current user: public

If you have questions about the server, please let us know.

Query: sp|P07108|ACBP_HUMAN Acyl-CoA-binding protein OS=Homo sapiens GN=DBI PE=1 SV=2, from H.sapiens

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGILast
1 -13.000IDP04044 gene: fadB/acbP; fusion product of 3-hydroxacyl-CoA dehydrogenase and acyl-CoA-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1530 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  41  1MTEKKFEEMLIAVRDAT-KPDNSQKLKLYAFYKQVKEGDNNTKKPSALKMVERAKWMAWDAIKGMSKEDAMRGYLRVFGE....... 84
2 -6.780IDP00115 gene: VPA0551; hypothetical protein VPA0551 (gi 28900406) NT01VPA0514 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  13  17MNNDYYDSKNLTIALHPSEKPQRMLARIFCLN-EFTKGLSTTEEPDLWHVADDQSITHWIEIGEPEPDRIKK............... 94
3 -5.800IDP06033 ribosome biogenesis regulatory protein, putative [Toxoplasma gondii ME49] XP_002369902 [Toxoplasma gondii ME49]  ali follow..  11  50LTRQNAQSMVAQLCALPHETTDDGLLVALPPPAKNSTFKLPRMHP---AAKKLTRWEAFAKEKGIQKKRSRLVWDANTKDWVPRWG. 135
4 -5.580IDP90999 hypothetical protein y1744 [Yersinia pestis KIM 10] y1744 [Yersinia pestis KIM10+]  ali follow..  14  11AKTEFIEEVKAALHQIIEPSREEKGNLQYDLHT-------ESEQKGSFVFFE--RWASDEALEKHNKTEHFKQLVKAIDGKLESLEI 88
5 -5.150IDP93953 hypothetical protein YE0340 [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001004718 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  14  17CEPENRERVKELVLKFVEPARLETGCLYYDLYQ-------KIDEPDTFYII-----DGWVNQEAVTSHAENPHVAEVMSDLQP.... 87
6 -4.860IDP04231 gene: aroC; chorismate synthase [Clostridium perfringens ATCC 13124] CPF_0690 [Clostridium perfringens ATCC 13124]  ali follow..  17  40IEKDMERRAPGRNSLSTQRKEGDKPEILSGIFNGITTGA-DVMRPGHADFPGYIRYNGFNDYRGGGHFSGRITAPALAKEILKEKDI 150
7 -4.850IDP90161 Chorismate synthase (5-enolpyruvylshikimate-3-phosphate phospholyase) CD1835 [Peptoclostridium difficile 630]  ali follow..  18  40IDKEMKRRAPGKNSISTSRNESDIPEILSGYFNGRTTGT-NLMRPGHADFTGNVRYSGFNDYRGGGHFSGRITAPAICKQILSQKGI 150
8 -4.280IDP00080 gene: yneC; putative inner membrane protein NT01ST5073 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  23VHDDKVEQFIDVFRQNHLGSIKEPGNLRFDVLQ-------DPQVLTRFYI-----YEAYVDEQAVAFHKTTPHYKTCVEQLEP.... 93
9 -4.240IDP05341 gene: aroF; chorismate synthase [Listeria monocytogenes EGD-e] lmo1928 [Listeria monocytogenes EGD-e]  ali follow..  16  32VNKELKRRQGGHGRGARMRIEKDQVQITAGIRHGKTLGAVSRPRPGHADLVGGMKYGHNDMRNVLERSSARETTVAVAKKLLHELGI 155
10 -4.230IDP91569 gene: ECs1815; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB35238 [Escherichia coli O157:H7 str. Sakai]  ali follow..  12  38LSPELQDKLDVMVSIYSCARNNNELEEIFQELSAFVS-GLMDKRNSVFEVRNENTDEVVGALRAGMTIEDRDSYIRDLFFL...... 117

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.