current user: public

If you have questions about the server, please let us know.

Query: gi|238922441|ref|YP_002935954.1| fumarate hydratase subunit B (EUBREC_0009) [Eubacterium rectale ATCC 33656], from E.rectale

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MEKHITTPITQKITKDLRSGDYVYITGEMYVARDAAHKRMIEALDRKEELPIDIKDSTIYYMGPSPARDGRPIGSAGPTTATRMDKYAPRLLDLGEKAMIGKGKRSKEVIDAVIRNKAVYFAAVGGAGALLSKCIKSSEVICYDDLGAEAIRKIYVEDFPVIVVIDSEGNNLYETSIKEFKKILast
1 -86.300[C] COG1838 Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain  ali follow..  37  8VRVDLNRPMKEAQLSQYPVSTRLSLNGTIIVGRDIAHAKLKERMDNGEGLPQYIKDHPIYYAGPAKTPEGYASGSLGPTTAGRMDSYVDQLQALGSMIMLAKGNRSQQVTDACKKHGGFYLGSIGGPAAVLAQGIKSLECVEYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQIQLTQCT. 193
2 -6.010[O] COG0826 Collagenase and related proteases  ali follow..  16  8.VPELLSPAGKNMRYAFAYGDAVYAGQPRYSLRVRNNEFNHENLQIGINEAHALGKKFYVVCNIQPHNSKLK----------TFIRDLKPVIDMGPDALIGLIMMVREEFPHMPIHLSVQANAVNWATVKFWASQGVERVIVSRELSLEEIEEIREKCPNTEIEVFVHGA............. 173
3 -5.890[C] COG2414 Aldehyde:ferredoxin oxidoreductase  ali follow..  16  7....LRIDLSTEKISEEVYKEDIV---KFLGGRGLGAYLALKELPRGID-PLSPSNKLYIFAGPNLATSRINVVGKSPLTESYTHSFAYWLRRTGYDGIIVEGKAEEPVYILVKDGE----VSIRPAKHIWGKWTGAATRALLKDAGFEP------ERKAGVMTIGPAGENL........... 172
4 -5.340[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  9.....RMRYRLAAMAGMPEGKLILLNGGSSAGKTSLALAFQDLAAE-----MHIGIDLFWFALPPEQLDL-HPGPILDLAMHSRYRAIRAYLDNGMNVIADTREWLVDALRVFEGCRVWMVGVHVSDEEGARRELER-RHPGWNRGSARAAHADAEYD----FELDTTATPVHELARELHESY 207
5 -5.300[E] COG0083 Homoserine kinase  ali follow..  13  1MSVVVYAPASIGNVSVVSPIDGTLLGDRVKVEAGAEAFTLKTAGRFVDKLPANPQENIVYDCWQVFARELEKKSVVLKPLTMTLEKNMP----------IGSG--------------------LGSSACSIVAALDALNQFHASPLDETELLALMGE-MEGKISGSIHYDNV........... 149
6 -5.140[O] COG2143 Thioredoxin-related protein  ali follow..  20  102.........................................................................................................VKELRDYIKEHFSAYYVNISYSKEHDFKVGDKNNEKEIKMSTEELAQIYAVQSTPTIVLSDKTGKTIYE......... 170
7 -5.030[R] COG0714 MoxR-like ATPases  ali follow..  23  1...................................................................................MREQISVLTQNLSQTIVGKDEAIRLVLVALLSGGHALLEDVPGVGTLLAKSLARSINGKFQ----------RVQCTPDLLPTDITGTNIWNPSSREFE.. 89
8 -5.010[G] COG0279 Phosphoheptose isomerase  ali follow..  19  35....................................................................................VLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVS-NDFGYDYIFSRYVEAVDVLLGISTSGNS............ 124
9 -4.970[S] COG2840 Uncharacterized protein conserved in bacteria  ali follow..  15  54....................DILPLNEPLEFRREGLQQGVIDKLRSGK---YPQQASLNLL------------RQPVETCRKMLFRFILEAQKEGLRNVLGKGREAKSHANIVRSYVARWLTE-GGGGACY.................................................... 165
10 -4.970[R] KOG3920 Uncharacterized conserved protein, contains PA domain  ali follow..  12.....................VLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCS--------LSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADI---PALFLLGRDGYMIRRSLEQH.... 159

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.