current user: public
If you have questions about the server, please let us know.

Query: sp|P56385|ATP5I_HUMAN ATP synthase subunit e, mitochondrial OS=Homo sapiens GN=ATP5I PE=1 SV=2, from H.sapiens

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILKLast
1 -4.870IDP05388 hypothetical protein BA_2383 [Bacillus anthracis str. Ames] BA_2383 [Bacillus anthracis str. Ames]  ali follow..  6  4..........LLFTKWTVVIS-IIFGTIFYVTNGKNNSEKATVETADTTTFKSKLQ............. 50
2 -4.700IDP90082 RecName: Full=Matrix protein 2; AltName: Full=BM2 P03493.2 [Influenza B virus (B/Lee/40)]  ali follow..  20  1MLEPLQISFILSALHFMAWTIGHLNQIKRGVNLK-RNPNKEAINREVSILRHNYQKEIQAKETMKKILS 75
3 -4.300IDP02715 gene: yhhL; hypothetical protein STM3573 [Salmonella typhimurium LT2] STM3573 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  5  72......................FLFGVFELLVWQKKFKNKK............................ 90
4 -4.200IDP00023 gene: papR; PapR BA_5594 [Bacillus anthracis str. Ames]  ali follow..  21  3...........KLLIGSLLTLAMAWGISLGDTALEKNQVISHNDQEVQLASD................. 43
5 -4.030IDP06042 hypothetical protein jhp0369 [Helicobacter pylori J99] NP_223088 [Helicobacter pylori J99]  ali follow..  11  1....MGINMCSKKIRNLILCFGFILSLCAEENITKENMTETNTTEENTPKDAPILLEEKRAQTLEL... 62
6 -3.960IDP00194 putative membrane protein YPO0983 [Yersinia pestis CO92]  ali follow..  8  124VFAPISEEIIFR---LAVVITSLLFALVHTQYLY................................... 170
7 -3.950IDP04701 putative type III secretion apparatus protein [Yersinia pestis CO92] YPO0270 [Yersinia pestis CO92]  ali follow..  25  183MVSPMTLSLPFKLL-WSLVLGQLVGSYL......................................... 216
8 -3.930IDP04354 gene: YPCD1.44; putative Yop secretion membrane protein [Yersinia pestis CO92] YPCD1.44 [Yersinia pestis CO92]  ali follow..  29  183MVSPMTISLPFKLL-WTRLTHGLVISY.......................................... 215
9 -3.910IDP05012 cell wall surface anchor family protein [Bacillus anthracis str. Ames] BA_5070 [Bacillus anthracis str. Ames]  ali follow..  14  114LPNTASNNVAMMALSACLVGIGTLFGLKRRNKVKA.................................. 148
10 -3.910IDP00750 gene: prfA; peptide chain release factor 1 SACOL2110 [Staphylococcus aureus subsp. aureus COL]  ali follow..  11  234.....HVNTTDSAVRITHLPTGVIATSSEKSQIQNREKAMKVLKARLYDMKVQEEQQKYASQRKSAV.. 295
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 9 4 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.