current user: public

If you have questions about the server, please let us know.

Query: sp|A6NJW9|CD8BL_HUMAN(removed signalp:1-18) Putative T-cell surface glycoprotein CD8 beta-2 chain OS=Homo sapiens GN=CD8BP PE=5 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst NSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMCIYWLRQRQAPSSDSHHEFLTLWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPVTLGLLVAGVLVLLVSLGVAMHLCCRRRRARLRFMKQLYKLast
1 -107.000sp|A6NJW9|CD8BL_HUMAN(removed signalp:1-18) Putative T-cell surface glycoprotein CD8 beta-2 chain OS=Homo sapiens GN=CD8BP PE=5 SV=2  ali  100  1NSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMCIYWLRQRQAPSSDSHHEFLTLWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPVTLGLLVAGVLVLLVSLGVAMHLCCRRRRARLRFMKQLYK 193
2 -102.000sp|P10966|CD8B_HUMAN(removed signalp:1-18) T-cell surface glycoprotein CD8 beta chain OS=Homo sapiens GN=CD8B PE=1 SV=1  ali follow..  93  1NSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQ-PTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK 192
3 -62.700sp|P01732|CD8A_HUMAN(removed signalp:1-21) T-cell surface glycoprotein CD8 alpha chain OS=Homo sapiens GN=CD8A PE=1 SV=1  ali follow..  18  1.SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTF---LLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVK 202
4 -60.200sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  23  1EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYG---------ASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTSPRTFGQGTKVEIK............................................................................ 108
5 -60.100sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  25  1EIVLTQSPGTLSLSPGERATLSCRASQSVSNSFLAWYQQKPGQAPRLLIYV---------ASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVELK............................................................................ 108
6 -60.100sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  25  1XIVLTXSPGTLSLSPGXRAALSCRASQSLSGNYLAWYQQKPGQAPRLLMYG---------VSSRATGIPDRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSSPFTFGQGSKLEIK............................................................................ 108
7 -59.900sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  24  1EIVMTQSPVTLSVSPGERATLSCRASQSISNSYLAWYQQKPSGSPRLLIYG---------ASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPTFGQGTRVEIK............................................................................ 108
8 -59.800sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  24  1EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIY---------GASSRATGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSSPWTFGQGTKVEIK............................................................................ 108
9 -59.800sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  24  1EIVLTQSPGTLSLSPGERATLSCRASQSVSNSYLAWYQQKPGQAPRLLIY---------GASSRATGIPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSSPQTFGQGSKVEIK............................................................................ 108
10 -59.500sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  23  1EIVLTQSPGTLSLSPGERATLSCRAALLSSRGYLAWYQQKPGQAPRLLMY---------GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPRSFGQGTKVEIK............................................................................ 108
11 -59.300sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  25  1EIVLTQSPGTLSLSPGERATLSCRASQSVSSGYLGWYQQKPGQAPRLLIY---------GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSLGRTFGQGTKVEIK............................................................................ 108
12 -58.700sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  20  1DIVMTQSPDSLAVSLGERATINCKSSQSVSKNYLAWYQQKPGQPPKLLIYW---------ASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYSFGQGTKLEIK............................................................................ 113
13 -58.400sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  18  1DIVMTQSPDSLAVSLGERATINCKSSQSINKNYLAWYQQKPGQPPKLLIYW---------ASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNLPWTFGQGTKVEIK............................................................................ 113
14 -58.200sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  21  1DIQMTQSPSSLSASVGDRVTITCRASQDITNY-VNWFQQRPGQAPKVLIYG---------ASILETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDTLPLTFGGGTKVDIK............................................................................ 107
15 -58.100sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  21  1DIQMTQSPSTLSASVGDRVTITCRASQS-INTWLAWYQQKPGKAPKLLMY---------KASSLESGVPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSDSKMFGQGTKVEVKG........................................................................... 108
16 -58.100sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  24  1EIVLTQSPGTLSLSPGESATLSCRASQSVSSN-LAWYQQKRGQSPRLLIRD---------ASSRANGIPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYSTSPYTFGQGTKLEIK............................................................................ 107
17 -58.000sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  19  1DIQMTQSPSSLSASVGDRVTITCQASQD-ISIFLNWYQQKPGKAPKLLIYD---------ASKLEAGVPSRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNLPLTFGGGTKVDFK............................................................................ 107
18 -58.000sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  24  1DIQMTQSPSSLSASVGDRVTITCRASQSISNY-LNWYQQKPGKAPKLLIYA---------ASSLQSGVTSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYSTLITFGQGTRLEIK............................................................................ 107
19 -58.000sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  19  1DIQMTQSPSSLSASVGDRVTITCRAGHNITNF-LSWYQQKPGKAPTLLIYA---------VSNLQVGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNFSFTFGGGTKVDNK............................................................................ 107
20 -58.000sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  22  5DIVMTQSPLSLPVTPGEPASISCRSSQSLGYNYLDWYLQKPQQSPQLLIYL---------GSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQTPQTFGQGTKVEIK............................................................................ 116
21 -57.900sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  19  1DIQMTQSPSSLSASVGDRVTITCRASQSISSY-LSWYQQKPGKAPQVLIYA---------ASSLPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYITPTSFGQGTRVEIK............................................................................ 107
22 -57.900sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  22  1DIVLTQSPLSLPVTPGEPASISCRSSQNLXGXYLDWYLXKPGXSPXLLIYL---------GSNRASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQTPLTFGGGTNVEIKR........................................................................... 112
23 -57.800sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  20  1DIQMTQSPSSLSASVGDRVTITCQASQDIRKH-LNWYDQKPGKAPRLLIY---------GASTLETGVPSRFSGSGSGTDFTLTISTLQPEDIGNYYCQQYDNVPITFGQGTRVENKG........................................................................... 108
24 -57.800sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  24  1DVVMTQSPLFLPVTLGEPASIQCRSSQSLGXTYLXWYLQKPGQSPELLIYL---------SSYRDSGVPDRFSDSGSGTDFTLKITRVQAEDVGVYYCMQATXSPYTFGQGTKLXIKR........................................................................... 113
25 -57.800sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  23  1DIVMTQSPLSLPVTPGEPASISCRSSQSLGFDYLNWYLQKPGQSPXLLIYA---------LSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQAPITFGQGTRLEIKR........................................................................... 113
26 -57.800sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  23  1DVVMTQSPLSLPVTLGQPASISCRSSQSLGNTYLNWFQQRPGQSPRRLIYK---------VSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWSWTFGQGTKVEIKR........................................................................... 113
27 -57.800sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  20  1DIQMTQSPSSLSVSVGDRVTITCQASQNVNAY-LNWYQQKPGLAPKLLIYG---------ASTREAGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYNNWPPTFGQGTKVEVK............................................................................ 107
28 -57.700sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  21  1DIQMTQSPSPLSASVGDSVTITCQASQDIRNS-LIWYQQKPGKAPKFLIY---------DAENLEIGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNLPYTFGQGTKLEIK............................................................................ 107
29 -57.700sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  18  1DIQMTQSPSSLSASVGDRVTIICRASQG-IRNDLTWYQQKPGKAPKELIYA---------ASNLQSGVPSRFSGSGAGTEFTLTISSLQPEDFATYYCLQQNSYPRSFGQGTKVEIK............................................................................ 107
30 -57.700sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  18  1DIQMTQSPSSLSASVGDRVTITCQASQDINHY-LNWYQQGPKKAPKILIYD---------ASNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKLEIK............................................................................ 107
31 -57.700sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  21  1DIQMTQSPSTQPASVGDRVTITCRASQS-INIWLAWYQQKPEKAPKLLIY---------KASTLETGVPSRFSGSGSGTEFTLTINSLQPDDFATYYCQQYSRYPYTFGQGTKLDIK............................................................................ 107
32 -57.700sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  20  1DIQMTQSPSSLSASVGDRVTITCRASQG-IRNDLTWYQQKPGTAPKRLIYG---------ATSLQSGVPSRFSGSGSGTEFTLTINSLQPEDFATYYCLQYSSFPWTFGQGTKVEVK............................................................................ 107
33 -57.600sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  20  1XIXMTQSPSSLSASVGDRVTITCRAGQS-VNKYLNWYQQKPGKAPKVLIFA---------ASSLKSGVPSRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTTPYTFGPGTKVEMT............................................................................ 107
34 -57.600sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  18  1DIQMTQSPSSLSASVGDRVTITCQASQDIIKY-LNWYQQTPGKAPKLLIYE---------ASNLQAGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSLPYTFGQGTKLQITR........................................................................... 108
35 -57.600sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  19  1DIQMTQSPSSLSASVGDRVTITCQASQDISDY-LNWYQQKPGKAPKLLIYD---------ASNLESGVPSRFSGGGSGAHFTFTISSLQPEDIATYYCQQYDYLPWTFGQGTKVEIK............................................................................ 107
36 -57.600sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  24  1DIQLTQSPSSLSASVGDRVTITCRASQSVYNY-VAWFQQKPGKAPKSLIYD---------ASTLQSGVPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSYPYTFGQGTKVQIK............................................................................ 107
37 -57.500sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  23  1DIQMTQSPSSVSASVGDRVTITCRASQDISHW-LAWYQQKSGKAPKLLIY---------SASSLENGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQAHSVPLTFGGGTTVDIKR........................................................................... 108
38 -57.400sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  20  1DIQMTQSPSTLSVSVGDRVTITCEASQTVLSY-LNWYQQKPGKAPKLLIYA---------ASSLETGVPSRFSGQGSGTXFTFTISSVXPXXFATYYCQXYLDLPRTFGQGTKVDLK............................................................................ 107
39 -57.300sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  19  1DIQMTXSPSSLSASVGXRVTITCRASXTISSY-LXWYXXKPGKAPXLLIYA---------ASXLHSGVPSRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSSPTTFGXGTRLXIK............................................................................ 107
40 -57.300sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  24  2DIVMTQTPLSLPVTPGEPASISCRSSQSLGNTYLNWYLQKAGQSPQLLIYT---------LSYRASGVPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEIPYTFGQGTKLEIR............................................................................ 114
41 -57.200sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  17  1DIQMTQSPSSLSATVGDRVTLLCEASQSVGNTFLAWYQQKPKKAPKLLIYD---------ASNLETGVPSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLPSTFGVASKVESK............................................................................ 111
42 -56.500sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.QSVLTQPPSLSAAPGQRVSISCSGSSNIGKNYVDWYQQLPGTAPKLLIFN---------NNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNRRSVFGGGTNVTVVG........................................................................... 109
43 -56.400sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  17  1.QSVLTQPPSASGTPGQRVTISCFGSSSNGRYYVYWYQQLPGTTPKLLIYK---------DNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLWVFGGGTTLTVLS........................................................................... 109
44 -56.300sp|P83593|KV405_HUMAN Ig kappa chain V-IV region STH (Fragment) OS=Homo sapiens PE=1 SV=1  ali follow..  17  1DIVMTQSPDSLVVSLGERATINCRSSQSVNKNYLAWYQQKPGQAPKLLFSW---------ASTRESGVPDRFSGSGSGTDFTLTIPGLQAEDVAVYYCQQYYRIPYTFGQGAK................................................................................ 109
45 -56.100sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  14  1.QSALTQPRSVSGSPGQSLTISCSGAPCDGCESVSWYQQHPGKAPKLIIYG---------FSNRPSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADSSVIFGAGTKLTVLR........................................................................... 110
46 -56.000sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  20  1SYELTQPP-SVSVSPGQTARITCSANAL-PNQYAYWYQQKPGRAPVMVIYK---------DTQRPSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNSASIFGGGTKLTVLG........................................................................... 107
47 -55.900sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  23  1DVQMTQSPSSLSASVGDRVIITCRASQS-SVDYLNWYQQKPGKAPKLLIFD---------TSNLQSGVPSRFSGGRSGTDFTLTISSLQPDDFATYYCQQSTNPEVTFGGGTTVDIK............................................................................ 108
48 -55.900sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  19  1DIQMTQSPSTLSASVGDRVAITCRASQNISSW-LAWYQQKPGKAPKVLIYK---------SSSLESGVPSRFSGSGSGTDFTLTISSLXPXXFATYYCQQYNTF-FTFGPGTKVDIK............................................................................ 106
49 -55.500sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  18  1DIVMTQSPDSLAVSLGERATINCKSSQSVNKNYLAWYQQKPGQPPKLLIYW---------ASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP-TFGGGTKVEIK............................................................................ 112
50 -55.300sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  20  2..ALTQPP-SVSVSPGQTAVITCSGDNL-EKTFVSWFQQRPGQSPLLVIYH---------TSERPSEIPERFSGSSSGATATLTISGAQSVDEADYFCQTWDTITAIFGGGTKLTVLS........................................................................... 106
51 -55.100sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  20  2..DLTQPP-SVSVSPGQTASITCSGDKL-GDKDVCWYQQRPGQSPVLVIYQ---------DNQRSSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSMSVVFGGGTRLTVLS........................................................................... 106
52 -55.100sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  22  1EIVMTQSPATLSVSPGERATLSCRASQS-VSNNLAWYQQKPGQPPRLLIYG---------ASTRATGIPARFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNPPWTFGQGTRVEIK............................................................................ 108
53 -55.000sp|P01715|LV401_HUMAN Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1  ali follow..  19  2..GLTQPP-SLSVSPGQTASITCSGDKL-GEQYVCWYQQKPGQSPVLVIYH---------DSKRPSGIPERFSGSNSGTTATLTISGTQAMDEADYYCQAWDSYTVIFGGGTKLTVLG........................................................................... 106
54 -54.600sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  19  1ASALTQ-PRSLSGSPGQAVTISCTGLPSVDDNFVSWYQQTPGRAPRLLIYD---------DSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGNYIVFGQGTDLTVLG........................................................................... 111
55 -54.600sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  18  1.QSVLTQPPSVSGTPGQRVTISCSGGSSTGNNYVYWYQQLPGTAPKLLIYR---------DDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRAVVFGGGTQLTVLR........................................................................... 112
56 -54.300sp|P06889|LV405_HUMAN Ig lambda chain V-IV region MOL OS=Homo sapiens PE=1 SV=1  ali follow..  19  2..ELTQPP-SVSVSPGQTATISCSGDKL-GESYYDWYQQSPGQSPLLVIY---------EGDKRPSGIPXRFSGSNSGNTATLTISGTESMDEADYYCQAWNSSSVLFGGGTKLTVLG........................................................................... 106
57 -54.300sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  18  1.QSVLTQPPSASGTPGGRVTISCSGSSSNSNXPAYWYQQLPGTAPKLLIYN---------YNQRPSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSGYVFGTGTKVTVLR........................................................................... 112
58 -54.300sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.QSVLTQPPSVSAAPGQKVTISCSGGSNIGNNYVSWHQHLPGTAPKLLIYE---------DNKRPSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSAVVFGGGTKVTVLG........................................................................... 111
59 -54.200sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  16  1.QSVLTQPPSVSAAPGQKVTISCSGSSNIGNDYVSWYQQVPGTAPKLLIYD---------NNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSGWVFGGGTKLTVLG........................................................................... 111
60 -54.200sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.QSALTQPASVSGSPGQSITISCTGTTSDGYDFVSWYQQHPGKAPKLLIYD---------VNSRPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSTTNSRAVFGGGTKLSVLG........................................................................... 112
61 -54.100sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.QSALTQPRSVSGSPGQSVTISCTGTSSDAYNSVSWYQQHPGKAPKLMIFD---------VTKRPSGVPDRLSGSKSGDTASLTISGLRADDEADYYCCSYGRYSVIFGGGTKLTVLG........................................................................... 111
62 -54.100sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  15  1.QSVLTQPPSVSAAPGQEVTISCSGSSNIGDNFVSWYQQLPGTAPKLLIYD---------NNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSVGMFGGGTRVTVLG........................................................................... 111
63 -54.000sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  18  1.HSALTQPASVSGSLGQSITISCTGTSSDGYNYVSWFQQHPGTAPKLIISE---------VRNRPSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYSSNSVVFGGGTKLTVLG........................................................................... 111
64 -54.000sp|P01703|LV105_HUMAN Ig lambda chain V-I region NEWM OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.QSVLTQPPSVSGAPGQRVTISCTGSSSNAGNHVKWYQQLPGTAPKLLIFH----------------NNARFSVSKSGSSATLAITGLQAEDEADYYCQSYDRSLRVFGGGTKLTVLR........................................................................... 103
65 -54.000sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  18  1.QSALTQPRSVSGSPGQSVTISCAGTSSGGNHFVSWYQQHPGKAPKLIIY---------GVNKRPSGVPYRFSGSKSGNTASLTISGLQAEDEAHYYCCSYGRFTWVFGGGTNLTVLG........................................................................... 111
66 -54.000sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  17  1.QSALTQPASVSGSPGQSITISCTGTTSDSYNFVSWYQQNPGKAPKLMIY---------EGNKRPSGVSNRFSGSKSGKTASLTISGLQVEDEADYYCCSYGNSTRVFGGGTRVTVLS........................................................................... 111
67 -53.900sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  19  1QSALTQPP-RVSGSPGQSVTISCTGSYSNGYNHVSWYQQDPGKVPKLMIYD---------VDKRPSGVPDRFSGSKSANTASLTISGLQANNEADYYCSSYGTYSLIFGGGTKLTVLG........................................................................... 111
68 -53.900sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  17  2TFYELTQPPSVSLAAGQTAMITCEGNDI-GERSVHWYQQKPGQAPVPVIYD---------DADRPSGVPARFSGYNSGNSAILTINRVEAGDEADYFCQSWDNGEVVFGTGTMVTVLG........................................................................... 111
69 -53.800sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  17  1.QSALTQPPSASGSLGQSVTISCTGTSSDGYNYVSWYQQHAGKAPKVIIYE---------VNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYGSDNFVFGTGTKVTVLG........................................................................... 111
70 -53.800sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  17  1.QSALTQPASVSASPGQSITISCTGTTNDSYSYVSWYQQYPGKAPKVLIF---------DVNSRPSGVSHRFSGSKSGNTASLTISGLQAEDEAHYFCSSYTSGTIIFGGGTYVTVLR........................................................................... 111
71 -53.700sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  19  1QSALTQPP-SASGSPGQSVTISCTGTSSDDNKYVSWYQQHPGRAPKLVIFE---------VSQRPSGVPDRFSGSKSDNTASLTVSGLRAEDEADYYCSSYDNNNFVFGGGTKLTVLR........................................................................... 111
72 -53.400sp|P01708|LV205_HUMAN Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  15  1.QSALTQPRSVSGSPGHSVTISCIGTSSNDYKYVSWYQQHPGKAPKLIIYE---------VSSRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYIGS-YVFGTGTKVIVLG........................................................................... 109
73 -53.400sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  21  1.SELTQDP-AVSVALGQTVRITCQGDSL-RGYDAAWYQQKPGQAPLLVIY---------GRNNRPSGIPDRFSGSSSGHTASLTITGAQAEDEADYYCNSRDSSHVLFGGGTKLTVLG........................................................................... 108
74 -53.200sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  13  1.QSVLTQPPSASGTPGQRVTISCSGGNDIGRNSVNWYQVHPGTAPRLLIYS---------SDQRSSGVPDRFSGSKSGTSASLAISGLQSENEADYFCATWDDSGPVFGGGTKVTVLG........................................................................... 111
75 -53.100sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  15  2...VLSQPPSVSVAPGQTARITCGGDGI-GGKSVHWYQQKPGQAPVLVVHE---------DNDRPAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRHVVFGGGTKLTVLG........................................................................... 108

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 4 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.