current user: public

If you have questions about the server, please let us know.

Query: sp|Q5VV42|CDKAL_HUMAN CDK5 regulatory subunit-associated protein 1-like 1 OS=Homo sapiens GN=CDKAL1 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .
# Score Template Links and tools%idFirst MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGITIATDIICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPGTPAAKMEQVPAQVKKQRTKDLSRVFHSYSPYDHKIGERQQVLVTEESFDSKFYVAHNQFYEQVLVPKNPAFMGKMVEVDIYESGKHFMKGQPVSDAKVYTPSISKPLAKGEVSGLTKDFRNGLGNQLSSGSHTSAASQCDSASSRMVLPMPRLHQDCALRMSVGLALLGLLFAFFVKVYNLast
1 -144.000[R] KOG4355 Predicted Fe-S oxidoreductase  ali follow..  99  1MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISISTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGITIATDIICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPGTPAAKMEQVPAQVKKQRTKDLSRVFHSYSPYDHKIGERQQVLVTEESFDSKFYVAHNQFYEQVLVPKNPAFMGKMVEVDIYESGKHFMKGQPVSDAKVYTPSISKPLAKGEVSGLTKDFRNGLGNQLSSGSHTSAASQCDSASSRMVLPMPRLHQDCALRMSVGLALLGLLFAFFVKVYN 579
2 -105.000[T] KOG2492 CDK5 activator-binding protein  ali follow..  22  47...............................KESTKKQRQKAIIPSIEDTKEYLNPEDLQGNGRTVCYVTYGCQMNVSDMEIVRSIMTKYGFVESDKKENADIVLLMTCSIRDGAEKKVWNQLKLIRSNSVIVGVLGCMAERVRHDLLNLVNIVAGPDSYRDLPRLVAVAAGGSNGINVQLSLDETYA----DVQPIRVDSASKTAFISIMRGCDNMCTYCVVPFTRGRERSRPIESIVEEVQRLRDQGYKQVTLLGQNVNSYRDMTGLTFTTLLEKV-ADAAPDIRFRFTSPHPKDFPMQLIEL--IASRPNLCKQLHLPAQSGDDETLERMERGYTRDLYLRLVDDIRHVLPSVSLTSDFIAGFCGETEQAHQNTLSLIRAVRYSFCFVFPYSMRGKTRAHHRDDVPEDVKARRHLDLTTVFREEALKQALIGSEQTVLLEGKSKRDSFSHGRIDGGVKAVFDNSKLCLGQYAKILITDANSQTLKAQLIGQSSI.................................................................................. 547
3 -97.400[J] COG0621 2-methylthioadenine synthetase  ali follow..  26  1..............................................................MKKVFIRTFGCQMNEYDSDKMLAVLEHGGIEQVTQADEADIILFNTCSVREKAQEKVFSDLGRVRPLKEKIGVAGCVASQEGENIAPYVDVVFGPQTLHRLPKMIVDKETSGLSQVDISFPEIEK-----FDHLPPARVEGGAAFVSIMEGCSKYCSFCVVPYTRGEEFSRPLNDVLTEIANLAQQGVKEINLLGQNVNAYRGEMICDFATLLRIV-HEIPGIERMRFTTSHPREFTDSIIEC--YRDLPKLVSHLHLPIQSGSDRVLSAMKRGYTALEYKSIIRKLRAIRPDLCLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSPRPGTPAANLDDTPHEEKVRRLEALNEVIEAETARQTMVGTVQRCLVEGISKKDDQLQARTANNRVVNFTGTPDMINQMIDLEITEAYTFSLRGKVVE...................................................................................... 441
4 -71.600[C] COG1031 Uncharacterized Fe-S oxidoreductase  ali follow..  14  13......................................................PAAFGVPPYVSPYVRYLAGALVVHDVEVDYVTIDKMRKESLWENEYDFLFVFGGITVPGRYKGGTPLTLSELQRRRPIKIVGGPIVGGYSLRFDIQADYLVSGDMEAFVVSYFQGVPDPEAKSDYELIDAVAPYGAVVLEKHPNF--PHVICEIEVSRGCETFCSFCTEPLLHGRLKSRDVQAILKEIESLYRAGCRAFRFRAANILAFGSDRGKPSPEILEELYSGTPHLEVLHTDNANPSYLVTYEKEVETIVRYNTPGDVFSFGVESFDENVLKKNNVQGSPEEFLKAIAVVNEGIPKLLPGVNLIFGLPGETEETLKKNYSYLKRILLRRINIRKLLAYPGTPVYEYKNKKHRIKSYLHDQWKRRIREEIDREKRVFPAGTVLKKVEYREGKTSFGRQLGSYPILVGIPGN-HSGVLDVVVVSHGERSVTALPYPSFINSMSLEELTAIPGIGSALARK.............................................................. 516
5 -34.700[C] COG1032 Fe-S oxidoreductase  ali follow..  15  52................................................................IVKYAPYAIRK-------IEASLVRAFGRDSVVVVDEDLFGGDLDAWVRREWDSLMEKVNKAREGKKAKLIVG-FTILRDEIDKYKVDYYVQGETDDVVAELFRQVAEDNIDKQMFFNGYMSYDENFHKVDIPEIINPSMKGMVEVMRGCGVGCDFCEVTLRP--LRYMPLNMIVDEIKINVAGGVDNAWLHSDEIFGYKHGHFFEPEEALSELFSTVMSVPGVKTGRISIPAGYPEMMEKLSLKAGPRNWIGIQTGLETGSEELAKKHMPNKTLDIVWQGVFVETRN--YWRSAFTIQVGQEGETPEDLWETIALINKLSNSRPFEFTVTPLVNVPLGRIKSKKLNTSMLDVNGLAVYYASYRHLAKMA................................................................................................................................................. 491
6 -34.100[R] COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif  ali follow..  13  25...............................................................................................................................................................................................................ILLTNFCIYDCAYCINRSSSNVERARTAEEVVWLTLEFYRRNYIEGLFLSSGIIRSSDHTMEEMVRVAREL-RVTHGFRGYIHLKSIPEASPRLIEEAGLYA--DRLSINIELPTDSGVSRFAPEKQPANIRRSMADIRLKIEERFAPAGQSTQMIVGADGADDSTILSTSRLYGSYGLRRVYYSAFSPIPDSSKNLPLIKPPLMREHRLYQADWLYRFYGFDIGEIIGGDGMLDLDIDPKLAWALKQRDRFPVDVNVADREMFGTKTVASILSSRRFRRLR.......................................................................................... 325
7 -22.600[S] COG1856 Uncharacterized homolog of biotin synthetase  ali follow..  15  56.......................................................................................................................................................................................................SPPKFVDISVTGRNCELMCDHCASKILWHMIPATTPEELVKVGEDLKKKGIEGVLISG-GSDKNGFVPLWDFFDAMKYLKEELGFLLTCHVGL-----VDEDYVEKLKEAN----VDAVLLDIIGDNETIAQVYKPHKSVEDYDRSLRLLKEA--GLRIVPHVIIGLHYGKIKGEYNAIDMIAKYEPDALVLVVVMPYYGKAKFQLLPPPSSEESAQVILYARK............................................................................................................................................................ 268
8 -18.600[R] COG1242 Predicted Fe-S oxidoreductase  ali follow..  17  36...............................................................................................................................................................................................................LDGGFDCPNRCTFCSAAGSGDGNRALDLKVQFQQVRDKMQTKWKDGKCIAYFQAFTNTHAPVAELREKFETVLNEPGVVGLSIAT-RPDCLPDDVVEYLAELNERTYLW-LELGLQSAHDETGRLINRAHDYDCYLEGVRKLQKH--NIRICTHIINGLPKETPEMMMETAQKVVESGVDGIKIHLLHLLKGTPMVELEILPPEMVIHRITGDGGVDDLIGPVWSLNKFEVLNAIDAELVRRDSWQGK............................................................................................................................ 311
9 -18.100[H] COG0320 Lipoate synthase  ali follow..  13  82..........................................................................................................................................................................................................HGTATFMILGACTRRCPFCDV--AHGRPVTPDANEPEKLAQTIQDMGLRYVVITSVDRDDLRDGGAQHFADCISAIRAKNPTIKIETLVP----DFRGRMDRALDILTATPPDVFNH--LEN-VPRVYRQVRPGANYDWSLKLLERFKEAHPDIPTKSGLMVGL-GETNAEIVEVMHDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSP----AEFDEMKAEAMAMGF---------THAACGPFVRSSYHADL............................................................................................................................ 313
10 -17.800[R] COG2516 Biotin synthase-related enzyme  ali follow..  18  31...............................................................................................................................................................................................................TYYEGRCINDCKFCAQARSSRANLEMPAFELETVLKNFSKGNFKRICLQTIDYPNMLSD----VFSLLEEL-SKLNVPISLSITPVPRSELEE----------STLGVDYIGVGLDAASERVYKDVKSRYSWDDMWKFFDDVLSVFGKGRAVVHLIVGL-GETDKEIVETIGEVYKKG-GIVSLFAFTPIKGTQMENFSPPPLE-RYRKIQVAHYLIKT......................................................................................................................................................... 239
11 -16.700[KB] COG1243 Histone acetyltransferase  ali follow..  16  3.................................................................................................................................................................................................VIRKPTRMLSGVTIVSIPHSCHGKCVFCPGGVDVDTPQSYPFHQVQSRLRQYVENGHTELIIMGGTFLSLPIDYQDWFVTYALEAMNAEVRCVGMTIET-KPDWAKEWHADQMLRLGATKV----ELGVQTVYDDILKFTNRGHTVKDSIESTRILKDS--GFKVVYHVMLGLPKSDPDKDLEAFKTIPNFRPDMLKIYPTLVVETAPRGLYKPYGTETLIELISEMYRYIPK......................................................................................................................................................... 283
12 -15.700[BK] KOG2535 RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase  ali follow..  15  107.....................................................................................................................................................................................................................TGNICVYCPGGPDSDFEYS-PFLQTRHRVEQLKQLGHSEFIVMGGTFMCLPEEYRDYFIRNLHDALSGHSSANVAE--ETRPDYCLKRHISDMLSYGCTRL----EIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDA--GYKIVTHMMPDLPNVDFERDIEQFIEYPAFRSDGLKIYPTLVIRGTGLYELGRYKSYPPSMLVDLVAKILALVP....................................................................................................................................................... 359
13 -15.100[H] COG0635 Coproporphyrinogen III oxidase and related Fe-S oxidoreductases  ali follow..  16  1...................................................................................................................................................................................................MNINRLPPLSLYIHI---CVQKCPYCSHAQKGHIPEQDYIAHLLQDLHQDRQRSLHSIFIGGGTPSLFSAE---GIHTLLSGVAQCLPFQPDIEITLANPGTAEAERFKGYVQAGVTR----ISMGIQSFNDDKLVRLGRIHNAQEAKSAVGFAKLS----SFNLDLMHGLPNQTLEEALSDLQQAIALEPPHLSWYQLTIEPNTMYRPPVLPDDDALWDIFEQGHQLLTEAGYVQYETSA............................................................................................................................................... 246
14 -15.000[H] KOG2672 Lipoate synthase  ali follow..  17  119..........................................................................................................................................................................................................RATATIMLMGDCTRGCRFCSVKTSR-RPGPLDPNEPENTAEAIKQWNLGYIVLTSVDRDDLTDLGANHIAKTIQKIKEKAPH---ILVEALTPDFSGRM--DLVEIVAKSGLDVFAH--VETVEELTPFVRDRRATYRQSLSVLKHVKKTCPHLITKTSIMLGL-GETDAEILTTLKDLLEHNVDVVTFGQYMRPTKRHLKVQEYVHPKKFEYWKEVAEKLGFLYVASGPLV................................................................................................................................................. 343
15 -14.700[R] COG1244 Predicted Fe-S oxidoreductase  ali follow..  10  12.......................................................................................................................................................................................................EPGKVLYVILPTIGCGKPCYMC--SYPAQAPKKTSQERILSHFLEAVHKDRFSIRIFTSGSFFDSAEVRRDTRIRIFREISKLDNVYEVVVET-RSEIIREDWVRELAEMVEDKWFE-VAIGLESANDDIADVINKGSTFNDFVRASEIIHNA--GAKVKTYLLLKPIFLSERDIEDVKFSIEKAEPDTFSINLTNIQKGTLYESLWQ-RGEYRTPWLWSVVEVLRWAK....................................................................................................................................................... 247
16 -13.400[HR] COG1060 Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes  ali follow..  12  1...............................................................................................................................................................MNSRSTAEITDYLNEKITKKDALELFSLPIHAVGRIADEIRKVKCDTNINYTNICLSKCRFCAF-YAREKGYVLSHEEILRKVGYAVKMGATQIMLQGGMNPDLGLE---WFEELFRKIKARFSSVHIHSLSPPEIVFLAKLE-EVLDRLKAAGLDSLPGGGAEILVDSVRRKI-NKCSSDEWLRVMETAHSL--NMPTTATMMFGH-VESDGDIVEHLIKIRELQEKTGGFTAFIPWTFQPGNT----ELYAEIKRPVSPLRYLQVLAISRIVLNNFRNIQASWLTQG-------FEIATLSLFFGANDFGGTMLEENVVRATGKDFRPAKIEEIVKAVKAVGRPVALRDT.................................................................... 347
17 -13.300[H] KOG2900 Biotin synthase  ali follow..  15  1.........................................................................................................................................................MFTRTIRQQIRRSSALSLVRNNWTREEIQKIYDTPLIDLIFRAASIHRKFQCTLLSIKTGCTEDCKYCAQSSRYNTGVKAKIDEVLEKAKIAKAKGSTRFCMGS------AWRDLNGRNRTFKNILEIIKEVRSMDMEVCVTLGMLNE--QQAKELKDAGLTAYNH---LDTSREYYSKIISTRTYDERLNTIDNLRKA--GLKVCSGGILGLGEKKHDRVGLIHSLTMPTHPESVPFNLLVPIPGTPVG--DAVKERLPIHPFLRSIATARICMPKTIIRFAAGRNTCSESEQALAFMAGAN........................................................................................................................... 302
18 -13.100[H] COG0502 Biotin synthase and related enzymes  ali follow..  16  7..................................................................................................................................................................QINSITPHPSVEYWSVCKVEALFETPFLELVYRATQVHRKHLSTLMSIKTGCPEDCSYCPQSARYHTGVQNDVDEIVAKAKIAKARGAGRFCMGAAWRGPKPKD--------IEKVTEIIKAVKSLGLTCGTFGLLQDGMAEDLKEAGLDYYNHNLDT-----APEHYAEVIGTRRFDDRLSTLGKVRKA--GLKVCCGGIVGM-NETRKERAGLIASLANLQPESVPINQLVKVEGTPLADAEELDW----TEFVRTIAVARITMPKSYVRLSAGRSGMTEEMQAMCFMAGANS.......................................................................................................................... 296
19 -11.900[R] COG2100 Predicted Fe-S oxidoreductase  ali follow..  14  119...............................................................................................................................................................................................................VRGSTGCNMRCIFCSVDEGPYSRTRKYLLKWFDWVAKEKGKGLEAHLDAQGE-------LYPFIVELVQAL-REHPHVSVISM-QSNGVLLNDKLVEELAEAGLDRV----NLSIHSLDPEKAKMLIKDYDLNHVLEMAEALVNAGIDVLIAPVIMFGV---NDDEAEAFIEFARRKRWPALGFQNYIPKFGRNPVIAKPVPFKEFYRWLRELEEKTGMKPLILK-RGEVVKAEVILPGRIEGEMIAKARNRLIQVINSNAK-VGDRIKVKIVRTRHGIYVGTPV....................................................................................... 419
20 -10.800[R] COG1964 Predicted Fe-S oxidoreductases  ali follow..  12  1...........................................................................................MQNVESELKDIRLPYKTKSLCPECLKILEAEV--YEENGKVMIRKVCEEHGEFVDVYWG-----DAEMFKKAARFAADGHGISTPITQNTTCPFSCGL------CNNHKSHTALLNIVLTNRCDLACWYCFFYARRAGYVYEPIREMVRKAKNMKPIGCNAVQLTGGE-------LRDDLIDIIRMIKEE--GYDHIQLNTN------------IRLAEDPDFALRV---RVAGVNTVVDEKTNPKNHHEIPKILENCRRAQLGLVLVPTVIKGV---NDHQLGDIIRFAAE-NIDIVRGVNFQP-----VSLVGSMPRKEREQFRITIPDCIKAIEEQTN................................................................................................................................................... 308
21 -10.800[R] COG5014 Predicted Fe-S oxidoreductase  ali follow..  79...............................................................................................................................................................................................................TADTVGCKFLCAYCRNLRPKRAGDFLSPEEVAERLLEISKKKCDLFRISGAE-------LGRRSAEHVRKVIELVNNTFILETNGLMFGFDPSLVDLFVNLNV------LIRVSVKGWDEESFEKITGA-SGEYFRYQLKALEHLHGKVHFWVAVVYDLFREKGKELEKRLPIPCRIEKEYLEMYP.......................................................................................................................................................................................... 258
22 -10.600[R] COG1313 Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins  ali follow..  11  2.................................................................................GAEEALPKY-FAILKREEEPNFMLARNVKVRFRGDEDLDGLWVIHDEGLDKLKENDLTENPERNLLDLKAKIADKILERCTLCEIKCRVNRKKSPGYCRVKESLVASDFLHYGEEPELVPSYTVFFS----GCNFRCVFCISQFRIGVEYL--PEYMAIKIEKAFQLGARNVNFVG----------GEPTPNLPFILETLRYVRVPIPIVWNSNMYMSEEAMKLLD-----GVVDIYLGDFKYGNDRCAMKYSKVPRYWEVVTRNFLLAKEHFRAEFLIRHLVM-PNHLDCCTKPILRWIAENLGREIRVNVMFQRPEYKAIEYDEIARTLTLDEMREAEKITKKLGFKNALVG................................................................................................................................................ 337
23 -10.500[R] COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme  ali follow..  10  34........................................................................................................................................................................................................VRGEKLVLFVTGVCPRNCFYCPLSPWRRKDVVYANERPVRSEKDIIEEDARGAGITG------GDPLLSRTVEYIRLLKEEFGKKFHIHL-YTTGILASEEALEKLYDAGLDEI---FHPDLFQPNSKFFERE---------IENMKKAFDFGWDVGGEVPAV-----GFEDRIKWFASLLDKLGAKFLNINELEF-SETNLRALLDRGYKPVSDESSAIKGSLEMGLKVLEWGEKNTSLNY......................................................................................................................................... 258
24 -10.300[H] COG2896 Molybdenum cofactor biosynthesis enzyme  ali follow..  14  29...............................................................................................................................................................................................................VSVTDRCDFRCTYCMAEHMTPKKDLLTLEELDRLCSVFIEKGVRKLRLTGGE-------VRKNIMHLIGNLHLKSGALDELTL-TTNGSQLARFAGELADCG-----VRRINVSLDTLNPEKFRTITRWGDLSRVLEGIDAAQKAGIHVKINAVALKDF---NDAEIPELIRWAHGRGMDVTLI--------------ETMPMGEIEFDRTDQYLPLSQVRADLASQFTLADIPYRTGGPARYVTISETGGRLGFITPMTYNFCESCNRVRLTC.................................................................................................. 278
25 -10.200[H] KOG2876 Molybdenum cofactor biosynthesis pathway protein  ali follow..  13  74...............................................................................................................................................................................................................ISLTEKCNLRCQYCMPE-LTPKANLLTTEEILTLARLFVKEGIDKIRLTGGE-------IRPDVVDIVAQL-QRLEGLRTIGV-TTNGINLARLLPQLQKA------LSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELYNPVKVNCVVMRGL---NEDELLDFAALTEGLPLDVRFI-EYMPFDGNKWNFKKMVSYKEMLDTVRQQWPELEKVPEEESSTAKAFKI........................................................................................................................................... 294
26 -9.940[R] COG0535 Predicted Fe-S oxidoreductases  ali follow..  12  1...................................................................................................................................................................................................MVAFLRGPTHVDFNLTNGCNLACSHCHSASGPKLDNELKTEEILQTIDALHIIGALKIAFAG------GEPF---IRRDIFNILSHACSLPGWGISVITNGFYLNS--LTVEKLKAQCPNLSINISVDGSTPAGYSTLRKQLNRPDFERVLSGID-NVVRSGMSNSVNFTITKATLHDIEATYELVDRIGADNMVAIKFFPGYGKEHLDLYEIPYDMWDEHFVALTRAKLGGKLERLQISWGYRSPLREDMYARMREVGDVAGISELCISSD----GEVYPSVLLVGEKTMSCGNLREHS.................................................................................... 316
27 -9.660[L] COG1533 DNA repair photolyase  ali follow..  12  69...............................................................................................................................................................................................................INPYRGCEHGCVYCFARPTHAFMGLSPGLDAKPDAARLLDKELSKTIAIGTNTDPY-----EKQYRIMREILEVLEARGHPVGIVTKSALVTRDIDILSRMAERGLA--KVALSVTTLDRMLARTMERASTPTKRLEAIRQLSDA----GIPTSVMVAIPGLTDQEMERILDSAYAAGAREAGYVVLRLPLEVSPIFKDWLLRHYPDRHVMSLIRSMRDGKDYDSEWGKRMKG........................................................................................................................................... 310
28 -9.200[E] COG1509 Lysine 2,3-aminomutase  ali follow..  112......................................................................................................................................................................................................VHRYKDKVLLLATDRCPVYCRFCTVLKKKVSPFQSRWDTILAYLRV--TPVIADVVVSGGDCFRLKPS---RLLAIGMGL-LSIPSIRRIRFATVLPMKITSDHKWTDALVNISDAGRDQGVEIS-----FHTHFNHPREIDYTIAAAELLFKRGIRMRNQSVLMAGV-NDDPEVMKQLVKKLSDLHIQPYYVYTCDLVDGIEHMRCSVRLACQIEKAVRGITAGYNTPLFVVDTPGGGGKRDVHSFEHYNT................................................................................................................................. 367
29 -9.160[R] COG0820 Predicted Fe-S-cluster redox enzyme  ali follow..  11  43.........................................................................................................................................................CDDFDQMNNINKQLREKLKAKCEIRAPYVSEAQHSADGTIKWAMRVGDQDVETVVSSQVGCALECKFCST--QQGFNRNLRVSEIIGQVWRAARRPITNVVMMGMGEPLLNMKNLIPALEIMLDDLGFGLSKRRVTVSTSGVVSGLEQMIGQIDV----ALAISLHAPNDKLRSEIMP-INDRWNIEAFLEVVRRYIASSNAVTVEYVLLDHV-NDGTEHAHELAELLKGTP--KINLIPFNPYPGSPYKKPSNHTVTIRKTRGDDIDAACGQLVGDVI................................................................................................................................................... 352

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.