current user: public

If you have questions about the server, please let us know.

Query: sp|Q9NPG2|NGB_HUMAN Neuroglobin OS=Homo sapiens GN=NGB PE=1 SV=1, from H.sapiens

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGELast
1 -55.400[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  18  2LDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNM------------SNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGTHLLATLDEMFN--PGQEVLDAWGKAYGVLANVFIHREAE. 137
2 -24.100[C] KOG3378 Globins and related hemoproteins  ali follow..  16  259ITERQKHIFTETFPVIFKEYKRNGLVLFAKYFSEFPHYKNIWPQ---RTLQDSALLASNELANHCSVYMSGLKV............................................................................. 330
3 -9.550[R] COG2346 Truncated hemoglobins  ali follow..  33................DATVRALTRRFYELM-DTLPEAARCRA------------IHPADLSGSEAKFYDYLTGYLGGPPVYVE-----PMLRRRHFVAPIGPAERDEWLLCFRRAMDET---IENAKLREIIWAPVERLAFHMQNQEADN 150
4 -5.550[U] KOG3316 Transport protein particle (TRAPP) complex subunit  ali follow..  13  11....................................EIIRSTLESEKDRCEAKEKFGTIIDNLNGPADIEKYESLVQKAFLHANAETKLESIGFR-------------VGRQLVEKVSKESPKLVT--CKDFWSSVFGKQVDNLRTNHQGV 118
5 -5.210[A] KOG2412 Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor  ali follow..  10  328LNFIAKAVVHQAETEVRVKPESA-GKLTLYLLVQFPELQELFQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALS-CNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEK 510
6 -5.210[K] COG1733 Predicted transcriptional regulators  ali follow..  16  13..SMAAEVLCTRWTMVLMRELVAGSTRFNDLRRGVPKMSPTLLSQRLKELELAGIVERKEVPGEKGIFDYRLTEAGRDLRP---VVEAMGFWGQKWVESRLSLKNLDP--SLLMWDMRRNLNPSPLPEGRTV................... 137
7 -5.170[R] COG3324 Predicted enzyme related to lactoylglutathione lyase  ali follow..  11  13...........CWIDLTTSDVDRAQDFYGTVFESAGPDYGGYINAAKGGHPVAGLMANRPEFQSPDGWATYF-----HTVDIGATVAKLAAAGGS-----SCLDPMEVPGKGFMSLAVDPSGAAFGEAGSPVWHQLTTRDYRSVIDFYRQ. 159
8 -5.150[S] COG3945 Uncharacterized conserved protein  ali follow..  14  46...........................FVDNCHHVKEEKVLFDFLEHKGMVGGPIYVMVYEHNKLRDIINRIEARYNEFEELREDLNSLIVLLASHIDKE-NNVLFPTAESLLIYEKFERIEEEFGKERHERYIELIDTLYGRYINKKSNE 175
9 -5.020[S] COG3195 Uncharacterized protein conserved in bacteria  ali follow..  10  36........AGNVHSALCNAFRAASPAERLRVLRAHPDLAGKLAVAGELTADSKAEQASAGLDRLSPEEHSRFTGLNTTYTKKFGFPFIIAVKGLT--------------KEDILAAFERRIDNSKEEEFETACAEVERIARLRLRSMLPGD 164
10 -4.970[R] COG2316 Predicted hydrolase (HD superfamily)  ali follow..  10  12....................................................KTHVKTKNLVKHCLAAEAVMRALAREFNEKWGLAGLLHDLDYEHGLKTLEILKDEDVPEDVLNAILAHCEKKTPETLMEKALYAVDPTTGFIVA..... 116

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.