FFAS03 results for 238922440

Query: gi|238922440|ref|YP_002935953.1| hypothetical protein (EUBREC_0008) [Eubacterium rectale ATCC 33656], from E.rectale

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.

						`. 10 . 20 . 30 . 40 .`
#	Score	Template	Links and tools	%id	First	`MLYVFPFFSPDSFIFTVFLFFQHNITCNNYSFLITLHISLFHYSCNN`	Last
1	-4.490	`[KT] COG3835 Sugar diacid utilization regulator`	`ali follow..`	16	315	`..........GQLVKTLKGLFAANGNLNLCAQQLFIHRNTLRYRLEK`	351
2	-4.180	`[S] COG1547 Uncharacterized conserved protein`	`ali follow..`	14	19	`......YFECHEVLEERWKQDPPGRRKPHWVALIQIAVGLYHERRGN`	59
3	-4.110	`[UR] KOG4677 Golgi integral membrane protein`	`ali follow..`	21	508	`..........DSTAFKLLSMLRGHPSARLFFYFIIMHLWLFF.....`	541
4	-3.830	`[S] COG5134 Uncharacterized conserved protein`	`ali follow..`	22	4	`..YIPPEGPNAKRRNVIRFEMPFPVWCNNCENIITTKIWSFSLKCHL`	70
5	-3.740	`[T] KOG3979 FGF receptor activating protein 1`	`ali follow..`	13	172	`...........TIFPLIYWYIQHKFKHIPGAYTV---YAFFEWS...`	201
6	-3.730	`[R] COG0705 Uncharacterized membrane protein (homolog of Drosophila rhomboid)`	`ali follow..`	17	106	`LVYIAMSLIGDQTVMVWLAWPFDPVLKFEVWRYFTMHFSLMHILFN.`	154
7	-3.710	`[S] KOG2969 Uncharacterized conserved protein`	`ali follow..`	37	3	`.................YAAFQHNVS----GFLVNAKQTDFN--CLN`	26
8	-3.710	`[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger`	`ali follow..`	25	194	`.......FPCELEIFTQNQLRNHQTKCSGKRFYLYIHMRNQHEKCH.`	250
9	-3.710	`[S] KOG2885 Uncharacterized conserved protein`	`ali follow..`	18	5	`....................LEERLRANSSAFLLALIPAKYYYDEKS`	33
10	-3.690	`[O] KOG3488 Dolichol phosphate-mannose regulatory protein (DPM2)`	`ali follow..`	38	27	`.VIILPFVDSDHFIHKYFL............................`	44

FFAS is supported by the NIH grant R01-GM087218-01

jobs submitted since Jan 1, 2011

Comments and questions to: webmaster