIKTSQAGMNHYLSKPVTLGQLAEMLDLTAQFQLERGVDLSPQLS.................................................................................................... 828
56 -20.300IDP90302 sensory transduction histidine kinase, putative [Borrelia burgdorferi B31] BB_0420 [Borrelia burgdorferi B31]  ali follow..  19 1156INVLIAEDNQVNQKVLKDILVVIGINIDVVDDGVKALKSLKDKKYTISFIDIRMPRYDGFSVAKEIRKFKPCVLVAVTAHALQEYKDKCLASGMNDYISKPIHISSIKTILKKYLQFEVDDIGENENLNQLVKFPNLDVNRALKELNLSYVSYSELCRGLFISINIIDLEKAFDEEDLSLIKDISHSISGALSNMRSELYKDFQKIETSKDSISELKKM........... 1385
57 -19.400IDP01845 hypothetical protein STM0017 [Salmonella typhimurium LT2] STM0017 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  8......................................................................................................................................SNCIYNEGKYELRTNSQVIKMTAMRAKCLSFIIENAHEIIERQKITTALWGSRHYVNDANLTQILYLIRRDLK-ALGINDLFITIPRQGLKVNSD. 105
58 -18.800IDP91337 EAL domain-containing protein [Vibrio vulnificus CMCP6] VV2_0138 [Vibrio vulnificus CMCP6]  ali follow..  14  397ICALVIDECSVSSSALTKQLQRASSQVLIARNLDQAVKTLRDYPVNLVVVDIFMSDATNYTLLTDIDQRFSGRMILLTEQSNPDIVLLPELTARSTILSKGSALFDTVQEILAHSKLEKTDFSAQQNKLDQLSERELAV---AQMLFKGLGNKQIANQLDINQKTVSTYKTRVQTKLGIKSAM............................................... 579
59 -18.000IDP04163 sensory box sensor histidine kinase/response regulator [Vibrio cholerae O1 biovar eltor str. N16961] VC1349 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  19  992QSLLLVEDNEVNQEVALGLLQDTGLNVVVANHGQEALERLEHADFDLVLMDMQMPVMDGITATEHIRANHSLPIVAMTANAMAIDIERCLQAGMNDHLSKPIEVDKFYQVLRHFLQVSDEQSFSSHSPNKPSASKPAMVDLEQAIFRIGGNQQRYF----EILRHFIDSQVDELNSTRVAHTLKGSAANLGLEALAQLAAEMEQSLEQQVLP.................. 1226
60 -12.100IDP04409 putative hybrid two-component system regulatory protein [Yersinia pestis CO92] YPO3965 [Yersinia pestis CO92]  ali follow..  24  739.LVLVLEDEPDVRQTLCEQLHQLGYLTLETGDSRQALALMADVDISIVISDLMLPGMTGAEVLQQARSVYHLKLLLISGQDLRRSKNFMPEV---ELLRKPFNQQQLVQALQRV.................................................................................................................... 851
61 -11.600IDP95483 gene: vieA; response regulator VieA [Vibrio cholerae O1 str. 2010EL-1786] YP_004937306 [Vibrio cholerae O1 str. 2010EL-1786]  ali follow..  12  419WQILLVDNHMLSATALQKVLNKEESKVFVAQDIEQTLHKLRDLPINLLVVESFLSTISPAAFHELLEPYRGALLVLHDGLTAEAQED-----EPKAIVVKANTLMETSSRISNVRPQAQQEELAQLSERELTVAKMLVEGLTNKEIALQLDINQKTVSTYKTRIMTKLGIKSAMELVRFVT................................................. 604
62 -11.600IDP95482 response regulator VieA [Vibrio cholerae O1 biovar El Tor str. N16961] NP_231289 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  397WQILLVDNHMLSATALQKVLNKEESKVFVAQDIEQTLHKLRDLPINLLVVESFLSTISPAAFHELLEPYYRGALLVLHDGLTAEAQE----DEPKAIVVKANTLMETSSRISNVRPQAQQEELAQLSERELTVAKMLVEGLTNKEIALQLDINQKTVSTYKTRIMTKLGIKSAMELVRFVT................................................. 582

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.