current user: public

If you have questions about the server, please let us know.

Query: sp|Q9NPG2|NGB_HUMAN Neuroglobin OS=Homo sapiens GN=NGB PE=1 SV=1, from H.sapiens

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGELast
1 -47.100IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  2LTQEHINIIKSTIPLLESAGPALTQHFYQRMFSHNPELKHIFNMTHQKTG------------RQSVALFEAIAAYAKHIDNLAALTSAVERIAHKHTSFNIQPEHYQIVGHHLLETLRELAPDAFTQPVEEAWTAAYFFLAQVFIDREGA. 139
2 -45.500IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  19  2LTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFNQTNQKRG------------MQSSALAQAVMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGKNLLKAIQDVTGLEENDPVIQAWAKAYGVIADVFIQIEKE. 139
3 -43.400IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  19  2LDTQTIAIVKSTIPLLAATGPKLTAHFYERMFKHHPELKNIFNMSNQSSG------------DQREALFNAICAYATNIENLAALLPTVERIAQKHTSLNIQPEHYPIVGEHLIATLDELFSP--GQAVLDAWAKAYGVLADVFIQRESQ. 137
4 -5.980IDP91562 gene: ECs0876; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB34299 [Escherichia coli O157:H7 str. Sakai]  ali follow..  543LKDKHYANLLTMLDLNDASESDKSKIFFC--------LSAVFANISHSNVFNGIPDASKTLKRYAFALLAKAHSLDESMISNQTFNTYKTVLLDFNNLSNEEANQLSSLYRDMVRYAQYRFSKVLSEWTPDAW.................. 669
5 -5.650IDP06380 gene: ORF46; ORF46 [Human herpesvirus 8] YP_001129398 [Human herpesvirus 8]  ali follow..  10  23....RDLLLAPKWISF--SLSSFLKQKLLSLLRVYPPQDKLMWWSHCCDPEDIKVVILGQDPYHKGQATGLAFSVDPQCQVPPSLRSIFRELEASVPNFSTPSDSWARQGVLLLNTVLTVEKGRAGSHEGLGWDWFTSFIISSISSKLEH. 181
6 -5.370IDP06391 gene: ORF31; ORF31 [Human herpesvirus 8] YP_001129384 [Human herpesvirus 8]  ali follow..  11  84..............................LACLKRDIVRYLQTWPDTTVIVQEIALGDGVTDTISAIIDTFGECLPVLGEAQGGYALVCSM---HVIVSIYSTK-TVYNSMLFKCTKNKKYDCIAKRVRTKWMRMLST............ 191
7 -5.220IDP01109 hypothetical protein GBAA_pXO1_0148 GBAA_pXO1_0148 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15....................................SQEKFISNWKKRILVHEHDPYKNEIIKNGTHLLHVFTMYMREEINLQDIEDISKKIAQERMDAKVNIADTNEGKKEILNTLFLLPTGQECKVVIEQINLFFDHLIYSTIYSYYK. 133
8 -4.980IDP90117 virokine protein [Monkeypox virus] MPXV_ZAI1979_005_027 [Monkeypox virus]  ali follow..  25..................................................................KKLILFDELVDDDDVCTLIKNMRMTLSDGPLLDRLNQPVNNVEDVKRMIAISAKVARDIGRRSEIRWEDSFTILFRMIEKYFDD. 108
9 -4.860IDP02284 gene: grpE; heat shock protein GrpE [Coxiella burnetii RSA 493] CBU_1293 [Coxiella burnetii RSA 493]  ali follow..  17  55............................GQLTRMERKVDEYKTQYLRAQAEMDNLRKRIEREKADIIKFGSKQLITDLLPVADSLIHGLESPASEDPQVKSMRDGMSLTLDLLHNTLAKNPGDPFDPALHEAMSVQ-DTIIQVLQKGY... 188
10 -4.740IDP01403 heat shock protein GrpE VC0854 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  52............................AALLVSEERVKEQQDSVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEVEAIKPLLEGVELTHKTFVDTIANPHGEVFNPEFHQAMSIQ-NTVMFVMQKGY... 184

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.