current user: public
If you have questions about the server, please let us know.

Query: gi|238922440|ref|YP_002935953.1| hypothetical protein (EUBREC_0008) [Eubacterium rectale ATCC 33656], from E.rectale

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst MLYVFPFFSPDSFIFTVFLFFQHNITCNNYSFLITLHISLFHYSCNNLast
1 -1.850PB009534 gi|153852721|ref|ZP_01994158.1| hypothetical protein DORLON_00140 [Dorea longicatena DSM 13814]gi|149754363|gb|EDM64294.1| hypothetical protein DORLON_00140 [Dorea longicatena DSM 13814]  ali follow..  13  162................ILTFFNHFGKKRLSVDPTPMEVEMRLYEND. 191
2 -1.760PB062605 Q9F6T7_BACTN/1-105 PB062605; Pfam-B_62605;  ali follow..  10  49MLAAFAVLALYTFGRAAYDIGRNDGSRMETGHAGRVELPTPAETDNH 95
3 -1.680HGC01215 gi|162843249|dbj|BABA01001460.1|3.0 TMP01713;  ali follow..  25  4.VFCVEGFSVDVFIVHIREIC.......................... 23
4 -1.520PB002794 gi|86143885|ref|ZP_01062253.1| hypothetical protein MED217_03525 [Flavobacterium sp. MED217]gi|85829592|gb|EAQ48055.1| hypothetical protein MED217_03525 [Leeuwenhoekiella blandensis MED217]  ali follow..  23  27VVEEFPFFQAARALHLKGLKNEDSFLYNTYLKKTAAHTQLFDF.... 73
5 -1.370PB012991 Q2RHT0_MOOTA/1-175 PB012991; Pfam-B_12991;  ali follow..  26  20.................FLLFYCNFLKGVFLLRIAV........... 38
6 -1.090HGC00485 gi|163636056|dbj|BABG01000217.1|3.0 TMP00523;  ali follow..  11  2......IMNPNILNKNPLMFFDRAVNAQRSQLLTVMADAV....... 35
7 -1.020PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  16  9..........EKISYTINMDTQKKHNLSGTIILVSCFLLLA--ACDN 44
8 -0.936PB007011 gi|160888195|ref|ZP_02069198.1| hypothetical protein BACUNI_00603 [Bacteroides uniformis ATCC 8492]gi|156862330|gb|EDO55761.1| hypothetical protein BACUNI_00603 [Bacteroides uniformis ATCC 8492]  ali follow..  38  137.......................NIAFSSRSFEYYL---LLHFE... 154
9 -0.578PB002104 Q72PH8_LEPIC/1-220 PB002104; Pfam-B_2104;  ali follow..  16  80YFPFSILYF-DLILFNLIEFWSGN....................... 107
10 -0.564HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  18  57........NYQKEAYKNYVFEKHHITEAEFD-------SMVWYTRH. 88
FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 8 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.