current user: public

If you have questions about the server, please let us know.

Query: gi|238922451|ref|YP_002935964.1| hypothetical protein (EUBREC_0025) [Eubacterium rectale ATCC 33656], from E.rectale

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# Score Template Links and tools%idFirst MEETGKAGKKSNIEINADKGAKQNSHPGREEWPHLIRIGVMVFVTFAVSILFFFALYRFEGFAGIWSKLLAAAMPIIMGLVLAYLMNPVMLWLERCFKKLLSKKMKSESKLRKVSRALAITGSVIILVAIISLLIAAIVPSVIASISGLMKTLPNDVAAFINMIKNGNFGDSKIAELASTGLQNATDYIENYATEKLIPEAQKYVAQITTGVISIVRGLFNFIIGIIVMVYVMSIQETLAGQSKKIIYAVCKPKTGNIIIETIRKTNEIFGGFISGKIIDSLIIGVIAYFGCLILRIPSSVLVAVIIGVTNVIPVFGPFIGAIPSLLIVVIQSPWHALYLLIFIVVLQQVDGNIIGPKILGSSTGLSTFWVMFAILIGGGMFGFLGMLLGVPTFAVIYYIVKRVVNYALRKKKLPEDTRDYTKTTGVDTKNNKLKYELast
1 -54.600[R] COG0628 Predicted permease  ali follow..  16  13...................................................LVAMLAMLVVIMAGIKAASPIVVPFLLAIFLAIVLNPLVKLLERI----------------KIPRTLAVILLVTIIILLMVLLF----GRLGSSLNEFARSLPQYRGMMLEKMRDLQEFALH------------FNIEFSVDDIMKYVDPSMAMNFVTRLLSHLSGAMTSTFLLLMTVVFMLFEVERMPYKVQLMF------DNPEKGNAILKRALNGVTHYLVIKTIISIATGIVIWLFLAAMGVRFAFLWGLLAFVLNYIPNIGSVLAAIPPIIQALLFGFADAFAVTGGYILINLIGGNIIDPRMMGRGLGLSTLVVFLSLIFWGWLLGPVGMLLSVPLTIIAKIVLELTPAGYRFAVLLSDGKPAKVEEEQ........... 350
2 -20.000[S] KOG2365 Uncharacterized membrane protein  ali follow..  11  600....................................................................................................................................................................................EVAESLWHIIRTNMSMIMGVTGEILSLVLSGGQACIEFILDMIVFFTALFYLLSSSQEKYAPLQITKYLGYSSSGIK----IADALENSITVVLVSMFRCSTFTGLFTWLVHTVFGARIVFLPSALAAMLAAAPFLGSYWCAVPAFLELWLAQD--RFYAGLILFLLQFFVPSSFETAIYADLKGGHPYLNGLAIAGGMYWIGWQGAIFGPLMLCFFIGLFEVATLAMRSHQEPRNSTDEERTT............. 837
3 -8.810[S] COG3216 Uncharacterized protein conserved in bacteria  ali follow..  14  47.........................................................................................................................................................................................................................................................................................................PTAVAAGVAAGVASFFPLGSHFAIAAIVCWLISGNMVAAGLGTFVFVVGATWETGKIMRPAHLSEMLQTLSISQLWAPVLKPMLCGPLGLVFGLLFYGITRCGMTAFREKRRKRLAEKGSLLQQQEDIVLSPPLPTRHRR 206
4 -7.620[S] COG3859 Predicted membrane protein  ali follow..  18  20.....................................................................................................................................................................................................................................................................................................LTEIAFMAALAFIISLIPNTVYGWIIVACIPILILSFRRGLTAGLVGGLIWGILSM---------ITGHAYILTLSQAFLEYLIAPVSLGIAGLF................................................. 107
5 -7.580[R] KOG1347 Uncharacterized membrane protein, predicted efflux pump  ali follow..  16  53.................................................................SKLLFNLAAPAVIVYMINYLMSMSTQIF-ETLCGQAYGGRKYEMLGVYLQRSTVLLTLTGLLLTLIYVFSEPIL-LFLGESPAIASAASLFVYGLIPQI-AANFPIQKFLQSQSIVAPSAYISTATLFVHLLLSWLAVYKLGMGLLGASLVLSLSWWIIVVAQFVYIVTSERQAFSGLWSFFKLSAASAVMLCLETWYFQILVLLAGLLENPELALDSLSICMTISGWVFMISVGFNAAISVRVSNEL---GNPKSAAFSVIIVNIYSLITCVILAIVILACRDVLSYAFGKEVSDAVSDLCPLLAVTLVLIGIPLFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVV.... 504
6 -7.280[P] KOG4505 Na+/H+ antiporter  ali follow..  12  13.......................................LAYAIIGGFTSLFMLCSLIIKEKLFLGEATMATATGLIFGPYVAKLFVPITEELARVLLVVEVFAAGAELPRAYMLRHWRSMFVMLLPVMIFGWLVSTGFMYALIPRLSFLESL--AIAACITATDPVLASSIVGKGKFARRVPGHLRNMLLAESGCNDGMAIPFLYLAIYLIIECIIILYECTFGCVLGAII----------ARKMIKFSERRGLMDRESFLVFYFVLALFCGGIGTIIGVDDLLVSFCAGAAF---HVSNVIDLLLNLSFFV-YVGAIMPWPQFHMPHMDLSVWRLVVLAICILIARRIPAVLLFKSFVPDIINWRE--ALFAGHFGPI--GVGALYTCLVARA.......................................... 383
7 -7.210[G] KOG4686 Predicted sugar transporter  ali follow..  10  10VDNEEVSRPTEEDQVVSRAGRRDNELSLPSGGCCMPSSTSHRFMALVFMCLLGFGSYFCYDAPGALQNYFK-LTSAQFTLIYSSWPNVVLCFVGGFLIDRLFG-----------IRLGTIIYMMILLVGQLIFACGGILDAFW--LGRFIFGIGA-----ESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGSTVNFWVMQPIYEYVSNFYKGHTALGVVLLLATLTCVMSMTCALILGWMDKRAERILQRNNNPAGQIPVFSFKPPFWMVSIICVAYYVAIFPFIALGQNFFVDRFGL-ANTVDSLVYLIPVFGFIILTTIGAHALLTFTQLTPYVGMIIMGLLWPLVALIIPEYQLGTAYGFCQSIQNLGLAVITIVAGII-FFMGWLTIALISTGVIWAYNNKNRGNLNMTPQQRAQFVSAENYQNFE.... 478
8 -6.920[J] COG5593 Nucleic-acid-binding protein possibly involved in ribosomal biogenesis  ali follow..  62LETRGLLLLKEDSERFSETLGHGTADKRMLQTLISSGTTSDRISALTLLVQ----IHAVKALETLLSICSKKSRNEATQAITT-LKDLFIGGLLPDRKLKYMKQQSCLGSKNVTDKHLMVWA--------FESFLKSFYFKYIQIIEALSFDLLFVKSQMVSTIYDLLKAKPEQEQNLLKLLINKLGDKENKIASKASYSILQLEASHPAMKLVITKEIERFILITLNQTVLTHKQVDVANLLIEIYFVFFTKLLFALEKEEVADAPTLEKKSLQSDSKNK--KKDEDLRKEAEENVNSRVISAVLTGVNRAYPFAEVNSEKFDKHMNTLFASFNTSVQVLMLIFQAKSLYESLLDPRLTTSSKQSLYLNLLYKVRAFIKRMVQVSAWQQPPLVTGLFHVMHQLVIATTALRSMFTNAEIHDFDGDEEEVFKDVEED 532
9 -6.920[S] KOG3140 Predicted membrane protein  ali follow..  12  53.....................................................................................................................................................................................................................SLLILVSIFLSAAFVMFLVYKNFPQLSEEERVNMKVPRD-------MDDAKALGKVLSKYKDTFYVQVLVAYFATYIFLQTFAIPGSIFLSILSGFL-FLVCLCSGLGASFCYMLSYLVGREHLINYIIFLRITPFLPNWFINVFFIGTFLGVAP--SFVAIKAGTTLYQLTTALMILAVLSILPAIFQKKLKQKFE........................... 291
10 -6.660[S] COG5604 Uncharacterized conserved protein  ali follow..  11  152AAETDAMAKEIDENERLKSSSGKIVLTSDTIQQWQKLLETNHSLTTLQKVVQAFKAAAFLNEEEAEDLKYTISDSKVFNDLLLLAIQYVPKVLNYHVPIQEDAKGKKFINTDSKVLPKLRPVLKSYGFSILRLLEGMTDAKNISLLLREAQNVLPYMITYRKFLKQFTQATVEVWSSTRDDLRTLCLTADITLLEFVLKEVYLGMARQSAYTTVHTLDKINFLKNSAVNLFLLDAESCYIRQLAITLRNTIHQPSKDSRKPVQS-------SYVHSLDFWARLLSQAAWLSRELQSLVYP-LVQIALGVIMSSPSS-PMRFHIIRSLIYLSRHTGVFIPLAPSLFVELRASSSYLRTKVYQDGL-IDQLLELLSEYYVLYATDISFPELVIPAIVRSKRFAKRSKNAKLNRGLLTLVNRLEQQSKFMTEKRNQQK.. 624

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.