current user: public

If you have questions about the server, please let us know.

Query: sp|P11766|ADHX_HUMAN Alcohol dehydrogenase class-3 OS=Homo sapiens GN=ADH5 PE=1 SV=4, from H.sapiens

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370
# Score Template Links and tools%idFirst MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVVKILast
1 -69.300IDP90877 oxidoreductase, zinc-binding dehydrogenase family [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1548c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  23  6LENNRIASKGYAMLSKDAKFTPFEFSRHAIGDNDILIKILYAGICHSDIHTARSEWGEATYPCVPGHEIAGEVIAVGKNVSKFKVGDYAVGCMVNSCGECDACKRSQEQFCENGKT----------IFTYNSCDVFHGNENTYGGYSNNIVVSEKFAVCVPKDAPMEKVAPLLCAGITTYSP-LKFSNIKEGSSVAVAGFGGLGMMAVKYAVKMGA-KVSVFARNENKKADALAMGVSSFYTSCDKNAV---------KERFDLIISTIPTPYNPAIYLDLLKFGGEM-AIVGLPPHEVAPSISVITHKAGKKVYGSLIGG---IAETQEMLDFSLKHGI---YPETELITPQEIDKAYENLTSGKAFRYVIDM 355
2 -58.000IDP04681 gene: adhB; alcohol dehydrogenase, zinc-containing [Bacillus anthracis str. `Ames Ancestor`] GBAA3131 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  24  1.......MKAVTYQGPNQ-VQVKQVDDAKEKKDDIIVKITSTAICGSDLHLYQGNMPLPQ-GYIIGHEPMGIVEEVGPDVTKVKKGDRVVIPFNVACGHCFYCQHEMESQCDNSNPHYDSGGYFGYTEKFGNHP---------GGQVEYLKVPNFTPFVIPESCELEDESLLFLSLPTAYWSV-INAGVKPGDTVIVLGCGPVGLMTQKFAWMHGAKRVIAVDYLDYRINYAKKINNVEVFEFTK-FPDMGEHLKEITHGGADVVIDCVGMDGPIQIATKAVRKYGTVQMTGVYGGNYNAFPLGAF-WVRNINLKM---GQAPVIHFMPELFEKITNKEFDPKEIITHKIPLEEASYGYQIFREDDCIKVILK. 376
3 -57.800IDP02503 gene: gutB; putative zinc-binding dehydrogenase [Yersinia pestis CO92] YPO2502 [Yersinia pestis CO92]  ali follow..  23  54MSQLPEKMSAVVCHGPQD-YRLEHVPTPVPKAKELVIKVKGCGICAGDCKCKNGETPWVKPPVVPGHEFYGHIVALGEGTSKYKLGERVIAEQIVPCWDCRYCNSGSYWMCETHNIYGFQKDVAEG------------------GMAEYMRFSENAIVKIPESLSHEDAVLMACAIH-----TVARGDIQLDDVVVLAGAGPLGLCMVPVARLKTPKKLIVIDTIEERLALAKAFGADVVINPLK-EDADKIVKSLTGGYGCDVYIEATGAPIGVTQGLQMIRKLGRF-VEFSVFGQETTVDWSIIGDRKELDIRGAH----LAPYSYEIATDLFERGLVTSKGIVTHSYSLDDWEKAFELADSTNSIKVILV. 407
4 -57.300IDP00931 gene: ybdR; putative dehydrogenase STM0615 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  24  1.......MKALTYHGPHH-VKVENVPDPGEQPDDIILRVTATAICGSDLHLYRGKIPQVKHGDIFGHEFMGEVVETGHDVKNIRKGDRVVIPFVIACGDCFFCRLQQYSACENTNDGHGAAMKKQIPPPAALFGYSHLYGGVPGGQAEYVRVPKGGPFKVPPLLSDDKALFLSDILPTAWQAA-KNAQIQQGFSVAVFGAGPVGLLTIACARLLGAEQIFVVDHHAWRLRFAEERYGAIPINFDDENDPAEKIIEQTAGHGVDAVIDAVGFEKALRQCIAAVRRGGVVSVP-GVYAGFIHGFLFGDAFDKGLTFKM---GQTHVHAWLGELLPLIEKGLLKPEEIVTHYMPFEEAARGYEIFREEECRKVILV. 387
5 -40.400IDP04685 alcohol dehydrogenase, zinc-containing [Bacillus anthracis str. `Ames Ancestor`] GBAA3438 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  22  1.......MKAQIIHSFGDSFQLEEVSKPKLLPGHVLIDVKATSVNPIDTKMRSGAVSAPEFPAILHGDVAGIVIEVGEGVSKFKCGDEVYGCAGGFKET--------------------------------------------GALAEFMLADARLIAHKPNNITMEEAAALPLVAITAWESLFDRANIKSGQNVLIHGTGGVGHVAIQLAKWAGA-NVFTTASQQNKMEIAHRLGADVAINYKEESSVQEYVQKHTNGNGFEVIFDTVGG-KNLDNSFEAAAVNGTVVTIAARSTHDLSPLHAKGLSLHVTFMALKILHTDKRNEILTKITKIVEEGKLR---LDSKSFTFDEVAQAHEYLESNKAIGKIVL. 331
6 -37.600IDP00076 gene: yhdH; putative oxidoreductase NT01ST4228 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  1.......MQALILEQQDGKASVQHLEESQLPAGDVTVDVHWSSLNYKDALAITGKGKIIRFPMIPGIDFAGTVHASE--DPRFHAGQEVLLT------------------------GWGVGENHWG------------------GLAERARVKGDWLVALPAGLSSRNAMIIGTAGFTAMLCVEDAGIRPQDGEVVVTGAGGVGSTAVALLHKLGY-QVAAVSGRESTHGYLKSLGANRILSRDE-----FAESRPLEKQLWAGAIDTVG-DKVLAKVLAQMNYGGCVAACGLAGGFALPTTVMPF-ILRNVRLQGVDSVMTPPARRAEAWARLVKDLPESFYAQAATEITLADAPKFADAIINNQVQRTLVKI 323
7 -8.700IDP92743 hypothetical protein lpp2747 [Legionella pneumophila str. Paris] YP_125052 [Legionella pneumophila str. Paris]  ali follow..  31.....................................................................................................................................................................................KFLAKISIHSNDYLLDAGCGD-GSFTQMLANLVPDGYVLGLDRSKTMIDYANKHCRSINVRFDIGDIQEPIIYGPFDNILSFWCLHWTDLEKSLSNLYHVLKPGGKICAIFSSGKQSTLFEV....................................................................... 151
8 -8.110IDP92740 hypothetical protein lpp2134 [Legionella pneumophila str. Paris] YP_124446 [Legionella pneumophila str. Paris]  ali follow..  21.....................................................................................................................................................................................VFLKTIHSKLSGNILDIGCGD-GHYTSLLAGKVKHGQVLGIDSSEQMIMHANQQWARTGLSFEVHNIEEFHQPQSFDLALSFWCLHWTNIHISFPNIFHLLKREGKLYAVMS................................................................................. 131
9 -7.800IDP95362 set237a-002 [Escherichia coli]  ali follow..  11  34..............................................................................................................................................................................GAEYTIDYWIKHGCINKKSHLLDLACS-TGFSSRECFKKEGA-SAEGIDISESAVMVANEKAKKLKANNLLKYYVADACDLPFEDNTFTHVLGIQNRLIALNETHRCLNHMGSMCIS................................................................................... 154
10 -7.690IDP95361 set237a-001 [Yersinia pseudotuberculosis PB1/+]  ali follow..  32..............................................................................................................................................................................GGMFTLDYWIEKSRINSNTYLLDLACS-TGFSARNIVHKTGC-SAEGIDISARSIESANQLAVQGNIAECVHFSVGNAESVSFTDNTFTHITAISDKPAALVEVQRVLKQDGFLCIS................................................................................... 152

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.