current user: public

If you have questions about the server, please let us know.

Query: sp|Q8WWM9|CYGB_HUMAN Cytoglobin OS=Homo sapiens GN=CYGB PE=1 SV=1, from H.sapiens

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGPLast
1 -49.600[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  15  2..................LDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNM-----------SNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHT-SFQIKPEQYNIVGTHLLATLDEMFN--PGQEVLDAWGKAYGVLANVFIHREAEIYHENASK.............. 145
2 -29.200[C] KOG3378 Globins and related hemoproteins  ali follow..  17  242.DLNNPDAKIKMRQEMDRITERQKHIFTETFPVIFKEYKRNGLVLFAKYFSEFPHYKNIWPQFRTLQD-SALLASNELANHCSVYMSGLKV................................................................................................... 330
3 -6.940[R] COG2346 Truncated hemoglobins  ali follow..  1MHSPPRKAIRTAGSKEATMSSETVTLYEAI----DATVRALTRRFYELM-DTLPEAARCRAI-----------HPADLSGSEAKFYDYLTGYLGGPPVYVE-----PMLRRRHF-VAPIGPAERDEWLLCFRRAMDET---IENAKLREIIWAPVERLAFHMQNQEAD...................... 149
4 -6.450[I] KOG3006 Transthyretin and related proteins  ali follow..  24..................STSGPLTSQEAIYTARDIWFNQVNVTDWLEAFSAHPQIGN-----TPSPSINSDFARRSVSEQSTAFATTSASALQEL----------AEWNVLYKKKFG-----FIFIHAEMLHALKERYENRPIVELEIAAMEQMKITELRMAKLFSDKAKVISETDSSSSPVSTKPQDR 182
5 -6.250[S] KOG4654 Uncharacterized conserved protein  ali follow..  2.....TSRKRSGSGSTKRPKEKVVYIYELLCR--GEDPSSESPEFWNEFFLLQPNFEALENEIGKLNNEQLQLVKPNLNTLFQRCIEMLDT-KRLCNSLHTLCSLFYGIFKKSNAEPTLN-EKMDEWLKLLMQYCNRILLGDVPENARFMCLKLLQVLVTGTDNVNQNA..................... 172
6 -6.160[T] KOG2085 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  305........................QQLSYCIVQFVEKDFKLADTVIRGLLKYWPVTEVMF--LGELEEVLEATQAAEFQRCMVPLFRQIARCLNS-SHFQVAERALFLWNNDHIRNL---TQNHKVIMPIVFPAMERNTRGHWNQAVQSLTLNVRKVMAETDQILFDECLAKFQEDEANETEVVAKREA. 468
7 -5.580[A] KOG2412 Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor  ali follow..  13  328..................LNFIAKAVVHQAETEVRVKPESA-GKLTLYLLVQFPELQELF----KRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRINNMESFPEMSP 538
8 -5.510[U] KOG2580 Mitochondrial import inner membrane translocase, subunit TIM44  ali follow..  10  61...............................................RFYSAPGRRAGFFSQFFD-NMKAEMDKNKEIKDNIRKFREEAQKLEES-DALKSARQKFNIVESEAQKSSSMLKEQLGAIKERVGDVLEDASKSHLAKKVTEELSKKARGVSDTISDTSGKLGQTSAFQAISNTTTTIKKE.. 199
9 -5.450[KT] COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain  ali follow..  13  196LLNQNDYLETEVLRRSGELDRMQDAVVFALASLAETRDPETGNHLYVKVLAQRLATTDKYRDVLSPTVIDTYFKAAPLRNHALLGKLALEKAEKLSGACTALINVAKEIAMGHHEKWGLKGDDIPLSARLMKAIILQGRGSHFDPMVIDAFLIEEQNFIDIAQKFADEESAMVPIQLGQQAS........ 440
10 -5.410[S] COG5592 Uncharacterized conserved protein  ali follow..  11  1............MTDLSELLMVEHSAIRILSRVVYGKESLEAFEDFNEYLVKD-EEKILFPVIVDFDWEDRKGFEQTVNKLIETLAENMLKWKRSGNDDLLRMPLFYKTLTDHNLS---EDQIFPRWKKLEAETRENALKEAMDI............................................. 142

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.