current user: public

If you have questions about the server, please let us know.

Query: gi|15644654|ref|NP_206823.1| lipid A 1-phosphatase (HP0021) [Helicobacter pylori 26695], from H.pylori

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MKKFLFKQKFCESLPKSFSKTLLALSLGLILLGIFAPFPKVPKQPSVPLMFHFTEHYARFIPTILSVAIPLIQRDAVGLFQVANASIATTLLTHTTKRALNHVTINDQRLGERPYGGNFNMPSGHSSMVGLAVAFLMRRYSFKKYFWLLPLVPLTMLARIYLDMHTIGAVLTGLGVGMLCVSLFTSPKKPLast
1 -48.900sp|Q8IY26|PPAC2_HUMAN Presqualene diphosphate phosphatase OS=Homo sapiens GN=PPAPDC2 PE=1 SV=3  ali follow..  16  113.............................LSKKLGVCAGESSSWGSVRPLMKLLEISGHGIPWLLGTLYCLCWAGREVLMNLLFALLLDLLLVALIKGLVRRRRPAHNQMDMF-SVDKYSFPSGHATRAALMSRFILNHLAIPLRVLVVLWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWL. 280
2 -47.600sp|Q8NBV4|PPAC3_HUMAN Probable lipid phosphate phosphatase PPAPDC3 OS=Homo sapiens GN=PPAPDC3 PE=2 SV=1  ali follow..  14  92.............................MSKRLGVCAGRAASWASARSMVKLIGITGHGIPWIGGTILCLVLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPSLLLTMDIYAFPAGHASRAAMVSKFFLSHLAVPLRVLLVLWALCVGLSRVMIGRHHVTDVLSGFVIGYLQFRLVELVWMP 260
3 -41.000sp|Q86YN1|DOPP1_HUMAN Dolichyldiphosphatase 1 OS=Homo sapiens GN=DOLPP1 PE=1 SV=1  ali follow..  17  41............................................................VFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAV--GTKYGMPSSHSQFMWFFSVYSDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWFIFTQ. 184
4 -38.900sp|Q9BX95|SGPP1_HUMAN Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens GN=SGPP1 PE=1 SV=2  ali follow..  16  116..................................EEGQLARVSNWPLYCLFCFGTELGNELFYILFFPFWIWNLDPLVGRRLVVIWVLVMYLGQCTKDIIRWPRPASVVKLEVFYNSEYSMPSTHAMSGTAIPISMVLLTYGRWQILIPCWCSLVCLSRIYMGMHSILDIIAGFLYTILILAVFYPFVD. 279
5 -38.900sp|Q5VZY2|PPC1A_HUMAN(removed signalp:1-21) Phosphatidate phosphatase PPAPDC1A OS=Homo sapiens GN=PPAPDC1A PE=1 SV=2  ali follow..  16  36........................................................ISFLTPLAVICVVKIIRRTDEAFLAVSLALALNGVCTNTIKLIVGRPRPD-TGDPDLVSEGRKSFPSIHSSFAFSGLGFTTKSWRLCAAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYP 206
6 -38.600sp|Q8IWX5|SGPP2_HUMAN Sphingosine-1-phosphate phosphatase 2 OS=Homo sapiens GN=SGPP2 PE=2 SV=1  ali follow..  16  73.................................EAYVQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRRLIIIWVLVMYIGQVAKDVLKWPRPSSVVKLEKRLIAEYGMPSTHAMAATAIAFTLLISTMDRYQVMAVVFSTLVCLSRLYTGMHTVLDVLGGVLITALLIVLTYPAWT. 237
7 -37.900sp|Q8NEB5|PPC1B_HUMAN(removed signalp:1-27) Phosphatidate phosphatase PPAPDC1B OS=Homo sapiens GN=PPAPDC1B PE=1 SV=2  ali follow..  21  61............................................................................QACLAASLALALNGVFTNTIKLIVGRPRPD-TGDKDVVNEGRKSFPSGHSSFAFAGLAFASKSWRFCAFLSPLLFAAVIALSRTCDYKHHWQDVLVGSMIGMTFAYVCYRQYYP 206
8 -37.600sp|Q7Z2D5|LPPR4_HUMAN Lipid phosphate phosphatase-related protein type 4 OS=Homo sapiens GN=LPPR4 PE=1 SV=1  ali   13  32.................................................................................HVFGLCSTALITDIIQLSTGYQAPYSGSDLTVINSGRKSFPSQHATLAAFAAVYVSKLLKPLLVFTFIICGIICGLTRITQYKNHPVDVYCGFLIGGGIALYLGLYAVG 178
9 -37.500sp|O14495|LPP3_HUMAN Lipid phosphate phosphohydrolase 3 OS=Homo sapiens GN=PPAP2B PE=1 SV=1  ali follow..  16  128............................................................................KQVGCFLFGCAISQSFTDIAKVSIGRLRPH-RGDDSKVQEARKSFFSGHASFSMYTMLYLVRLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSD 276
10 -37.300sp|O43688|LPP2_HUMAN(removed signalp:1-30) Lipid phosphate phosphohydrolase 2 OS=Homo sapiens GN=PPAP2C PE=1 SV=1  ali follow..  21  72.................................................................................FLFGAAVSQSLTDLAKYMIGRLRPN-RGNPADVTEARLSFYSGHSSFGMYCMVFLARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISD 215
11 -36.900sp|O14494|LPP1_HUMAN(removed signalp:1-27) Lipid phosphate phosphohydrolase 1 OS=Homo sapiens GN=PPAP2A PE=1 SV=1  ali follow..  24  78.................................................................................FLFGAAASQSLTDIAKYSIGRLRPH-RGNAERVKEGRLSFYSGHSSFSMYCMLFVARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSD 221
12 -35.900sp|Q6T4P5|LPPR3_HUMAN Lipid phosphate phosphatase-related protein type 3 OS=Homo sapiens GN=LPPR3 PE=2 SV=1  ali   14  137.................................................................................HVFGLCATALVTDVIQLATGYHTPFSGHDIHAILSARKTFPSQHATLSAFAAVYVSKLLKPILVFAFAIAAGVCGLTQITQYRSHPVDVYAGFLIGAGIAAYLACHAVG 283
13 -35.600sp|Q32ZL2|LPPR5_HUMAN(removed signalp:1-27) Lipid phosphate phosphatase-related protein type 5 OS=Homo sapiens GN=LPPR5 PE=2 SV=2  ali follow..  13  18CHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPH-TGNPDLIMRARKTFPSKEAALSVYAAMYLTRLAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVN 245
14 -35.300sp|Q8TBJ4|LPPR1_HUMAN(removed signalp:1-31) Lipid phosphate phosphatase-related protein type 1 OS=Homo sapiens GN=LPPR1 PE=2 SV=1  ali follow..  12  19CQDGDLMKPYPGTEEESFITPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPY-TGDLEVIEKARRSFPSKHAALSIYSALYATRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVH 246
15 -35.300sp|Q96GM1|LPPR2_HUMAN(removed signalp:1-41) Lipid phosphate phosphatase-related protein type 2 OS=Homo sapiens GN=LPPR2 PE=2 SV=1  ali follow..  13  92.................................................................................YSFGLFTTTIFANAGQVVTGNPTPH-AGSPSLVAAARRAFPCKDAALCAYAVTYTARLVKPSLCLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVH 245
16 -34.900sp|Q6T4P5|LPPR3_HUMAN Lipid phosphate phosphatase-related protein type 3 OS=Homo sapiens GN=LPPR3 PE=2 SV=1  ali   12  1...............................................................................................IQLATGYHTPFSGHDIHAILSARKTFPSQHATLSAFAAVYVSKLLKPILVFAFAIAAGVCGLTQITQYRSHPVDVYAGFLIGAGIAAYLACHAVG 133
17 -34.400sp|P35575|G6PC_HUMAN Glucose-6-phosphatase OS=Homo sapiens GN=G6PC PE=1 SV=2  ali follow..  13  20........................................QVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHS. 200
18 -34.200sp|Q9NQR9|G6PC2_HUMAN Glucose-6-phosphatase 2 OS=Homo sapiens GN=G6PC2 PE=1 SV=1  ali follow..  11  16........................................QKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWVAVIGDWLNLIFKWILFGHRPYWWVQETQTCETGPGSPSGHAMGASCVWYVMVTAALSHTVSVFWLIQISVCISRVFIATHFPHQVILGVIGGMLVAEAFEHTPG. 198
19 -34.100sp|Q9BUM1|G6PC3_HUMAN Glucose-6-phosphatase 3 OS=Homo sapiens GN=G6PC3 PE=1 SV=2  ali follow..  17  16........................................QNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWISLITEWLNLIFKWFLFGDRPFWWVHESGYCETGPGSPSGHCMITGAALWPIMTALSSQVALAYCTFLLAVGLSRIFILAHFPHQVLAGLITGAVLGWLMTPRVP. 191
20 -22.600sp|Q7Z2D5|LPPR4_HUMAN Lipid phosphate phosphatase-related protein type 4 OS=Homo sapiens GN=LPPR4 PE=1 SV=1  ali   13  182.................................................................................HVFGLCSTALITDIIQLSTGYQAPYSGSDLTVINSGRKSFPSQHATLAAFAAVYVSMYFNSTLTFTFIICGIICGLTRI-------TQ..................... 300
21 -15.900sp|Q8NHU3|SMS2_HUMAN Phosphatidylcholine:ceramide cholinephosphotransferase 2 OS=Homo sapiens GN=SGMS2 PE=1 SV=1  ali follow..  12  78................KTGIAFIYAVFNLVLTTVMITVVHERVPPKELKWAFSVSEINGIILVGLWITQWLFLRYKSIVGRRFCFIIGTLYLYRCITMYVTTLPV-LSITGSHILCGDFLF-SGHTVTLTLTYLFIKEYSPRHYHLICWLLSAAGIICILVAHEHYTIDVIIAYYITTRLFWWYHSMAN. 296
22 -13.800sp|Q86VZ5|SMS1_HUMAN Phosphatidylcholine:ceramide cholinephosphotransferase 1 OS=Homo sapiens GN=SGMS1 PE=1 SV=2  ali follow..  12  192.....................................................ICEINGMILVGLWLIQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTTL-PV-SITGSHNMCGDYLY-SGHTVMLTLTYLFIKEYSPRRYHWICWLLSVVGIFCILLAHDHYTVDVV----VAYYITTRLFWWYH. 354
23 -13.700sp|Q96LT4|SAMD8_HUMAN Sphingomyelin synthase-related protein 1 OS=Homo sapiens GN=SAMD8 PE=2 SV=2  ali follow..  10  203.....................................................MTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWESGHTVVLTMLNFFVTEYTPRSLHTLSWVLNLFGIFFILAAHEHYSIDVF----IAFYITTRLFLYYH. 364
24 -9.410sp|Q8N6M3|FITM2_HUMAN Fat storage-inducing transmembrane protein 2 OS=Homo sapiens GN=FITM2 PE=2 SV=1  ali follow..  19  153..........................................................................................................................SGHSFLLTFCALMIVEELHTAITTLVVALGILTFITAVY---HNLSQKVFGTLFGLLSWYGTYGFWYP 239
25 -9.260sp|A5D6W6|FITM1_HUMAN(removed signalp:1-34) Fat storage-inducing transmembrane protein 1 OS=Homo sapiens GN=FITM1 PE=1 SV=1  ali follow..  20  150..........................................................................................................................SSHTFLLTFCCLLMAEEAGAPLRLVFLLNVLLLGLTVIY---HQYTHKVVGAAVGTFAWYLTYG.... 231

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]