current user: public |
|
Query: gi|238922435|ref|YP_002935948.1| hypothetical protein (EUBREC_0003) [Eubacterium rectale ATCC 33656], from E.rectale |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 | |||||||
# | Score | Template | Links and tools | %id | First | MKQISIREQDEFIKLGQALKKADLVSSGVEAKIVIQDGQVTVNGETELQRGKKLHDGDVFSYDGETVKVVK | Last |
1 | -3.390 | PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184] | ali follow.. | 20 | 157 | .......................LYSGTNNAMVTVDPNFLTMNGTLLPYSDSNVFQG.............. | 194 |
2 | -3.190 | PB008806 Q5L9W8_BACFN/1-127 PB008806; Pfam-B_8806; | ali follow.. | 3 | 2 | .........NNMYILVKIPSFISY--GNLQTATMIIGTPLSIAESYVHKNMGEILQQTMSITQ........ | 53 |
3 | -2.190 | HGC00552 gi|162599220|dbj|BAAV01006262.1|2.0 TMP00636; | ali follow.. | 2 | 17 | ............LAITCLMATTAFAAGTGDVAGAVESTWSTASTQIKSVVDNVVFP............... | 60 |
4 | -1.790 | PB007486 gi|154484254|ref|ZP_02026702.1| hypothetical protein EUBVEN_01966 [Eubacterium ventriosum ATCC 27560]gi|149734731|gb|EDM50648.1| hypothetical protein EUBVEN_01966 [Eubacterium ventriosum ATCC 27560] | ali follow.. | 20 | 24 | ..SREERIMDADNEIENIINQKEIVTT---DGVVTRENQITVNGTINYN...................... | 67 |
5 | -1.750 | PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361; | ali follow.. | 9 | 392 | ....KIDIEDITLDVTGGGYAAAIGTNVKWYTN--KCNSITIKNSVITACSGKGAAAGSIVIENSTIYA.. | 472 |
6 | -1.480 | PB053138 Q73Q90_TREDE/1-298 PB053138; Pfam-B_53138; | ali follow.. | 11 | 241 | ..............................LSYIYDNDNPIEDGNTI........................ | 257 |
7 | -1.330 | PB019827 gi|67919427|ref|ZP_00513005.1| conserved hypothetical protein [Chlorobium limicola DSM 245]gi|67782966|gb|EAM42367.1| conserved hypothetical protein [Chlorobium limicola DSM 245] | ali follow.. | 13 | 243 | .............DVTKNLKLGKFETTWYDDREVYGDSTDQRNTSAPGT...................... | 279 |
8 | -1.220 | PB002589 gi|91201099|emb|CAJ74158.1| hypothetical protein [Candidatus Kuenenia stuttgartiensis] | ali follow.. | 17 | 7 | ..........RCIWFGQHIEKKNLRTDDGLRLEILSPGEFFLEGKGLIRGSVEIH................ | 64 |
9 | -1.190 | PB033130 gi|160880323|ref|YP_001559291.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]gi|160428989|gb|ABX42552.1| transglutaminase domain protein [Clostridium phytofermentans ISDg] | ali follow.. | 8 | 4 | ....GAKVSLEILNYAEFASVTELTDEKGCVSITIGLGDIHIRAVKDGFFAEAMRTQEEITL......... | 65 |
10 | -1.020 | PB037276 Q24TM0_DESHY/1-190 PB037276; Pfam-B_37276; | ali follow.. | 15 | 58 | ..FQSIAPVKKFLQIDYCIEGCYEVEYQNGTVSFLGEGDLCV............................. | 97 |
FFAS is supported by the NIH grant R01-GM087218-01
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02. |