current user: public

If you have questions about the server, please let us know.

Query: sp|P59091|CU093_HUMAN Uncharacterized protein C21orf93 OS=Homo sapiens GN=C21orf93 PE=5 SV=1, from H.sapiens

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MDSLTERCRPQPLAALGPADAQLHGPAAAGGGVGPRVMLSSLCREHPWQGRCPPIPAHGKEVRQLRHLHRTRPPDTHQDMARGPGLPHTHGLPARPSHVRHQTEPVQVASRWHVPSDGLCRPCHVHQLLHPPLVPALGALast
1 -6.500[S] COG5423 Predicted metal-binding protein  ali follow..  12  1MPRKYKDLVEKASEM--GLKAYFLKAEDIPVEDRIALKCAYGCRSYGKRLSCPPHVISIGEFRKVIREYSYDTSGCKDVLEAWRKLRKSSFHKMFELEQEAFREGFIFAHLLRPGSCNECEVCNLEKCVKPFAPEAVGI 149
2 -6.230[J] KOG1749 40S ribosomal protein S23  ali follow..  17  13......................................................LKTHRQEQRWNDKRYKKAHIGTRWKSNPFGGASHAKGIAKQPNSAIRKCVRVQLIKN-FVPNDGCLNFVEENDEVLVSGFGRSGH 110
3 -6.060[R] COG5063 CCCH-type Zn-finger protein  ali follow..  13  172....TELCESKGSCPYGSKCQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCP---KHGDDNDIAVYVKAGTYCNVSSTSKQSDEKRSNGRGSAKKKNLNVKVKALQRMT-W........................... 285
4 -5.970[T] KOG1094 Discoidin domain receptor DDR1  ali follow..  18  27....PAICR----YPLG-PDEDITASSQWSESTAAK---GRLDSEEGDGAWCPEIPVEPDDLKELHTLHFITLVGTQGRHAGGHGIEFAP---------MYKINYSRDGTRWQVLDGNSNPYDIFLKDLEPPIVAR... 162
5 -5.960[G] COG0837 Glucokinase  ali follow..  18  108....IPVLPAQDVLQFGGTQPQPGKPVAVYGGLGVAHLVNVDRRWISLAGHVDFAPNSEEEDQILAVLRQELGHVSAERVLSGPGLVNLYRIVISDARLPEKLAPKDITARALADSCTDC................... 230
6 -5.760[C] COG3043 Nitrate reductase cytochrome c-type subunit  ali follow..  22  71....................................................PPMIPHSVEGYQVTTNTNRCLQCHGVESYRTTGAPRIS--------PTHFMDSDGKVGAEVAPRRYFCLQCHVPQADTAPIVG.... 145
7 -5.690[T] COG2062 Phosphohistidine phosphatase SixA  ali follow..  14  24..........RPLDEEGIASLMRLARSMKETGLFPDRVVLSASRTCETAFGLIERLGIDVETIIDETIYSGGPGQYMQSIRQHGDTGHNPSIEDLALALCSDGEPESIHRL-GFPTAALA................... 141
8 -5.580[S] COG0779 Uncharacterized protein conserved in bacteria  ali follow..  22  1.....................................MGLSTLEQKLTEMITAPVEALGFELVGIEFIRGRTS-RIYIDSEDGINVDDCADVSHQVSAVLDVEDPITVAYNLEVSSPGLDRP................. 86
9 -5.520[O] KOG1873 Ubiquitin-specific protease  ali follow..  13  233LVNLGNTCKENGSGVGGPL-TETKPEAGLKSVINPRAFFGSFCSKAPQ---------RGYDQHDSHELLRCLLDSLSTEESA------LRKKRGVSDNDEKSTTLIESVFGGETSSIVSCMECGHSSKVYEPFL..... 379
10 -5.400[R] COG1078 HD superfamily phosphohydrolases  ali follow..  18  9..........................DPIHGFIKLTEEEVKLIDGEPLIQRL-------RYIKQLGFVYLVYPTATHTRFDHSLGVMHIATLLG--QRIMQLLGEVDEELLRHLRAAALL-----HDIGHLPFSHSF.. 105

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.